| Basic Information | |
|---|---|
| Family ID | F071724 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTTSASAAATDWHRRQRDLVAASLVAVPSVKRPTHRRWA |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.39 % |
| % of genes near scaffold ends (potentially truncated) | 34.43 % |
| % of genes from short scaffolds (< 2000 bps) | 87.70 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.197 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil (16.393 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.508 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.262 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF04480 | DUF559 | 10.83 |
| PF06253 | MTTB | 9.17 |
| PF03176 | MMPL | 4.17 |
| PF01842 | ACT | 3.33 |
| PF07883 | Cupin_2 | 3.33 |
| PF00202 | Aminotran_3 | 2.50 |
| PF13191 | AAA_16 | 1.67 |
| PF13338 | AbiEi_4 | 1.67 |
| PF01471 | PG_binding_1 | 1.67 |
| PF00296 | Bac_luciferase | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.83 |
| PF12681 | Glyoxalase_2 | 0.83 |
| PF03704 | BTAD | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF01872 | RibD_C | 0.83 |
| PF09339 | HTH_IclR | 0.83 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF13669 | Glyoxalase_4 | 0.83 |
| PF03109 | ABC1 | 0.83 |
| PF01425 | Amidase | 0.83 |
| PF04909 | Amidohydro_2 | 0.83 |
| PF01850 | PIN | 0.83 |
| PF00355 | Rieske | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF03640 | Lipoprotein_15 | 0.83 |
| PF14518 | Haem_oxygenas_2 | 0.83 |
| PF00557 | Peptidase_M24 | 0.83 |
| PF06718 | DUF1203 | 0.83 |
| PF13302 | Acetyltransf_3 | 0.83 |
| PF01636 | APH | 0.83 |
| PF01569 | PAP2 | 0.83 |
| PF00583 | Acetyltransf_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 9.17 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 4.17 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 4.17 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.83 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.83 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.83 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.20 % |
| Unclassified | root | N/A | 41.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001205|C688J13580_1045768 | Not Available | 583 | Open in IMG/M |
| 3300001305|C688J14111_10251658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300001686|C688J18823_10059601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2645 | Open in IMG/M |
| 3300001686|C688J18823_10402119 | Not Available | 886 | Open in IMG/M |
| 3300002568|C688J35102_118519430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 567 | Open in IMG/M |
| 3300002568|C688J35102_118854000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 605 | Open in IMG/M |
| 3300002568|C688J35102_119469751 | Not Available | 701 | Open in IMG/M |
| 3300002568|C688J35102_120022796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300002568|C688J35102_120265537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
| 3300002568|C688J35102_120505383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 1126 | Open in IMG/M |
| 3300002568|C688J35102_120571279 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300002568|C688J35102_120616406 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300002568|C688J35102_120680478 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300002568|C688J35102_120834265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
| 3300002568|C688J35102_120862050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 1874 | Open in IMG/M |
| 3300002568|C688J35102_120862050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 1874 | Open in IMG/M |
| 3300002568|C688J35102_120919182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2333 | Open in IMG/M |
| 3300002568|C688J35102_120937102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2596 | Open in IMG/M |
| 3300004081|Ga0063454_101340890 | Not Available | 602 | Open in IMG/M |
| 3300004153|Ga0063455_100319921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300004156|Ga0062589_101273847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 708 | Open in IMG/M |
| 3300004479|Ga0062595_100360367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
| 3300005329|Ga0070683_100349633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
| 3300005332|Ga0066388_108676156 | Not Available | 505 | Open in IMG/M |
| 3300005334|Ga0068869_100625264 | Not Available | 912 | Open in IMG/M |
| 3300005338|Ga0068868_100335970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300005338|Ga0068868_100392328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1196 | Open in IMG/M |
| 3300005340|Ga0070689_100059304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2974 | Open in IMG/M |
| 3300005341|Ga0070691_11085418 | Not Available | 504 | Open in IMG/M |
| 3300005355|Ga0070671_100737313 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005439|Ga0070711_100053878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 2774 | Open in IMG/M |
| 3300005459|Ga0068867_100059910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2823 | Open in IMG/M |
| 3300005466|Ga0070685_10028555 | All Organisms → cellular organisms → Bacteria | 3091 | Open in IMG/M |
| 3300005539|Ga0068853_101491999 | Not Available | 655 | Open in IMG/M |
| 3300005547|Ga0070693_100375880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 979 | Open in IMG/M |
| 3300005564|Ga0070664_100803500 | Not Available | 879 | Open in IMG/M |
| 3300005614|Ga0068856_100592515 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300005615|Ga0070702_100253755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1194 | Open in IMG/M |
| 3300005844|Ga0068862_102088114 | Not Available | 578 | Open in IMG/M |
| 3300009148|Ga0105243_11446332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 709 | Open in IMG/M |
| 3300009156|Ga0111538_13058627 | Not Available | 584 | Open in IMG/M |
| 3300009789|Ga0126307_10201408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1597 | Open in IMG/M |
| 3300009840|Ga0126313_10005373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 7651 | Open in IMG/M |
| 3300009840|Ga0126313_10810896 | Not Available | 762 | Open in IMG/M |
| 3300010039|Ga0126309_10119822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300010039|Ga0126309_10543028 | Not Available | 722 | Open in IMG/M |
| 3300010041|Ga0126312_10048971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 2828 | Open in IMG/M |
| 3300010041|Ga0126312_10892212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 648 | Open in IMG/M |
| 3300010041|Ga0126312_11370483 | Not Available | 524 | Open in IMG/M |
| 3300010042|Ga0126314_10458354 | Not Available | 923 | Open in IMG/M |
| 3300010042|Ga0126314_10679907 | Not Available | 753 | Open in IMG/M |
| 3300010371|Ga0134125_11146232 | Not Available | 850 | Open in IMG/M |
| 3300010371|Ga0134125_11710328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans | 684 | Open in IMG/M |
| 3300010400|Ga0134122_10678490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 965 | Open in IMG/M |
| 3300012212|Ga0150985_100239151 | Not Available | 728 | Open in IMG/M |
| 3300012212|Ga0150985_102360924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1467 | Open in IMG/M |
| 3300012212|Ga0150985_108953309 | Not Available | 621 | Open in IMG/M |
| 3300012212|Ga0150985_110063367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300012212|Ga0150985_115317861 | Not Available | 687 | Open in IMG/M |
| 3300012212|Ga0150985_116535040 | Not Available | 613 | Open in IMG/M |
| 3300012212|Ga0150985_118514718 | Not Available | 748 | Open in IMG/M |
| 3300012212|Ga0150985_120831441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 756 | Open in IMG/M |
| 3300012469|Ga0150984_106483118 | Not Available | 606 | Open in IMG/M |
| 3300012469|Ga0150984_106897210 | Not Available | 693 | Open in IMG/M |
| 3300012469|Ga0150984_108196961 | Not Available | 616 | Open in IMG/M |
| 3300012469|Ga0150984_112317806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300012908|Ga0157286_10169002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300012908|Ga0157286_10277069 | Not Available | 603 | Open in IMG/M |
| 3300012955|Ga0164298_10109028 | Not Available | 1482 | Open in IMG/M |
| 3300012958|Ga0164299_10230572 | Not Available | 1093 | Open in IMG/M |
| 3300012986|Ga0164304_11708833 | Not Available | 526 | Open in IMG/M |
| 3300012989|Ga0164305_10016640 | All Organisms → cellular organisms → Bacteria | 3727 | Open in IMG/M |
| 3300012989|Ga0164305_11112768 | Not Available | 679 | Open in IMG/M |
| 3300013308|Ga0157375_10162667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2375 | Open in IMG/M |
| 3300014325|Ga0163163_12308560 | Not Available | 597 | Open in IMG/M |
| 3300014488|Ga0182001_10049217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1130 | Open in IMG/M |
| 3300014745|Ga0157377_10898334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans | 662 | Open in IMG/M |
| 3300015371|Ga0132258_12365397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1331 | Open in IMG/M |
| 3300015371|Ga0132258_13104043 | Not Available | 1148 | Open in IMG/M |
| 3300015374|Ga0132255_103171404 | Not Available | 701 | Open in IMG/M |
| 3300025905|Ga0207685_10555522 | Not Available | 611 | Open in IMG/M |
| 3300025908|Ga0207643_10485252 | Not Available | 789 | Open in IMG/M |
| 3300025915|Ga0207693_11446727 | Not Available | 509 | Open in IMG/M |
| 3300025916|Ga0207663_10075928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 2182 | Open in IMG/M |
| 3300025918|Ga0207662_10645969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300025923|Ga0207681_10268289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1339 | Open in IMG/M |
| 3300025927|Ga0207687_10288646 | Not Available | 1318 | Open in IMG/M |
| 3300025936|Ga0207670_10042531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2994 | Open in IMG/M |
| 3300025937|Ga0207669_10554455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300025942|Ga0207689_10401133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1143 | Open in IMG/M |
| 3300026023|Ga0207677_10531835 | Not Available | 1021 | Open in IMG/M |
| 3300026023|Ga0207677_11121677 | Not Available | 718 | Open in IMG/M |
| 3300026035|Ga0207703_12428536 | Not Available | 500 | Open in IMG/M |
| 3300026041|Ga0207639_11266461 | Not Available | 692 | Open in IMG/M |
| 3300026067|Ga0207678_11171090 | Not Available | 681 | Open in IMG/M |
| 3300026116|Ga0207674_10110686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2721 | Open in IMG/M |
| 3300026118|Ga0207675_100290834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1589 | Open in IMG/M |
| 3300026142|Ga0207698_11891561 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300028587|Ga0247828_10294522 | Not Available | 892 | Open in IMG/M |
| 3300028589|Ga0247818_10930629 | Not Available | 612 | Open in IMG/M |
| 3300030336|Ga0247826_10010814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3789 | Open in IMG/M |
| 3300030336|Ga0247826_10245800 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300030511|Ga0268241_10147036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300030513|Ga0268242_1049937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300031198|Ga0307500_10170093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300031198|Ga0307500_10316525 | Not Available | 500 | Open in IMG/M |
| 3300031547|Ga0310887_10294494 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031547|Ga0310887_10827678 | Not Available | 583 | Open in IMG/M |
| 3300031548|Ga0307408_102410495 | Not Available | 511 | Open in IMG/M |
| 3300031548|Ga0307408_102410495 | Not Available | 511 | Open in IMG/M |
| 3300031938|Ga0308175_100294883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1651 | Open in IMG/M |
| 3300031938|Ga0308175_100347259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1531 | Open in IMG/M |
| 3300031938|Ga0308175_100729392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300031938|Ga0308175_102910671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300031995|Ga0307409_100712577 | Not Available | 1004 | Open in IMG/M |
| 3300031995|Ga0307409_101261618 | Not Available | 763 | Open in IMG/M |
| 3300031996|Ga0308176_10847115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300032002|Ga0307416_100841580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1015 | Open in IMG/M |
| 3300032002|Ga0307416_101984714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300032080|Ga0326721_10310242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300032126|Ga0307415_101172130 | Not Available | 723 | Open in IMG/M |
| 3300034384|Ga0372946_0457609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 16.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.20% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.20% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.10% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.28% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J13580_10457681 | 3300001205 | Soil | MTTSASPAATDWHRRQRDLVAASLIAVPGVKRATHRRWA* |
| C688J14111_102516582 | 3300001305 | Soil | MTSAAPTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| C688J18823_100596014 | 3300001686 | Soil | MTTSASAAATDWHRRQRDLVAASLVAVPAVKRPTHRRWA* |
| C688J18823_104021191 | 3300001686 | Soil | MTTSASPAATDWHRRQRDLVAASLIAVPGAKRATHRRWA* |
| C688J35102_1185194302 | 3300002568 | Soil | TSRPKSAAMTTSASSPTITDWHRRQRDLVAASLIAVPGMKRPTHRRWA* |
| C688J35102_1188540001 | 3300002568 | Soil | MTSAAPIAPRPAASPDWHRRQRDLVAASLVACPRASRSMHRRWA* |
| C688J35102_1194697511 | 3300002568 | Soil | MTTSNSATPIDWHRRQRDLVAASLIAVPGVKRPSHRRWA* |
| C688J35102_1200227962 | 3300002568 | Soil | MTPTTTSAPTAPLDWHSRQRALVAASLIAVPGSTRATHRRWA* |
| C688J35102_1202655372 | 3300002568 | Soil | MTSSSSATATDWHRRQRALVAASLIAVPAVKRPTHRRWA* |
| C688J35102_1205053831 | 3300002568 | Soil | MPTTVASAPNATAADWHRRQRDLVAASLVACPRSSRPTHRRWA* |
| C688J35102_1205712791 | 3300002568 | Soil | MPAMTSAAPTAPTSAAADWHRRQRDLVAASLRIVPGATRPTHRRWA* |
| C688J35102_1206164063 | 3300002568 | Soil | MPAMTTSTSATATDWHRRQRDLVAASLIAVPGVKRPTHRRWA* |
| C688J35102_1206804782 | 3300002568 | Soil | MTLPTSTTTTPTDWHRRQRDLVAASLIAVPGVKRPTHRRWV* |
| C688J35102_1208342652 | 3300002568 | Soil | MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| C688J35102_1208620502 | 3300002568 | Soil | MTSASPTAPTTAAADWHRRQRDLVAASLVCVPGAKRATHRRWA* |
| C688J35102_1208620503 | 3300002568 | Soil | MTATTASPTATAAADWHRRQRDLVAASLVCVPGVRRPTHRRWA* |
| C688J35102_1209191822 | 3300002568 | Soil | MTLTTSTSATSTAWHRRQRDLVAASLIAVPGVKRPTHRRWA* |
| C688J35102_1209371024 | 3300002568 | Soil | MTSAAPTAPRPAASSDWHRRQRDLVAASLVACPSATRSTHRRWA* |
| Ga0063454_1013408902 | 3300004081 | Soil | MTTSASAAATDWHRRQRDLVAASLVAVPSVKRPTHRRWA* |
| Ga0063455_1003199212 | 3300004153 | Soil | MTSAAVTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0062589_1012738473 | 3300004156 | Soil | MTLAASATTTDWHRRQRDLVAASLIAVPSVKRPTHRRWA* |
| Ga0062595_1003603672 | 3300004479 | Soil | VTTSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHRRWA* |
| Ga0070683_1003496332 | 3300005329 | Corn Rhizosphere | MPTTVAAAPHATAADWHRRQRDLVAASLVACPRSSRPTHRRWA* |
| Ga0066388_1086761562 | 3300005332 | Tropical Forest Soil | MLAFAMTTAASITPTDWHRRQRALVAASLIAVPAAKRPTHRRWA* |
| Ga0068869_1006252642 | 3300005334 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA* |
| Ga0068868_1003359702 | 3300005338 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRWA* |
| Ga0068868_1003923282 | 3300005338 | Miscanthus Rhizosphere | MTSAAPTTSTPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA* |
| Ga0070689_1000593041 | 3300005340 | Switchgrass Rhizosphere | LNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRWA* |
| Ga0070691_110854182 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA* |
| Ga0070671_1007373133 | 3300005355 | Switchgrass Rhizosphere | MTSAAPTAKSSAIADWHRRQRDLVAVSLVACPSSSRPMHR |
| Ga0070711_1000538783 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRWA* |
| Ga0068867_1000599102 | 3300005459 | Miscanthus Rhizosphere | MLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA* |
| Ga0070685_100285551 | 3300005466 | Switchgrass Rhizosphere | MSTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA* |
| Ga0068853_1014919992 | 3300005539 | Corn Rhizosphere | MLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHR |
| Ga0070693_1003758802 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPTKTTTAATTDWHRRQRSLVAASLIAVPGVKRPTHRRWA* |
| Ga0070664_1008035002 | 3300005564 | Corn Rhizosphere | MITSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHGR* |
| Ga0068856_1005925153 | 3300005614 | Corn Rhizosphere | MTPTKTTTAATTDWHRRQQSLVAASLIAVPGVKRPTHRRWA* |
| Ga0070702_1002537553 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHR |
| Ga0068862_1020881141 | 3300005844 | Switchgrass Rhizosphere | MTSAAPSAPTATAADWHRRQRALVAQSLVACPRSSRPTHRRWA* |
| Ga0105243_114463322 | 3300009148 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLLAVPRVKRPTHRRWA* |
| Ga0111538_130586271 | 3300009156 | Populus Rhizosphere | RLTTSDSATATGWHRRQRDLVAASLIAVPRAKRPTHRRWA* |
| Ga0126307_102014081 | 3300009789 | Serpentine Soil | MTSAAPTAPAPAAAADWHRRQRDLVAASLRCVPGASRS |
| Ga0126313_100053736 | 3300009840 | Serpentine Soil | MTSAAPTAPAPAAAADWHRRQRDLVAASLRCVPGASRSTHRRWA* |
| Ga0126313_108108962 | 3300009840 | Serpentine Soil | MTAAAPYPATSTAADWHRRQRDLVAASLVARPQASRPTHRRWA* |
| Ga0126309_101198222 | 3300010039 | Serpentine Soil | MTTATASAPTPTAADWHRRQRDLVAASLVACPRSARPTHRRWA* |
| Ga0126309_105430282 | 3300010039 | Serpentine Soil | MTSAAAHTATITAADWHRRQRDMVAASLVSRPQSARPTHRRWA* |
| Ga0126312_100489712 | 3300010041 | Serpentine Soil | MTSAAPTAPAPAAAADWHRRQRDLVAASLVTRPQAARPTHRRWA* |
| Ga0126312_108922121 | 3300010041 | Serpentine Soil | WARDRRDRRMNPMTSPTHTAQTATAADWHRRQRELVAASLVACPGASRPTHRRWA* |
| Ga0126312_113704832 | 3300010041 | Serpentine Soil | MTSAAPTAPAPAAVADWHRRQRDMVTASLRCVPGASRPTHRRWA* |
| Ga0126314_104583543 | 3300010042 | Serpentine Soil | ATAPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA* |
| Ga0126314_106799072 | 3300010042 | Serpentine Soil | MTSAAPTAPAPAAAADWHRPPRDLVAATPRRVPGAS |
| Ga0134125_111462322 | 3300010371 | Terrestrial Soil | MTTSTSATATDWHRRQRDLVAASLIAVPGVKRSTHRRWA* |
| Ga0134125_117103281 | 3300010371 | Terrestrial Soil | MTTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA* |
| Ga0134122_106784902 | 3300010400 | Terrestrial Soil | MPATITTSASATATGWHRRQRDLVAASLLAVPRVKRPTHRRWA* |
| Ga0150985_1002391511 | 3300012212 | Avena Fatua Rhizosphere | PTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1023609241 | 3300012212 | Avena Fatua Rhizosphere | AKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1089533091 | 3300012212 | Avena Fatua Rhizosphere | PTALRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1100633671 | 3300012212 | Avena Fatua Rhizosphere | PITKSPAADWRRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1153178611 | 3300012212 | Avena Fatua Rhizosphere | ITKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1165350401 | 3300012212 | Avena Fatua Rhizosphere | TYTAKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150985_1185147182 | 3300012212 | Avena Fatua Rhizosphere | MTTSASPAATDWHRRQRDLVAASLIAVPAVKRATH |
| Ga0150985_1208314412 | 3300012212 | Avena Fatua Rhizosphere | APTTAAADWHRRQRDLVAASLVCVPGAKRATHRRWA* |
| Ga0150984_1064831182 | 3300012469 | Avena Fatua Rhizosphere | YTAKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150984_1068972101 | 3300012469 | Avena Fatua Rhizosphere | MTTPASPAATDWHRRQRDLVAASLIAVPGVKRATHRRWA* |
| Ga0150984_1081969611 | 3300012469 | Avena Fatua Rhizosphere | LITKSPAADWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0150984_1123178062 | 3300012469 | Avena Fatua Rhizosphere | MTTSNSATPIDWHRRQRDLVAASLIAVPGVKRSTHRRWA* |
| Ga0157286_101690022 | 3300012908 | Soil | MTSAAPTAPRSAAAVDWHRRQRDLVAASLVACPSSSRPTHRRWA* |
| Ga0157286_102770691 | 3300012908 | Soil | PAVTTSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHRRWA* |
| Ga0164298_101090281 | 3300012955 | Soil | MTLTTSASATTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA* |
| Ga0164299_102305721 | 3300012958 | Soil | MTLTTSASATTTDWHRRQRDLVAASLIAVPGVERPTHRRWA* |
| Ga0164304_117088331 | 3300012986 | Soil | MTLTTSASATTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA |
| Ga0164305_100166402 | 3300012989 | Soil | MTLTTSASATPTDWHRRQRDLVAASLIAVPGVKRPTHRRWA* |
| Ga0164305_111127682 | 3300012989 | Soil | MLNAAPSATTAPTADWHRRQRDLVAASLVACPRAGRATHRRWA* |
| Ga0157375_101626673 | 3300013308 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRPTHRRWA* |
| Ga0163163_123085602 | 3300014325 | Switchgrass Rhizosphere | MLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA* |
| Ga0182001_100492172 | 3300014488 | Soil | MTTAASHPATSTAADWHRRQRDLVAASLIARPQAARPTHRRWA* |
| Ga0157377_108983342 | 3300014745 | Miscanthus Rhizosphere | MSTSASPSATDWHRRQRELVAASLIAVPGVKRPTHR |
| Ga0132258_123653972 | 3300015371 | Arabidopsis Rhizosphere | MTTSASATTTDWHRRQRALVAASLIAVPGVKSPTHRRWA* |
| Ga0132258_131040431 | 3300015371 | Arabidopsis Rhizosphere | TVPVTTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA* |
| Ga0132255_1031714042 | 3300015374 | Arabidopsis Rhizosphere | SATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA* |
| Ga0207685_105555222 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRSRASASS |
| Ga0207643_104852522 | 3300025908 | Miscanthus Rhizosphere | MLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA |
| Ga0207693_114467272 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAASATTPTDWHRRQRDLVAASLIAVPGVKRPTHRRW |
| Ga0207663_100759283 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRWA |
| Ga0207662_106459691 | 3300025918 | Switchgrass Rhizosphere | VAMLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA |
| Ga0207681_102682893 | 3300025923 | Switchgrass Rhizosphere | AMLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA |
| Ga0207687_102886461 | 3300025927 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRW |
| Ga0207670_100425313 | 3300025936 | Switchgrass Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA |
| Ga0207669_105544551 | 3300025937 | Miscanthus Rhizosphere | MTTSTSATATDWHRRQRDLVAASLIAVPGVKRSTHRRWA |
| Ga0207689_104011331 | 3300025942 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTH |
| Ga0207677_105318351 | 3300026023 | Miscanthus Rhizosphere | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRA |
| Ga0207677_111216771 | 3300026023 | Miscanthus Rhizosphere | MTTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA |
| Ga0207703_124285362 | 3300026035 | Switchgrass Rhizosphere | ATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA |
| Ga0207639_112664611 | 3300026041 | Corn Rhizosphere | MTSAAPTTSTPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA |
| Ga0207678_111710902 | 3300026067 | Corn Rhizosphere | MITSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHGR |
| Ga0207674_101106862 | 3300026116 | Corn Rhizosphere | MITSASPTTTDWHRRQRDLVAASLIAVPVAKSPTHGR |
| Ga0207675_1002908343 | 3300026118 | Switchgrass Rhizosphere | MTLAASATTTDWHRRQRDLVAASLIAVPSVKRPTHRRWA |
| Ga0207698_118915612 | 3300026142 | Corn Rhizosphere | MTPTKTTTAATTDWHGRQRSLVAASLIAVPGVKRPTHRRWA |
| Ga0247828_102945222 | 3300028587 | Soil | ASATTTDWHRRQRALVAASLIAVPGVKSPTHGRRD |
| Ga0247818_109306291 | 3300028589 | Soil | TAPRSAAAVDWHRRQRDLVAASLVACPSSSSPTHRRWA |
| Ga0247826_100108145 | 3300030336 | Soil | MTTSASATTTDWHRRQRALVAASLIAVPGVKSPTHGRRV |
| Ga0247826_102458002 | 3300030336 | Soil | MPTSASVTTTDWHRRQRALVAASLIAVPGVKRPTHRRWA |
| Ga0268241_101470362 | 3300030511 | Soil | MTTPSATATATDWHSRQRALVAASLIAVPSIKRPTHRRWA |
| Ga0268242_10499372 | 3300030513 | Soil | MTTAASHPATSTAADWHRRQRDLVAASLIARPQAARPTHRRWA |
| Ga0307500_101700931 | 3300031198 | Soil | MTSAAPTAPRPAATTDWHRRQRDLVAASLVACPSSSRPMHRRWA |
| Ga0307500_103165252 | 3300031198 | Soil | MTTSASATAIDWHRRQRALVAASLIAVPGVKRPTHRRWA |
| Ga0310887_102944942 | 3300031547 | Soil | MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA |
| Ga0310887_108276781 | 3300031547 | Soil | APSAATATTADWHRRQRDLVAASLVACPRSGRSTHRRWA |
| Ga0307408_1024104951 | 3300031548 | Rhizosphere | TAPAPAAAADWHRRQRDLVAASLRCVPGSSRPTHRRWA |
| Ga0307408_1024104952 | 3300031548 | Rhizosphere | MTTAAPHTPTPTAADWHRRQRDLVAASLVARPQAARPTHRRWA |
| Ga0308175_1002948833 | 3300031938 | Soil | MTLAASPTPTDWHRRQRDLVAASLIAVPGVKRPTHRRWA |
| Ga0308175_1003472591 | 3300031938 | Soil | MTLTTSTPATPTDWHRRQRDLVAASLVAVPGVKRPTHRRWA |
| Ga0308175_1007293922 | 3300031938 | Soil | MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA |
| Ga0308175_1029106711 | 3300031938 | Soil | MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSS |
| Ga0307409_1007125773 | 3300031995 | Rhizosphere | ASAAAADWHRRQRDLVAASLIAVPGVKRPTHRRWA |
| Ga0307409_1012616181 | 3300031995 | Rhizosphere | MSAIQPTKSAADWHRRQRDLVAASLVRVPGASRPAHRRWA |
| Ga0308176_108471152 | 3300031996 | Soil | MTSAAPTAPRPAASADWHRRQRDLVAASLLACPSSARPTHRRWA |
| Ga0307416_1008415802 | 3300032002 | Rhizosphere | MTTATASAPTPTAADWHRRQRDLVAASLVACPRSARPTHRRWA |
| Ga0307416_1019847142 | 3300032002 | Rhizosphere | MITATASTATTTAADWHRRQRDLVAASLVARPQVARPTHRRWA |
| Ga0326721_103102422 | 3300032080 | Soil | MTAPATPTPTSTAADWHRRQRDMVAASLVARPQAARPTHRRWA |
| Ga0307415_1011721302 | 3300032126 | Rhizosphere | MPASMTTSASAAAADWHRRQRDLVAASMIAVPGVKRPTHRRWA |
| Ga0372946_0457609_229_363 | 3300034384 | Soil | MLSAAHTTTTATPAVALHVRQRELVAASLIAVPAATRPTHRRWA |
| ⦗Top⦘ |