Metagenome Family F071724

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F071724
Family Type	Metagenome
Number of Sequences	122
Average Sequence Length	41 residues
Representative Sequence	MTTSASAAATDWHRRQRDLVAASLVAVPSVKRPTHRRWA
Number of Associated Samples	78
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	66.39 %
% of genes near scaffold ends (potentially truncated)	34.43 %
% of genes from short scaffolds (< 2000 bps)	87.70 %
Associated GOLD sequencing projects	67
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (58.197 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil (16.393 % of family members)
Environment Ontology (ENVO)	Unclassified (29.508 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.262 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF04480	DUF559	10.83
PF06253	MTTB	9.17
PF03176	MMPL	4.17
PF01842	ACT	3.33
PF07883	Cupin_2	3.33
PF00202	Aminotran_3	2.50
PF13191	AAA_16	1.67
PF13338	AbiEi_4	1.67
PF01471	PG_binding_1	1.67
PF00296	Bac_luciferase	0.83
PF03466	LysR_substrate	0.83
PF13640	2OG-FeII_Oxy_3	0.83
PF12681	Glyoxalase_2	0.83
PF03704	BTAD	0.83
PF13683	rve_3	0.83
PF01872	RibD_C	0.83
PF09339	HTH_IclR	0.83
PF12697	Abhydrolase_6	0.83
PF13669	Glyoxalase_4	0.83
PF03109	ABC1	0.83
PF01425	Amidase	0.83
PF04909	Amidohydro_2	0.83
PF01850	PIN	0.83
PF00355	Rieske	0.83
PF00378	ECH_1	0.83
PF03640	Lipoprotein_15	0.83
PF14518	Haem_oxygenas_2	0.83
PF00557	Peptidase_M24	0.83
PF06718	DUF1203	0.83
PF13302	Acetyltransf_3	0.83
PF01636	APH	0.83
PF01569	PAP2	0.83
PF00583	Acetyltransf_1	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG5598	Trimethylamine:corrinoid methyltransferase	Coenzyme transport and metabolism [H]	9.17
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	4.17
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	4.17
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.83
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.83
COG0661	Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family	Signal transduction mechanisms [T]	0.83
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.83
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.83
COG3629	DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain	Transcription [K]	0.83
COG3947	Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains	Transcription [K]	0.83
COG4315	Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)	Function unknown [S]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.20 %
Unclassified	root	N/A	41.80 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.20 %
Unclassified	root	N/A	41.80 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.20 %
Unclassified	root	N/A	41.80 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	50.00 %
Unclassified	root	N/A	41.80 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	42.62 %
Unclassified	root	N/A	41.80 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.80 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	18.03 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5.74 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	1.64 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.80 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	5.74 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	4.92 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2.46 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.46 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	2.46 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	1.64 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.82 %
unclassified Thermoleophilia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.74 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	4.92 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	2.46 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.46 %
Dictyobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae	1.64 %
Promicromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae	1.64 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.82 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.74 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples	4.10 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2.46 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.46 %
Dictyobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter	1.64 %
Cellulosimicrobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium	1.64 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.82 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.82 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.74 %
uncultured Nocardioidaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	4.10 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2.46 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.46 %
Dictyobacter formicarum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum	1.64 %
Cellulosimicrobium cellulans	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans	1.64 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.82 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.82 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001205\|C688J13580_1045768	Not Available	583	Open in IMG/M
3300001305\|C688J14111_10251658	All Organisms → cellular organisms → Bacteria → Terrabacteria group	554	Open in IMG/M
3300001686\|C688J18823_10059601	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2645	Open in IMG/M
3300001686\|C688J18823_10402119	Not Available	886	Open in IMG/M
3300002568\|C688J35102_118519430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	567	Open in IMG/M
3300002568\|C688J35102_118854000	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	605	Open in IMG/M
3300002568\|C688J35102_119469751	Not Available	701	Open in IMG/M
3300002568\|C688J35102_120022796	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	849	Open in IMG/M
3300002568\|C688J35102_120265537	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	957	Open in IMG/M
3300002568\|C688J35102_120505383	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	1126	Open in IMG/M
3300002568\|C688J35102_120571279	All Organisms → cellular organisms → Bacteria	1193	Open in IMG/M
3300002568\|C688J35102_120616406	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300002568\|C688J35102_120680478	All Organisms → cellular organisms → Bacteria	1342	Open in IMG/M
3300002568\|C688J35102_120834265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1743	Open in IMG/M
3300002568\|C688J35102_120862050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	1874	Open in IMG/M
3300002568\|C688J35102_120862050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	1874	Open in IMG/M
3300002568\|C688J35102_120919182	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2333	Open in IMG/M
3300002568\|C688J35102_120937102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2596	Open in IMG/M
3300004081\|Ga0063454_101340890	Not Available	602	Open in IMG/M
3300004153\|Ga0063455_100319921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	864	Open in IMG/M
3300004156\|Ga0062589_101273847	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	708	Open in IMG/M
3300004479\|Ga0062595_100360367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1018	Open in IMG/M
3300005329\|Ga0070683_100349633	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1408	Open in IMG/M
3300005332\|Ga0066388_108676156	Not Available	505	Open in IMG/M
3300005334\|Ga0068869_100625264	Not Available	912	Open in IMG/M
3300005338\|Ga0068868_100335970	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1291	Open in IMG/M
3300005338\|Ga0068868_100392328	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1196	Open in IMG/M
3300005340\|Ga0070689_100059304	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2974	Open in IMG/M
3300005341\|Ga0070691_11085418	Not Available	504	Open in IMG/M
3300005355\|Ga0070671_100737313	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300005439\|Ga0070711_100053878	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum	2774	Open in IMG/M
3300005459\|Ga0068867_100059910	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2823	Open in IMG/M
3300005466\|Ga0070685_10028555	All Organisms → cellular organisms → Bacteria	3091	Open in IMG/M
3300005539\|Ga0068853_101491999	Not Available	655	Open in IMG/M
3300005547\|Ga0070693_100375880	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	979	Open in IMG/M
3300005564\|Ga0070664_100803500	Not Available	879	Open in IMG/M
3300005614\|Ga0068856_100592515	All Organisms → cellular organisms → Bacteria	1130	Open in IMG/M
3300005615\|Ga0070702_100253755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1194	Open in IMG/M
3300005844\|Ga0068862_102088114	Not Available	578	Open in IMG/M
3300009148\|Ga0105243_11446332	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	709	Open in IMG/M
3300009156\|Ga0111538_13058627	Not Available	584	Open in IMG/M
3300009789\|Ga0126307_10201408	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1597	Open in IMG/M
3300009840\|Ga0126313_10005373	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	7651	Open in IMG/M
3300009840\|Ga0126313_10810896	Not Available	762	Open in IMG/M
3300010039\|Ga0126309_10119822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1380	Open in IMG/M
3300010039\|Ga0126309_10543028	Not Available	722	Open in IMG/M
3300010041\|Ga0126312_10048971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	2828	Open in IMG/M
3300010041\|Ga0126312_10892212	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	648	Open in IMG/M
3300010041\|Ga0126312_11370483	Not Available	524	Open in IMG/M
3300010042\|Ga0126314_10458354	Not Available	923	Open in IMG/M
3300010042\|Ga0126314_10679907	Not Available	753	Open in IMG/M
3300010371\|Ga0134125_11146232	Not Available	850	Open in IMG/M
3300010371\|Ga0134125_11710328	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans	684	Open in IMG/M
3300010400\|Ga0134122_10678490	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	965	Open in IMG/M
3300012212\|Ga0150985_100239151	Not Available	728	Open in IMG/M
3300012212\|Ga0150985_102360924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1467	Open in IMG/M
3300012212\|Ga0150985_108953309	Not Available	621	Open in IMG/M
3300012212\|Ga0150985_110063367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	522	Open in IMG/M
3300012212\|Ga0150985_115317861	Not Available	687	Open in IMG/M
3300012212\|Ga0150985_116535040	Not Available	613	Open in IMG/M
3300012212\|Ga0150985_118514718	Not Available	748	Open in IMG/M
3300012212\|Ga0150985_120831441	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium	756	Open in IMG/M
3300012469\|Ga0150984_106483118	Not Available	606	Open in IMG/M
3300012469\|Ga0150984_106897210	Not Available	693	Open in IMG/M
3300012469\|Ga0150984_108196961	Not Available	616	Open in IMG/M
3300012469\|Ga0150984_112317806	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	580	Open in IMG/M
3300012908\|Ga0157286_10169002	All Organisms → cellular organisms → Bacteria → Terrabacteria group	712	Open in IMG/M
3300012908\|Ga0157286_10277069	Not Available	603	Open in IMG/M
3300012955\|Ga0164298_10109028	Not Available	1482	Open in IMG/M
3300012958\|Ga0164299_10230572	Not Available	1093	Open in IMG/M
3300012986\|Ga0164304_11708833	Not Available	526	Open in IMG/M
3300012989\|Ga0164305_10016640	All Organisms → cellular organisms → Bacteria	3727	Open in IMG/M
3300012989\|Ga0164305_11112768	Not Available	679	Open in IMG/M
3300013308\|Ga0157375_10162667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2375	Open in IMG/M
3300014325\|Ga0163163_12308560	Not Available	597	Open in IMG/M
3300014488\|Ga0182001_10049217	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1130	Open in IMG/M
3300014745\|Ga0157377_10898334	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans	662	Open in IMG/M
3300015371\|Ga0132258_12365397	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	1331	Open in IMG/M
3300015371\|Ga0132258_13104043	Not Available	1148	Open in IMG/M
3300015374\|Ga0132255_103171404	Not Available	701	Open in IMG/M
3300025905\|Ga0207685_10555522	Not Available	611	Open in IMG/M
3300025908\|Ga0207643_10485252	Not Available	789	Open in IMG/M
3300025915\|Ga0207693_11446727	Not Available	509	Open in IMG/M
3300025916\|Ga0207663_10075928	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum	2182	Open in IMG/M
3300025918\|Ga0207662_10645969	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	739	Open in IMG/M
3300025923\|Ga0207681_10268289	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1339	Open in IMG/M
3300025927\|Ga0207687_10288646	Not Available	1318	Open in IMG/M
3300025936\|Ga0207670_10042531	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2994	Open in IMG/M
3300025937\|Ga0207669_10554455	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	928	Open in IMG/M
3300025942\|Ga0207689_10401133	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1143	Open in IMG/M
3300026023\|Ga0207677_10531835	Not Available	1021	Open in IMG/M
3300026023\|Ga0207677_11121677	Not Available	718	Open in IMG/M
3300026035\|Ga0207703_12428536	Not Available	500	Open in IMG/M
3300026041\|Ga0207639_11266461	Not Available	692	Open in IMG/M
3300026067\|Ga0207678_11171090	Not Available	681	Open in IMG/M
3300026116\|Ga0207674_10110686	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2721	Open in IMG/M
3300026118\|Ga0207675_100290834	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1589	Open in IMG/M
3300026142\|Ga0207698_11891561	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300028587\|Ga0247828_10294522	Not Available	892	Open in IMG/M
3300028589\|Ga0247818_10930629	Not Available	612	Open in IMG/M
3300030336\|Ga0247826_10010814	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3789	Open in IMG/M
3300030336\|Ga0247826_10245800	All Organisms → cellular organisms → Bacteria	1253	Open in IMG/M
3300030511\|Ga0268241_10147036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	574	Open in IMG/M
3300030513\|Ga0268242_1049937	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	786	Open in IMG/M
3300031198\|Ga0307500_10170093	All Organisms → cellular organisms → Bacteria → Terrabacteria group	634	Open in IMG/M
3300031198\|Ga0307500_10316525	Not Available	500	Open in IMG/M
3300031547\|Ga0310887_10294494	All Organisms → cellular organisms → Bacteria	923	Open in IMG/M
3300031547\|Ga0310887_10827678	Not Available	583	Open in IMG/M
3300031548\|Ga0307408_102410495	Not Available	511	Open in IMG/M
3300031548\|Ga0307408_102410495	Not Available	511	Open in IMG/M
3300031938\|Ga0308175_100294883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1651	Open in IMG/M
3300031938\|Ga0308175_100347259	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1531	Open in IMG/M
3300031938\|Ga0308175_100729392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1079	Open in IMG/M
3300031938\|Ga0308175_102910671	All Organisms → cellular organisms → Bacteria → Terrabacteria group	534	Open in IMG/M
3300031995\|Ga0307409_100712577	Not Available	1004	Open in IMG/M
3300031995\|Ga0307409_101261618	Not Available	763	Open in IMG/M
3300031996\|Ga0308176_10847115	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	958	Open in IMG/M
3300032002\|Ga0307416_100841580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1015	Open in IMG/M
3300032002\|Ga0307416_101984714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	685	Open in IMG/M
3300032080\|Ga0326721_10310242	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	883	Open in IMG/M
3300032126\|Ga0307415_101172130	Not Available	723	Open in IMG/M
3300034384\|Ga0372946_0457609	All Organisms → cellular organisms → Bacteria → Terrabacteria group	620	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	59.84%
Host-Associated	Host-Associated	40.16%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.84%
Plants	Host-Associated → Plants	40.16%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.84%
Rhizoplane	Host-Associated → Plants → Rhizoplane	22.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.21%
Roots	Host-Associated → Plants → Roots	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.79%
Loam	Environmental → Terrestrial → Soil → Loam	27.05%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	9.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.38%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.31%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	16.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.11%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.84%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	9.02%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	9.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.38%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.82%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	16.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	9.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.20%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	8.20%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	6.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	6.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	5.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.10%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.28%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	3.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.46%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.82%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.82%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001205	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental	Open in IMG/M
3300030513	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032080	Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C688J13580_10457681	3300001205	Soil	MTTSASPAATDWHRRQRDLVAASLIAVPGVKRATHRRWA*
C688J14111_102516582	3300001305	Soil	MTSAAPTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA*
C688J18823_100596014	3300001686	Soil	MTTSASAAATDWHRRQRDLVAASLVAVPAVKRPTHRRWA*
C688J18823_104021191	3300001686	Soil	MTTSASPAATDWHRRQRDLVAASLIAVPGAKRATHRRWA*
C688J35102_1185194302	3300002568	Soil	TSRPKSAAMTTSASSPTITDWHRRQRDLVAASLIAVPGMKRPTHRRWA*
C688J35102_1188540001	3300002568	Soil	MTSAAPIAPRPAASPDWHRRQRDLVAASLVACPRASRSMHRRWA*
C688J35102_1194697511	3300002568	Soil	MTTSNSATPIDWHRRQRDLVAASLIAVPGVKRPSHRRWA*
C688J35102_1200227962	3300002568	Soil	MTPTTTSAPTAPLDWHSRQRALVAASLIAVPGSTRATHRRWA*
C688J35102_1202655372	3300002568	Soil	MTSSSSATATDWHRRQRALVAASLIAVPAVKRPTHRRWA*
C688J35102_1205053831	3300002568	Soil	MPTTVASAPNATAADWHRRQRDLVAASLVACPRSSRPTHRRWA*
C688J35102_1205712791	3300002568	Soil	MPAMTSAAPTAPTSAAADWHRRQRDLVAASLRIVPGATRPTHRRWA*
C688J35102_1206164063	3300002568	Soil	MPAMTTSTSATATDWHRRQRDLVAASLIAVPGVKRPTHRRWA*
C688J35102_1206804782	3300002568	Soil	MTLPTSTTTTPTDWHRRQRDLVAASLIAVPGVKRPTHRRWV*
C688J35102_1208342652	3300002568	Soil	MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
C688J35102_1208620502	3300002568	Soil	MTSASPTAPTTAAADWHRRQRDLVAASLVCVPGAKRATHRRWA*
C688J35102_1208620503	3300002568	Soil	MTATTASPTATAAADWHRRQRDLVAASLVCVPGVRRPTHRRWA*
C688J35102_1209191822	3300002568	Soil	MTLTTSTSATSTAWHRRQRDLVAASLIAVPGVKRPTHRRWA*
C688J35102_1209371024	3300002568	Soil	MTSAAPTAPRPAASSDWHRRQRDLVAASLVACPSATRSTHRRWA*
Ga0063454_1013408902	3300004081	Soil	MTTSASAAATDWHRRQRDLVAASLVAVPSVKRPTHRRWA*
Ga0063455_1003199212	3300004153	Soil	MTSAAVTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0062589_1012738473	3300004156	Soil	MTLAASATTTDWHRRQRDLVAASLIAVPSVKRPTHRRWA*
Ga0062595_1003603672	3300004479	Soil	VTTSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHRRWA*
Ga0070683_1003496332	3300005329	Corn Rhizosphere	MPTTVAAAPHATAADWHRRQRDLVAASLVACPRSSRPTHRRWA*
Ga0066388_1086761562	3300005332	Tropical Forest Soil	MLAFAMTTAASITPTDWHRRQRALVAASLIAVPAAKRPTHRRWA*
Ga0068869_1006252642	3300005334	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA*
Ga0068868_1003359702	3300005338	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRWA*
Ga0068868_1003923282	3300005338	Miscanthus Rhizosphere	MTSAAPTTSTPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA*
Ga0070689_1000593041	3300005340	Switchgrass Rhizosphere	LNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRWA*
Ga0070691_110854182	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA*
Ga0070671_1007373133	3300005355	Switchgrass Rhizosphere	MTSAAPTAKSSAIADWHRRQRDLVAVSLVACPSSSRPMHR
Ga0070711_1000538783	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRWA*
Ga0068867_1000599102	3300005459	Miscanthus Rhizosphere	MLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA*
Ga0070685_100285551	3300005466	Switchgrass Rhizosphere	MSTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA*
Ga0068853_1014919992	3300005539	Corn Rhizosphere	MLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHR
Ga0070693_1003758802	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MTPTKTTTAATTDWHRRQRSLVAASLIAVPGVKRPTHRRWA*
Ga0070664_1008035002	3300005564	Corn Rhizosphere	MITSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHGR*
Ga0068856_1005925153	3300005614	Corn Rhizosphere	MTPTKTTTAATTDWHRRQQSLVAASLIAVPGVKRPTHRRWA*
Ga0070702_1002537553	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHR
Ga0068862_1020881141	3300005844	Switchgrass Rhizosphere	MTSAAPSAPTATAADWHRRQRALVAQSLVACPRSSRPTHRRWA*
Ga0105243_114463322	3300009148	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLLAVPRVKRPTHRRWA*
Ga0111538_130586271	3300009156	Populus Rhizosphere	RLTTSDSATATGWHRRQRDLVAASLIAVPRAKRPTHRRWA*
Ga0126307_102014081	3300009789	Serpentine Soil	MTSAAPTAPAPAAAADWHRRQRDLVAASLRCVPGASRS
Ga0126313_100053736	3300009840	Serpentine Soil	MTSAAPTAPAPAAAADWHRRQRDLVAASLRCVPGASRSTHRRWA*
Ga0126313_108108962	3300009840	Serpentine Soil	MTAAAPYPATSTAADWHRRQRDLVAASLVARPQASRPTHRRWA*
Ga0126309_101198222	3300010039	Serpentine Soil	MTTATASAPTPTAADWHRRQRDLVAASLVACPRSARPTHRRWA*
Ga0126309_105430282	3300010039	Serpentine Soil	MTSAAAHTATITAADWHRRQRDMVAASLVSRPQSARPTHRRWA*
Ga0126312_100489712	3300010041	Serpentine Soil	MTSAAPTAPAPAAAADWHRRQRDLVAASLVTRPQAARPTHRRWA*
Ga0126312_108922121	3300010041	Serpentine Soil	WARDRRDRRMNPMTSPTHTAQTATAADWHRRQRELVAASLVACPGASRPTHRRWA*
Ga0126312_113704832	3300010041	Serpentine Soil	MTSAAPTAPAPAAVADWHRRQRDMVTASLRCVPGASRPTHRRWA*
Ga0126314_104583543	3300010042	Serpentine Soil	ATAPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA*
Ga0126314_106799072	3300010042	Serpentine Soil	MTSAAPTAPAPAAAADWHRPPRDLVAATPRRVPGAS
Ga0134125_111462322	3300010371	Terrestrial Soil	MTTSTSATATDWHRRQRDLVAASLIAVPGVKRSTHRRWA*
Ga0134125_117103281	3300010371	Terrestrial Soil	MTTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA*
Ga0134122_106784902	3300010400	Terrestrial Soil	MPATITTSASATATGWHRRQRDLVAASLLAVPRVKRPTHRRWA*
Ga0150985_1002391511	3300012212	Avena Fatua Rhizosphere	PTAKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1023609241	3300012212	Avena Fatua Rhizosphere	AKSPAPADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1089533091	3300012212	Avena Fatua Rhizosphere	PTALRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1100633671	3300012212	Avena Fatua Rhizosphere	PITKSPAADWRRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1153178611	3300012212	Avena Fatua Rhizosphere	ITKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1165350401	3300012212	Avena Fatua Rhizosphere	TYTAKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150985_1185147182	3300012212	Avena Fatua Rhizosphere	MTTSASPAATDWHRRQRDLVAASLIAVPAVKRATH
Ga0150985_1208314412	3300012212	Avena Fatua Rhizosphere	APTTAAADWHRRQRDLVAASLVCVPGAKRATHRRWA*
Ga0150984_1064831182	3300012469	Avena Fatua Rhizosphere	YTAKSPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150984_1068972101	3300012469	Avena Fatua Rhizosphere	MTTPASPAATDWHRRQRDLVAASLIAVPGVKRATHRRWA*
Ga0150984_1081969611	3300012469	Avena Fatua Rhizosphere	LITKSPAADWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0150984_1123178062	3300012469	Avena Fatua Rhizosphere	MTTSNSATPIDWHRRQRDLVAASLIAVPGVKRSTHRRWA*
Ga0157286_101690022	3300012908	Soil	MTSAAPTAPRSAAAVDWHRRQRDLVAASLVACPSSSRPTHRRWA*
Ga0157286_102770691	3300012908	Soil	PAVTTSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHRRWA*
Ga0164298_101090281	3300012955	Soil	MTLTTSASATTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA*
Ga0164299_102305721	3300012958	Soil	MTLTTSASATTTDWHRRQRDLVAASLIAVPGVERPTHRRWA*
Ga0164304_117088331	3300012986	Soil	MTLTTSASATTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA
Ga0164305_100166402	3300012989	Soil	MTLTTSASATPTDWHRRQRDLVAASLIAVPGVKRPTHRRWA*
Ga0164305_111127682	3300012989	Soil	MLNAAPSATTAPTADWHRRQRDLVAASLVACPRAGRATHRRWA*
Ga0157375_101626673	3300013308	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRPTHRRWA*
Ga0163163_123085602	3300014325	Switchgrass Rhizosphere	MLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA*
Ga0182001_100492172	3300014488	Soil	MTTAASHPATSTAADWHRRQRDLVAASLIARPQAARPTHRRWA*
Ga0157377_108983342	3300014745	Miscanthus Rhizosphere	MSTSASPSATDWHRRQRELVAASLIAVPGVKRPTHR
Ga0132258_123653972	3300015371	Arabidopsis Rhizosphere	MTTSASATTTDWHRRQRALVAASLIAVPGVKSPTHRRWA*
Ga0132258_131040431	3300015371	Arabidopsis Rhizosphere	TVPVTTTDWHRRQRDLVAASLIAVPGVKRPTHRRWA*
Ga0132255_1031714042	3300015374	Arabidopsis Rhizosphere	SATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA*
Ga0207685_105555222	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRSRASASS
Ga0207643_104852522	3300025908	Miscanthus Rhizosphere	MLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA
Ga0207693_114467272	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MTLAASATTPTDWHRRQRDLVAASLIAVPGVKRPTHRRW
Ga0207663_100759283	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MLSAAPSPTTATTVDWHRRQRELVAASLVACPRSGRSTHRRWA
Ga0207662_106459691	3300025918	Switchgrass Rhizosphere	VAMLSAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA
Ga0207681_102682893	3300025923	Switchgrass Rhizosphere	AMLNAAPSATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA
Ga0207687_102886461	3300025927	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTHRRW
Ga0207670_100425313	3300025936	Switchgrass Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRAMHRRWA
Ga0207669_105544551	3300025937	Miscanthus Rhizosphere	MTTSTSATATDWHRRQRDLVAASLIAVPGVKRSTHRRWA
Ga0207689_104011331	3300025942	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRSTH
Ga0207677_105318351	3300026023	Miscanthus Rhizosphere	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRA
Ga0207677_111216771	3300026023	Miscanthus Rhizosphere	MTTSASPSATDWHRRQRELVAASLIAVPGVKRPTHRRWA
Ga0207703_124285362	3300026035	Switchgrass Rhizosphere	ATTATTADWHRRQRDLVAASLVACPRSGRSTHRRWA
Ga0207639_112664611	3300026041	Corn Rhizosphere	MTSAAPTTSTPAAADWHRRQRDLVAASLRCVPGASRSTHRRWA
Ga0207678_111710902	3300026067	Corn Rhizosphere	MITSASPTTTDWHRRQRDLVAASLIAVPVAKRPTHGR
Ga0207674_101106862	3300026116	Corn Rhizosphere	MITSASPTTTDWHRRQRDLVAASLIAVPVAKSPTHGR
Ga0207675_1002908343	3300026118	Switchgrass Rhizosphere	MTLAASATTTDWHRRQRDLVAASLIAVPSVKRPTHRRWA
Ga0207698_118915612	3300026142	Corn Rhizosphere	MTPTKTTTAATTDWHGRQRSLVAASLIAVPGVKRPTHRRWA
Ga0247828_102945222	3300028587	Soil	ASATTTDWHRRQRALVAASLIAVPGVKSPTHGRRD
Ga0247818_109306291	3300028589	Soil	TAPRSAAAVDWHRRQRDLVAASLVACPSSSSPTHRRWA
Ga0247826_100108145	3300030336	Soil	MTTSASATTTDWHRRQRALVAASLIAVPGVKSPTHGRRV
Ga0247826_102458002	3300030336	Soil	MPTSASVTTTDWHRRQRALVAASLIAVPGVKRPTHRRWA
Ga0268241_101470362	3300030511	Soil	MTTPSATATATDWHSRQRALVAASLIAVPSIKRPTHRRWA
Ga0268242_10499372	3300030513	Soil	MTTAASHPATSTAADWHRRQRDLVAASLIARPQAARPTHRRWA
Ga0307500_101700931	3300031198	Soil	MTSAAPTAPRPAATTDWHRRQRDLVAASLVACPSSSRPMHRRWA
Ga0307500_103165252	3300031198	Soil	MTTSASATAIDWHRRQRALVAASLIAVPGVKRPTHRRWA
Ga0310887_102944942	3300031547	Soil	MLNAAPSATTATAADWHRRQRDLVAASLVACPRSGRATHRRWA
Ga0310887_108276781	3300031547	Soil	APSAATATTADWHRRQRDLVAASLVACPRSGRSTHRRWA
Ga0307408_1024104951	3300031548	Rhizosphere	TAPAPAAAADWHRRQRDLVAASLRCVPGSSRPTHRRWA
Ga0307408_1024104952	3300031548	Rhizosphere	MTTAAPHTPTPTAADWHRRQRDLVAASLVARPQAARPTHRRWA
Ga0308175_1002948833	3300031938	Soil	MTLAASPTPTDWHRRQRDLVAASLIAVPGVKRPTHRRWA
Ga0308175_1003472591	3300031938	Soil	MTLTTSTPATPTDWHRRQRDLVAASLVAVPGVKRPTHRRWA
Ga0308175_1007293922	3300031938	Soil	MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSSRPTHRRWA
Ga0308175_1029106711	3300031938	Soil	MTSAAPTAPRPAAADWHRRQRDLVAASLVACPSSS
Ga0307409_1007125773	3300031995	Rhizosphere	ASAAAADWHRRQRDLVAASLIAVPGVKRPTHRRWA
Ga0307409_1012616181	3300031995	Rhizosphere	MSAIQPTKSAADWHRRQRDLVAASLVRVPGASRPAHRRWA
Ga0308176_108471152	3300031996	Soil	MTSAAPTAPRPAASADWHRRQRDLVAASLLACPSSARPTHRRWA
Ga0307416_1008415802	3300032002	Rhizosphere	MTTATASAPTPTAADWHRRQRDLVAASLVACPRSARPTHRRWA
Ga0307416_1019847142	3300032002	Rhizosphere	MITATASTATTTAADWHRRQRDLVAASLVARPQVARPTHRRWA
Ga0326721_103102422	3300032080	Soil	MTAPATPTPTSTAADWHRRQRDMVAASLVARPQAARPTHRRWA
Ga0307415_1011721302	3300032126	Rhizosphere	MPASMTTSASAAAADWHRRQRDLVAASMIAVPGVKRPTHRRWA
Ga0372946_0457609_229_363	3300034384	Soil	MLSAAHTTTTATPAVALHVRQRELVAASLIAVPAATRPTHRRWA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F071724

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences