Metagenome Family F071770

Basic Information
Family ID	F071770
Family Type	Metagenome
Number of Sequences	122
Average Sequence Length	45 residues
Representative Sequence	KRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV
Number of Associated Samples	99
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.82 %
% of genes near scaffold ends (potentially truncated)	95.08 %
% of genes from short scaffolds (< 2000 bps)	91.80 %
Associated GOLD sequencing projects	92
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Bacteria (72.951 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (9.836 % of family members)
Environment Ontology (ENVO)	Unclassified (42.623 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (51.639 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF13360	PQQ_2	6.56
PF13709	DUF4159	3.28
PF00069	Pkinase	3.28
PF01979	Amidohydro_1	2.46
PF03781	FGE-sulfatase	2.46
PF00692	dUTPase	2.46
PF06172	Cupin_5	1.64
PF00575	S1	1.64
PF07690	MFS_1	1.64
PF00144	Beta-lactamase	1.64
PF09180	ProRS-C_1	1.64
PF03551	PadR	1.64
PF00106	adh_short	1.64
PF13460	NAD_binding_10	0.82
PF13000	Acatn	0.82
PF07676	PD40	0.82
PF14534	DUF4440	0.82
PF07853	DUF1648	0.82
PF00529	CusB_dom_1	0.82
PF13649	Methyltransf_25	0.82
PF13290	CHB_HEX_C_1	0.82
PF08241	Methyltransf_11	0.82
PF07883	Cupin_2	0.82
PF13557	Phenol_MetA_deg	0.82
PF13365	Trypsin_2	0.82
PF01263	Aldose_epim	0.82
PF12779	WXXGXW	0.82
PF06057	VirJ	0.82
PF13860	FlgD_ig	0.82
PF13466	STAS_2	0.82
PF13826	DUF4188	0.82
PF00486	Trans_reg_C	0.82
PF06983	3-dmu-9_3-mt	0.82
PF13493	DUF4118	0.82
PF00583	Acetyltransf_1	0.82
PF13376	OmdA	0.82
PF01436	NHL	0.82
PF13564	DoxX_2	0.82
PF00072	Response_reg	0.82
PF12121	DD_K	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	13.11
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	2.46
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	2.46
COG1262	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain	Posttranslational modification, protein turnover, chaperones [O]	2.46
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	1.64
COG3542	Predicted sugar epimerase, cupin superfamily	General function prediction only [R]	1.64
COG2367	Beta-lactamase class A	Defense mechanisms [V]	1.64
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	1.64
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	1.64
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	1.64
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.64
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	1.64
COG2017	Galactose mutarotase or related enzyme	Carbohydrate transport and metabolism [G]	0.82
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	0.82
COG0676	D-hexose-6-phosphate mutarotase	Carbohydrate transport and metabolism [G]	0.82
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	0.82
COG3946	Type IV secretory pathway, VirJ component	Intracellular trafficking, secretion, and vesicular transport [U]	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.95 %
Unclassified	root	N/A	27.05 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.95 %
Unclassified	root	N/A	27.05 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.95 %
Unclassified	root	N/A	27.05 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	35.25 %
Unclassified	root	N/A	27.05 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.30 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	18.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.92 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.46 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.82 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.82 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.11 %
Parvularculales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales	3.28 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	2.46 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	1.64 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	1.64 %
Acidobacteria bacterium SCN 69-37	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	0.82 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.82 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.82 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.82 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.82 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.82 %
Oceanospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales	0.82 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.11 %
Parvularculaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae	3.28 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	2.46 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.64 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	1.64 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	0.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.82 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.82 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.82 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.82 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.82 %
Acidobacteria bacterium SCN 69-37	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	0.82 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.11 %
Parvularcula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	3.28 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	2.46 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.64 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	1.64 %
Pseudoroseicyclus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus	0.82 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	0.82 %
Pseudogulbenkiania	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Pseudogulbenkiania	0.82 %
Amphritea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Amphritea	0.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.82 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.82 %
Acidobacteria bacterium SCN 69-37	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	0.82 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.11 %
Parvularcula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	3.28 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	2.46 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.64 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	1.64 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.82 %
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	0.82 %
unclassified Pseudogulbenkiania	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Pseudogulbenkiania → unclassified Pseudogulbenkiania	0.82 %
Amphritea balenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Amphritea → Amphritea balenae	0.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.82 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.82 %
Acidobacteria bacterium SCN 69-37	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	0.82 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.05 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.11 %
Parvularcula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	3.28 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	2.46 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.64 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	1.64 %
Candidatus Sulfopaludibacter sp. SbA6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6	0.82 %
Pseudogulbenkiania sp. NH8B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Pseudogulbenkiania → unclassified Pseudogulbenkiania → Pseudogulbenkiania sp. NH8B	0.82 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.82 %
Amphritea balenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Amphritea → Amphritea balenae	0.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.82 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.82 %
Acidobacteria bacterium SCN 69-37	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	0.82 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c0331514	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	601	Open in IMG/M
3300000891\|JGI10214J12806_11154079	All Organisms → cellular organisms → Bacteria → Acidobacteria	872	Open in IMG/M
3300000956\|JGI10216J12902_100478837	Not Available	922	Open in IMG/M
3300000956\|JGI10216J12902_105954769	All Organisms → cellular organisms → Bacteria → Acidobacteria	2790	Open in IMG/M
3300000956\|JGI10216J12902_113111190	Not Available	2355	Open in IMG/M
3300001431\|F14TB_100685667	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300004114\|Ga0062593_101179383	All Organisms → cellular organisms → Bacteria → Acidobacteria	802	Open in IMG/M
3300004156\|Ga0062589_101057364	All Organisms → cellular organisms → Bacteria → Acidobacteria	764	Open in IMG/M
3300004479\|Ga0062595_100431171	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	959	Open in IMG/M
3300004479\|Ga0062595_101319522	Not Available	651	Open in IMG/M
3300004643\|Ga0062591_100354466	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1188	Open in IMG/M
3300005169\|Ga0066810_10184083	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	517	Open in IMG/M
3300005290\|Ga0065712_10153392	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300005330\|Ga0070690_100108850	All Organisms → cellular organisms → Bacteria	1846	Open in IMG/M
3300005331\|Ga0070670_101322133	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005331\|Ga0070670_101331637	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300005339\|Ga0070660_100781661	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	802	Open in IMG/M
3300005354\|Ga0070675_102171499	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300005355\|Ga0070671_101366193	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	625	Open in IMG/M
3300005364\|Ga0070673_100121564	All Organisms → cellular organisms → Bacteria	2179	Open in IMG/M
3300005366\|Ga0070659_101499769	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6	601	Open in IMG/M
3300005436\|Ga0070713_101408439	All Organisms → cellular organisms → Bacteria → Acidobacteria	676	Open in IMG/M
3300005444\|Ga0070694_100508300	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	960	Open in IMG/M
3300005445\|Ga0070708_100755176	Not Available	915	Open in IMG/M
3300005457\|Ga0070662_101359123	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300005458\|Ga0070681_11046091	All Organisms → cellular organisms → Bacteria → Acidobacteria	737	Open in IMG/M
3300005467\|Ga0070706_101915203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Amphritea → Amphritea balenae	538	Open in IMG/M
3300005526\|Ga0073909_10186292	All Organisms → cellular organisms → Bacteria → Acidobacteria	889	Open in IMG/M
3300005539\|Ga0068853_101024527	All Organisms → cellular organisms → Bacteria → Proteobacteria	795	Open in IMG/M
3300005543\|Ga0070672_100824359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	817	Open in IMG/M
3300005544\|Ga0070686_100497460	Not Available	945	Open in IMG/M
3300005546\|Ga0070696_100796024	Not Available	778	Open in IMG/M
3300005564\|Ga0070664_100764162	All Organisms → cellular organisms → Bacteria → Acidobacteria	902	Open in IMG/M
3300005564\|Ga0070664_101897819	Not Available	565	Open in IMG/M
3300005616\|Ga0068852_101816620	All Organisms → cellular organisms → Bacteria → Acidobacteria	632	Open in IMG/M
3300005617\|Ga0068859_102308856	Not Available	593	Open in IMG/M
3300005719\|Ga0068861_100675986	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300005719\|Ga0068861_101973230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Pseudogulbenkiania → unclassified Pseudogulbenkiania → Pseudogulbenkiania sp. NH8B	582	Open in IMG/M
3300006049\|Ga0075417_10423934	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300006845\|Ga0075421_101999110	Not Available	618	Open in IMG/M
3300006876\|Ga0079217_11635113	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	516	Open in IMG/M
3300006894\|Ga0079215_11215253	Not Available	575	Open in IMG/M
3300006969\|Ga0075419_10766032	Not Available	688	Open in IMG/M
3300007004\|Ga0079218_12498524	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37	610	Open in IMG/M
3300009148\|Ga0105243_11090272	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	806	Open in IMG/M
3300009162\|Ga0075423_11696644	Not Available	680	Open in IMG/M
3300009609\|Ga0105347_1114085	All Organisms → cellular organisms → Bacteria → Acidobacteria	1029	Open in IMG/M
3300010037\|Ga0126304_10096228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	1866	Open in IMG/M
3300010040\|Ga0126308_11131288	All Organisms → cellular organisms → Bacteria → Proteobacteria	552	Open in IMG/M
3300010045\|Ga0126311_11816130	Not Available	517	Open in IMG/M
3300010373\|Ga0134128_12819413	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	535	Open in IMG/M
3300010397\|Ga0134124_10479072	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1200	Open in IMG/M
3300010401\|Ga0134121_11034683	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	809	Open in IMG/M
3300011424\|Ga0137439_1171750	Not Available	513	Open in IMG/M
3300012166\|Ga0137350_1105679	All Organisms → cellular organisms → Bacteria → Acidobacteria	570	Open in IMG/M
3300012232\|Ga0137435_1256056	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	531	Open in IMG/M
3300012469\|Ga0150984_104722583	Not Available	507	Open in IMG/M
3300012469\|Ga0150984_110772454	Not Available	591	Open in IMG/M
3300012469\|Ga0150984_111292727	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300012906\|Ga0157295_10120856	All Organisms → cellular organisms → Bacteria → Proteobacteria	747	Open in IMG/M
3300012955\|Ga0164298_11307872	Not Available	556	Open in IMG/M
3300012960\|Ga0164301_10908446	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	684	Open in IMG/M
3300013306\|Ga0163162_10569157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	1260	Open in IMG/M
3300013306\|Ga0163162_12376336	Not Available	609	Open in IMG/M
3300014325\|Ga0163163_12407551	Not Available	585	Open in IMG/M
3300015200\|Ga0173480_10006712	All Organisms → cellular organisms → Bacteria	4552	Open in IMG/M
3300015200\|Ga0173480_10155127	All Organisms → cellular organisms → Bacteria → Acidobacteria	1173	Open in IMG/M
3300015357\|Ga0134072_10293721	All Organisms → cellular organisms → Bacteria → Acidobacteria	603	Open in IMG/M
3300015372\|Ga0132256_100652831	Not Available	1167	Open in IMG/M
3300015372\|Ga0132256_103021288	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300015372\|Ga0132256_103283081	Not Available	544	Open in IMG/M
3300015373\|Ga0132257_100100517	All Organisms → cellular organisms → Bacteria	3328	Open in IMG/M
3300015373\|Ga0132257_100229208	All Organisms → cellular organisms → Bacteria	2211	Open in IMG/M
3300015373\|Ga0132257_100924385	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1094	Open in IMG/M
3300018067\|Ga0184611_1169994	Not Available	774	Open in IMG/M
3300018068\|Ga0184636_1300631	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	565	Open in IMG/M
3300018422\|Ga0190265_13422661	Not Available	529	Open in IMG/M
3300018469\|Ga0190270_10855388	All Organisms → cellular organisms → Bacteria	922	Open in IMG/M
3300018481\|Ga0190271_13099839	All Organisms → cellular organisms → Bacteria → Acidobacteria	557	Open in IMG/M
3300020016\|Ga0193696_1069366	Not Available	919	Open in IMG/M
3300022756\|Ga0222622_10048754	All Organisms → cellular organisms → Bacteria → Proteobacteria	2379	Open in IMG/M
3300022886\|Ga0247746_1147581	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300025315\|Ga0207697_10275820	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300025907\|Ga0207645_10223373	All Organisms → cellular organisms → Bacteria → Proteobacteria	1242	Open in IMG/M
3300025920\|Ga0207649_10049488	Not Available	2596	Open in IMG/M
3300025925\|Ga0207650_10665321	Not Available	878	Open in IMG/M
3300025925\|Ga0207650_11038383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	697	Open in IMG/M
3300025926\|Ga0207659_10103772	All Organisms → cellular organisms → Bacteria	2149	Open in IMG/M
3300025926\|Ga0207659_10388484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	1165	Open in IMG/M
3300025926\|Ga0207659_10848242	Not Available	785	Open in IMG/M
3300025933\|Ga0207706_10252435	All Organisms → cellular organisms → Bacteria	1540	Open in IMG/M
3300025933\|Ga0207706_11219842	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300025937\|Ga0207669_10731559	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300025940\|Ga0207691_11512322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Parvularcula	548	Open in IMG/M
3300025941\|Ga0207711_10610111	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1018	Open in IMG/M
3300025972\|Ga0207668_10400521	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300025981\|Ga0207640_11091751	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	705	Open in IMG/M
3300026078\|Ga0207702_11317703	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300026121\|Ga0207683_10723388	All Organisms → cellular organisms → Bacteria → Acidobacteria	923	Open in IMG/M
3300026142\|Ga0207698_11743664	All Organisms → cellular organisms → Bacteria → Acidobacteria	638	Open in IMG/M
3300027639\|Ga0209387_1169786	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	583	Open in IMG/M
3300027787\|Ga0209074_10433632	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	558	Open in IMG/M
3300027886\|Ga0209486_10079727	All Organisms → cellular organisms → Bacteria → Acidobacteria	1700	Open in IMG/M
3300028802\|Ga0307503_10228857	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	897	Open in IMG/M
3300029923\|Ga0311347_10899742	Not Available	538	Open in IMG/M
3300031547\|Ga0310887_11055161	Not Available	520	Open in IMG/M
3300031716\|Ga0310813_11250124	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	685	Open in IMG/M
3300031740\|Ga0307468_101832734	All Organisms → cellular organisms → Bacteria → Acidobacteria	576	Open in IMG/M
3300031854\|Ga0310904_10236344	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300031908\|Ga0310900_11096795	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300031908\|Ga0310900_11902643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	507	Open in IMG/M
3300032003\|Ga0310897_10158301	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	957	Open in IMG/M
3300032003\|Ga0310897_10312945	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300032003\|Ga0310897_10542113	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300032013\|Ga0310906_10280121	All Organisms → cellular organisms → Bacteria → Acidobacteria	1055	Open in IMG/M
3300032017\|Ga0310899_10137860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1028	Open in IMG/M
3300032017\|Ga0310899_10188788	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300032075\|Ga0310890_10702161	Not Available	792	Open in IMG/M
3300032179\|Ga0310889_10026272	Not Available	2089	Open in IMG/M
3300032180\|Ga0307471_102674545	Not Available	633	Open in IMG/M
3300032180\|Ga0307471_103095722	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300033408\|Ga0316605_11709494	Not Available	612	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	57.38%
Host-Associated	Host-Associated	42.62%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.64%
Plants	Host-Associated → Plants	42.62%
Aquatic	Environmental → Aquatic	5.74%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.11%
Sediment	Environmental → Aquatic → Sediment	5.74%
Peat	Environmental → Terrestrial → Peat	0.82%
Roots	Host-Associated → Plants → Roots	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.62%
Soil	Host-Associated → Plants → Rhizosphere → Soil	23.77%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.02%
Loam	Environmental → Terrestrial → Soil → Loam	7.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.28%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.82%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.82%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	23.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.39%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.84%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	9.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.02%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.92%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.10%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.46%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.82%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.82%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	9.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.02%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	6.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	6.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.10%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.10%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.28%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.28%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.46%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.46%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.46%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.46%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	2.46%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.46%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.64%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.64%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.82%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.82%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.82%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011424	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2	Environmental	Open in IMG/M
3300012166	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2	Environmental	Open in IMG/M
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300029923	II_Fen_E1 coassembly	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F071770

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_03315141	2228664021	Soil	HRTKKRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD
JGI10214J12806_111540792	3300000891	Soil	NKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKATLPPAVG*
JGI10216J12902_1004788373	3300000956	Soil	RIAAAPAAGRAALEAKVQRTYSSSHSMMKEKPPPEVV*
JGI10216J12902_1059547694	3300000956	Soil	VAKREKLRARIAAAPTGRAAFEAKLLRTYSPFHTMTKEKLPPTVV*
JGI10216J12902_1131111904	3300000956	Soil	KKRDKLRARIAAAPATERAALEARVQRTYSPFHSVMKQKLP*
F14TB_1006856671	3300001431	Soil	ARIAAAPAAGRAALEARVQRTYSPFHPLTKEKPPPPVV*
Ga0062593_1011793831	3300004114	Soil	KKRNKLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV*
Ga0062589_1010573641	3300004156	Soil	QHRAKKRNKLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV*
Ga0062595_1004311712	3300004479	Soil	KLRARIAAAPATGRAALEAKVQRTYSAFHSKTKEKLPPAVV*
Ga0062595_1013195221	3300004479	Soil	QHRAKKRNKLRARIAAAPANGRAALEARVLRTYSPFHSVMKEKLP*
Ga0062591_1003544661	3300004643	Soil	KRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD*
Ga0066810_101840831	3300005169	Soil	KLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV*
Ga0065712_101533921	3300005290	Miscanthus Rhizosphere	VKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV*
Ga0070690_1001088503	3300005330	Switchgrass Rhizosphere	QHRAKKRNKLRARIAAAPATGRAALEIKVQRTYSPFHSTMKEKLPTEVVSPAE*
Ga0070670_1013221332	3300005331	Switchgrass Rhizosphere	RQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRTMKEKPPPALV*
Ga0070670_1013316372	3300005331	Switchgrass Rhizosphere	LRQHRSKKRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA*
Ga0070660_1007816612	3300005339	Corn Rhizosphere	HLRQHRAKKRNKLRARIAAAPAAARAALEAKLQRTYSPLHTMTKE*
Ga0070675_1021714992	3300005354	Miscanthus Rhizosphere	QYRKAKRDKLRARIAAASVSATGRAAFEAKLQRTYSPFHMMMKEKLPPTVV*
Ga0070671_1013661931	3300005355	Switchgrass Rhizosphere	KKRNKLRARIAAAPATGRAALEIKVQRTYSPFHSTMKEKLPTEVVSPAE*
Ga0070673_1001215643	3300005364	Switchgrass Rhizosphere	RQHRAKKRHKLRARIAAAPTTGRAALETKVQRTYSAFHSIMKEKTPPAVV*
Ga0070659_1014997691	3300005366	Corn Rhizosphere	HRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPFHSMKREKLPQAVV*
Ga0070713_1014084392	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	KKRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMREKLPPAVV*
Ga0070694_1005083001	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	KKRNKLRARIAAAPATGRAALEAKVQRTYSLSHSMMREKLPPAVV*
Ga0070708_1007551761	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	RAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRMMKEKLPPALV*
Ga0070662_1013591232	3300005457	Corn Rhizosphere	QHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV*
Ga0070681_110460911	3300005458	Corn Rhizosphere	KLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPTVV*
Ga0070706_1019152031	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	RQHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV*
Ga0073909_101862921	3300005526	Surface Soil	LRARIAAAPAAGRAALEAKVQRTYSPFHRMTEEKLPPAVV*
Ga0068853_1010245273	3300005539	Corn Rhizosphere	HRAKKRAKLRARIAAAPAAGRAALEAKVEKAYSPFHSKMKEKPSPPEL*
Ga0070672_1008243591	3300005543	Miscanthus Rhizosphere	KKRNKLRARIAAAPATGRAALEARVLRTYSAFHSTREKLPPAPG*
Ga0070686_1004974601	3300005544	Switchgrass Rhizosphere	RAKKRNKLRARIAAAPAVAVAALEARVQRTYSPFHSMREKLPRAVL*
Ga0070696_1007960241	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	RQHRAKKRNKLRARIAAAPAAGRAALETKLQRTYSPSHSMKETLPPAVV*
Ga0070664_1007641622	3300005564	Corn Rhizosphere	HRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPSHSMMKEKLPPTVV*
Ga0070664_1018978191	3300005564	Corn Rhizosphere	LRARIAAAPMVGRAALEAKVQRTYSAFHVPAKLKPPPAAV*
Ga0068852_1018166201	3300005616	Corn Rhizosphere	LRQHRAKKRNKLRARIAAAPATGRAALEARVQRTYSPFHSMREKLPGTVI*
Ga0068859_1023088562	3300005617	Switchgrass Rhizosphere	RNKLRARIAAAPAGGRAVLEAKVLKTYSAFHSLTKEKSTPEAV*
Ga0068861_1006759861	3300005719	Switchgrass Rhizosphere	LRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPAGV*
Ga0068861_1019732302	3300005719	Switchgrass Rhizosphere	QHRVKKRNKLRARIAAASPTGRAALEARVQRTYSPFHSMQREKLPQAVV*
Ga0075417_104239341	3300006049	Populus Rhizosphere	KRNKLRARIAASPSGRAAFEAKLQRTYSPFHSMMKEKLPPAVV*
Ga0075421_1019991101	3300006845	Populus Rhizosphere	KLRARIAAAPASGRAALEAKVQRTYSRSHSMMKEKLPPAVV*
Ga0079217_116351132	3300006876	Agricultural Soil	KKRNKLRARIAAAPSTGRAALEAKVQRTYSPFHSVMKETLPPAVV*
Ga0079215_112152531	3300006894	Agricultural Soil	RQHRVAKRNKLRARIAAEPAGRAAFEAKLQRTYSPFHTMTKEKLPPTVV*
Ga0075419_107660322	3300006969	Populus Rhizosphere	LRARIAAAPATGRAALEAKVQRTYSSSHSMVKEKLPPAVA*
Ga0079218_124985242	3300007004	Agricultural Soil	RARIAAAPASGRAALEAKVQRTYSAFNSTSKEKQPPTTA*
Ga0105243_110902721	3300009148	Miscanthus Rhizosphere	LRQHRAKKRNKLRARIAAAPAAGRAALEAKVLRTYSSSHSVMKEKVPPTVL*
Ga0075423_116966441	3300009162	Populus Rhizosphere	KKRNKLRARIAAASATGRAVLEAKLQRTYSYSHSTTKKNLPPAVV*
Ga0105347_11140852	3300009609	Soil	VEKRNKLRARIAATPATGRAALEARLQRTYSPFHSMMKEKEKLPPVVA*
Ga0126304_100962282	3300010037	Serpentine Soil	VAKRHKLRARIAAAPAGRAAFEAKLQRTYSPFHTMLKEKLPPTVV*
Ga0126308_111312881	3300010040	Serpentine Soil	HRAKKRNKLRARIAAAPATGRAALELKVQRTYSPFHSMMKEKLPPAVV*
Ga0126311_118161302	3300010045	Serpentine Soil	VAKRNKLRARIAAAPAGRAAFEAKLQRTYSPFHTMLKE
Ga0134128_128194131	3300010373	Terrestrial Soil	LRARIAAAPAIGRAALEAKLQRTYSPFHTMTKEKLPPAPD*
Ga0134124_104790723	3300010397	Terrestrial Soil	RQHRAKKRDKLRARIAAAPTTGRAALEAKVQRTYSPSHSMMKEKLPPAVV*
Ga0134121_110346831	3300010401	Terrestrial Soil	RDKLRARIAAAPATVRAALEAKVQRTYSAFHSKTKEKLPPAVV*
Ga0137439_11717501	3300011424	Soil	KRNKLRARIAAAPAAGRATLEAKVLRTYSPFHSMMKEKLPRGVV*
Ga0137350_11056791	3300012166	Soil	KLRARIAAAPATGRAALEARLQRTYSPFHSMMKEKLPPTVV*
Ga0137435_12560563	3300012232	Soil	RQHRAKKRNKLRARIAAGPATGVAALEAKVLRTYSAFHSLMKEKQPPETV*
Ga0150984_1047225832	3300012469	Avena Fatua Rhizosphere	KRAKLRARIAAAPAAGRAALEARVQRTYSPFHVMRDELPKVAAK*
Ga0150984_1107724541	3300012469	Avena Fatua Rhizosphere	RQHRAKKRDKLRARIAAAPAIGRAALEAKMQRTYSPFHMKEKLPPTVV*
Ga0150984_1112927271	3300012469	Avena Fatua Rhizosphere	RNKLRARIAAAAPAARAALEARVLRTYSAFHTAQKEKQPPADA*
Ga0157295_101208561	3300012906	Soil	KLRARIAAAPAAGRAPLEARVLRTYSAFHREMKEKLTPAPVEP*
Ga0164298_113078721	3300012955	Soil	TKKRDKLRARIAASPLVGRAALEARVLRTYSPFHVPAKQKLPPVVV*
Ga0164301_109084461	3300012960	Soil	KRNKLRARIAAAPPTGRAALEARVQRTYSPFHSMKREKLPQAVV*
Ga0163162_105691571	3300013306	Switchgrass Rhizosphere	RNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA*
Ga0163162_123763362	3300013306	Switchgrass Rhizosphere	LRQHRVKKRNKLRARIAAAPPNGRAALEARVLRTYSPFHSMKEKLPRAG*
Ga0163163_124075512	3300014325	Switchgrass Rhizosphere	REKKRNKLRARIAAAPAAGRAALEARVLRTYSPFHSLREKLPRAVV*
Ga0173480_100067123	3300015200	Soil	KKRDKLRARIAAAPATGRAVLEAKVLRTYSPFHSAMRAKLPPAAV*
Ga0173480_101551271	3300015200	Soil	KRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA*
Ga0134072_102937212	3300015357	Grasslands Soil	KKLRAQIAAAPATGRAALEAKVQRTYSPFHMVMKEKLPPAIV*
Ga0132256_1006528311	3300015372	Arabidopsis Rhizosphere	QHRAKKRHKLRARIAAAPTTGRAALEAKVQRTYSAFHSITKEKTPPAVV*
Ga0132256_1030212882	3300015372	Arabidopsis Rhizosphere	RHRVKKRNKLRARIAAAPATGRAALEARLQRTYSAFHTATKEKPPPTEV*
Ga0132256_1032830811	3300015372	Arabidopsis Rhizosphere	KRDKLRARIAAAPPTGRAPLEAKMQRTYSASHSMMKENSPPEAV*
Ga0132257_1001005171	3300015373	Arabidopsis Rhizosphere	KRAKLRARIAAGPANGRAALEARVLRTYSPFHSMKEKLPRAG*
Ga0132257_1002292085	3300015373	Arabidopsis Rhizosphere	RAKKRAKLRARIAAAPAAGRAALEAKVQRTYSSSHSMMKEKLPPAAV*
Ga0132257_1009243853	3300015373	Arabidopsis Rhizosphere	AAAPATGRAALEAKVQRTYSPSHRMMKEKLPPALV*
Ga0184611_11699941	3300018067	Groundwater Sediment	HRAKKRNKLRARIAAAPATGRATLEAKVQRTYSTSHSMMKEKLPPAVA
Ga0184636_13006312	3300018068	Groundwater Sediment	RIAAAPASGRAALEARVLRTYSAFHSTREKLPPAAV
Ga0190265_134226612	3300018422	Soil	LRQHRAKKRDKLRARIAAAPAAGRAALEAKVQRTYSPFHSTTKETPPPAVV
Ga0190270_108553882	3300018469	Soil	TSASTSNEEANKLRARIAAAPATGRVALEARLQRTYSAFHSMMKEKPPPAAV
Ga0190271_130998392	3300018481	Soil	QHRRKKRDKLRARIAAKPAVGRAALEAKVLRTYSAFHFPAKEKPPVVAV
Ga0193696_10693661	3300020016	Soil	LRARIAAAPAAGRAALEAKVQRTYSSSHSMMKEKLPPAVV
Ga0222622_100487541	3300022756	Groundwater Sediment	ARIAAAPATGRAALEAKVLKTYSAFHSFLKEKAPPEAV
Ga0247746_11475811	3300022886	Soil	KLRARIAAAPATGRAELEAKLQRTYSPFHSMMKEKLPPVVV
Ga0207697_102758202	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	VKKRNKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV
Ga0207645_102233731	3300025907	Miscanthus Rhizosphere	KLRARIAAAPATGRAALEAKLQRTYSPSHSMMKEKLPPTVVEP
Ga0207649_100494882	3300025920	Corn Rhizosphere	RQHRAKKRNKLRARIAAAPASGRAALEAKVQRTYSPSHSMMKEKLPPTVV
Ga0207650_106653212	3300025925	Switchgrass Rhizosphere	RARIAASPMVGRAALEAKVQRTYSPFHKAAKAKLPPVVA
Ga0207650_110383831	3300025925	Switchgrass Rhizosphere	KRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA
Ga0207659_101037724	3300025926	Miscanthus Rhizosphere	RVKKRNKLRARIAAASPTGRAALEARVQRTYSPFHSMQREKLPQAVV
Ga0207659_103884842	3300025926	Miscanthus Rhizosphere	HRAKKRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA
Ga0207659_108482422	3300025926	Miscanthus Rhizosphere	KLRARIAAAPATGRAALEARVERTYSPFHSTMKEPLPPAVV
Ga0207706_102524351	3300025933	Corn Rhizosphere	ARIAASPTGKAAFEAKLQRTYSPFHTMAKEKLPPTVV
Ga0207706_112198422	3300025933	Corn Rhizosphere	RARIAAAPATARAALEARLQRTYSAFHTATKEKPPPTVV
Ga0207669_107315591	3300025937	Miscanthus Rhizosphere	NKLRARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV
Ga0207691_115123222	3300025940	Miscanthus Rhizosphere	QHRAKKRNKLRARIAASPMVGRAALEAKVLRTYSTFHVPAKEKVPPVVA
Ga0207711_106101112	3300025941	Switchgrass Rhizosphere	QHRLKKRNKLRARLASAPATGRAALEAKLLRTYSPFHSMMKEKQPPPAV
Ga0207668_104005212	3300025972	Switchgrass Rhizosphere	KLRARIAAAPAGGRAVLEAKVLKTYSAFHSLTKEKSTPEAV
Ga0207640_110917512	3300025981	Corn Rhizosphere	NKLRARIAAAPATARAALEAKVQRTYSPSHSMMKEKLPPTVV
Ga0207702_113177032	3300026078	Corn Rhizosphere	KLRARIAAAPASGRAALEAKLQRTYSPFHMMTKEKLPPAPD
Ga0207683_107233882	3300026121	Miscanthus Rhizosphere	LRQHRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPVVA
Ga0207698_117436641	3300026142	Corn Rhizosphere	LRQHRAKKRNKLRARIAAAPATGRAALEARVQRTYSPFHSMREKLPGTVI
Ga0209387_11697862	3300027639	Agricultural Soil	IAAAPAAGRAALEVKVQRTYSPFHSMMKEKLPPAVV
Ga0209074_104336321	3300027787	Agricultural Soil	IAAAPATGRAALEAKLLRTYSPFHSMMKAKLPPAAV
Ga0209486_100797271	3300027886	Agricultural Soil	KRNKLRARIAAAPATGRAALEAKVQRTYSPSHSMMKEKLPPAVV
Ga0307503_102288571	3300028802	Soil	YRLKKRNKLRARIAAAPASGRAALEARVLRTYSAFHSTREKLPPAAV
Ga0311347_108997421	3300029923	Fen	HRTKKRDKLRARIAAAPAVGRAALEAKVERTYSPFHIAAKEKLPPVVA
Ga0310887_110551611	3300031547	Soil	LLARIAAAPATGRAALEAKVQRTYSRSHSMMKEKLPPAVV
Ga0310813_112501241	3300031716	Soil	LRARIAAAPASERAALEAKVQRTYAPSHSMTKEKLPPPSV
Ga0307468_1018327342	3300031740	Hardwood Forest Soil	HRAKKRDKLRARIAAAPAGGRAVLEAKVQRTYSLFHSKAEEQLLPEVQR
Ga0310904_102363441	3300031854	Soil	SKKRDKLRARIAAAPATGRAALEAKVQRTYSPFHTMKAKVPPAEA
Ga0310900_110967951	3300031908	Soil	AKKRNKLRARIAAAPATGRAALEAKLQRTYSPFHSMMKEKLPPVVV
Ga0310900_119026431	3300031908	Soil	KLRARLAAAPATGRAALEAKLQRTYSPFHTMAKEKLPPAPD
Ga0310897_101583011	3300032003	Soil	KRNKLRARIAAAPASGRAALEAKLQRTYSPFHTMTKEKLPPAPD
Ga0310897_103129452	3300032003	Soil	RIAAASVSATGRAAFEAKLQRTYSPFHMMMKEKPPPTVV
Ga0310897_105421131	3300032003	Soil	RQHRVKKRNKLRARIAAAPASAGRAALEAKVLRTYSPFHSTATKKLPPEL
Ga0310906_102801211	3300032013	Soil	AKKRKKLRARIAAAPATGRASLEAKLQRTYSPFHSMMKEKLPPVVA
Ga0310899_101378602	3300032017	Soil	ARIAAAPATGRTTFEAKLLRTYSPFHTMMKEQLPPTVV
Ga0310899_101887881	3300032017	Soil	PHRVKKRNKLRARIAAAPASAGRAALEAKVLRTYSPFHSTATKKLPPEL
Ga0310890_107021611	3300032075	Soil	LRARIAAAPTTGRAALETKVQRTYSAFHSITKEKTPPAVV
Ga0310889_100262721	3300032179	Soil	KKRAKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKEKLPPAGA
Ga0307471_1026745451	3300032180	Hardwood Forest Soil	HRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPSHRMMKEKVPPALV
Ga0307471_1030957222	3300032180	Hardwood Forest Soil	QHRAKKRAKLRARIAAAPATGRAALEAKVQRTYSPFHSMMKEKLPPPVV
Ga0316605_117094941	3300033408	Soil	RQHRAKKRRKLLARIAATPAAGRAALEAKVQRTYSPFHSMTKEGLPPPTV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign