| Basic Information | |
|---|---|
| Family ID | F071704 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MDRKLRNRTLLFLALAAIVAFVLVRLSGRQPVAKISATTPVRQ |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.97 % |
| % of genes near scaffold ends (potentially truncated) | 95.90 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.295 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.934 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.508 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.639 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 54.92 |
| PF13545 | HTH_Crp_2 | 0.82 |
| PF01894 | UPF0047 | 0.82 |
| PF12698 | ABC2_membrane_3 | 0.82 |
| PF03061 | 4HBT | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF16576 | HlyD_D23 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.30 % |
| Unclassified | root | N/A | 37.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig43132.27117 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100267275 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 1597 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100440734 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300003370|JGI26337J50220_1036878 | Not Available | 557 | Open in IMG/M |
| 3300004080|Ga0062385_10374553 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300004152|Ga0062386_100579703 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005332|Ga0066388_106062973 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005332|Ga0066388_107778762 | Not Available | 537 | Open in IMG/M |
| 3300005445|Ga0070708_100974452 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005553|Ga0066695_10087864 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300006028|Ga0070717_10827916 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006050|Ga0075028_100432681 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006052|Ga0075029_100287061 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300006163|Ga0070715_10239892 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006176|Ga0070765_101103122 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006176|Ga0070765_101326932 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006176|Ga0070765_102245973 | Not Available | 509 | Open in IMG/M |
| 3300006871|Ga0075434_100416100 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300006903|Ga0075426_11461423 | Not Available | 519 | Open in IMG/M |
| 3300007076|Ga0075435_100823886 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009143|Ga0099792_10363064 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300009522|Ga0116218_1389210 | Not Available | 622 | Open in IMG/M |
| 3300009523|Ga0116221_1275730 | Not Available | 727 | Open in IMG/M |
| 3300010043|Ga0126380_10393790 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300010043|Ga0126380_10790671 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300010048|Ga0126373_12862151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300010333|Ga0134080_10222793 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300010359|Ga0126376_10890112 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010360|Ga0126372_10159339 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300010360|Ga0126372_12077356 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010361|Ga0126378_12981746 | Not Available | 540 | Open in IMG/M |
| 3300010361|Ga0126378_13323555 | Not Available | 511 | Open in IMG/M |
| 3300010366|Ga0126379_10641464 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300010401|Ga0134121_12929305 | Not Available | 524 | Open in IMG/M |
| 3300011271|Ga0137393_11618341 | Not Available | 537 | Open in IMG/M |
| 3300012202|Ga0137363_11274107 | Not Available | 623 | Open in IMG/M |
| 3300012205|Ga0137362_10454887 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300012206|Ga0137380_10779200 | Not Available | 826 | Open in IMG/M |
| 3300012363|Ga0137390_10108686 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300012917|Ga0137395_10730435 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012922|Ga0137394_10920772 | Not Available | 729 | Open in IMG/M |
| 3300012925|Ga0137419_10521351 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012930|Ga0137407_11069040 | Not Available | 765 | Open in IMG/M |
| 3300012931|Ga0153915_10295583 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300012931|Ga0153915_12238214 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012944|Ga0137410_10307136 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300015053|Ga0137405_1204851 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300015167|Ga0167661_1046655 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300015197|Ga0167638_1031542 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300015264|Ga0137403_10155467 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300016270|Ga0182036_10708490 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300016319|Ga0182033_11177116 | Not Available | 686 | Open in IMG/M |
| 3300016387|Ga0182040_10791478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300016404|Ga0182037_11664298 | Not Available | 568 | Open in IMG/M |
| 3300016422|Ga0182039_10040237 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300016422|Ga0182039_11853914 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300017822|Ga0187802_10455031 | Not Available | 508 | Open in IMG/M |
| 3300017930|Ga0187825_10420192 | Not Available | 516 | Open in IMG/M |
| 3300017933|Ga0187801_10171964 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300017934|Ga0187803_10156469 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300017947|Ga0187785_10732992 | Not Available | 521 | Open in IMG/M |
| 3300017955|Ga0187817_10196958 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300017959|Ga0187779_10971299 | Not Available | 588 | Open in IMG/M |
| 3300017973|Ga0187780_10734069 | Not Available | 713 | Open in IMG/M |
| 3300017974|Ga0187777_10527545 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300018062|Ga0187784_10735656 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300018085|Ga0187772_10141359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 1585 | Open in IMG/M |
| 3300018088|Ga0187771_10052954 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
| 3300020170|Ga0179594_10133390 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300020580|Ga0210403_11059527 | Not Available | 632 | Open in IMG/M |
| 3300020581|Ga0210399_11079356 | Not Available | 643 | Open in IMG/M |
| 3300020582|Ga0210395_11136186 | Not Available | 576 | Open in IMG/M |
| 3300021168|Ga0210406_11134048 | Not Available | 573 | Open in IMG/M |
| 3300021178|Ga0210408_10257920 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300021178|Ga0210408_11044369 | Not Available | 631 | Open in IMG/M |
| 3300021407|Ga0210383_10516043 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300021477|Ga0210398_10024071 | All Organisms → cellular organisms → Bacteria | 5159 | Open in IMG/M |
| 3300021478|Ga0210402_10519783 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300024271|Ga0224564_1116129 | Not Available | 547 | Open in IMG/M |
| 3300025409|Ga0208321_1009088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2070 | Open in IMG/M |
| 3300025419|Ga0208036_1015404 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300026324|Ga0209470_1380605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300026555|Ga0179593_1145939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1723 | Open in IMG/M |
| 3300026557|Ga0179587_10503802 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300026890|Ga0207781_1015943 | Not Available | 772 | Open in IMG/M |
| 3300026979|Ga0207817_1006129 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300027014|Ga0207815_1005986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1642 | Open in IMG/M |
| 3300027024|Ga0207819_1041075 | Not Available | 563 | Open in IMG/M |
| 3300027334|Ga0209529_1026368 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300027376|Ga0209004_1013349 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300027812|Ga0209656_10167636 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300027857|Ga0209166_10335201 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027910|Ga0209583_10158796 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300028021|Ga0265352_1012400 | Not Available | 567 | Open in IMG/M |
| 3300028381|Ga0268264_10428593 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300028906|Ga0308309_10409912 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300029882|Ga0311368_10328561 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300030013|Ga0302178_10481583 | Not Available | 543 | Open in IMG/M |
| 3300030687|Ga0302309_10289074 | Not Available | 816 | Open in IMG/M |
| 3300031564|Ga0318573_10381714 | Not Available | 757 | Open in IMG/M |
| 3300031713|Ga0318496_10505204 | Not Available | 668 | Open in IMG/M |
| 3300031715|Ga0307476_10663168 | Not Available | 773 | Open in IMG/M |
| 3300031718|Ga0307474_11631479 | Not Available | 506 | Open in IMG/M |
| 3300031720|Ga0307469_10139078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1795 | Open in IMG/M |
| 3300031823|Ga0307478_10554668 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300031833|Ga0310917_10876660 | Not Available | 604 | Open in IMG/M |
| 3300031890|Ga0306925_11477560 | Not Available | 666 | Open in IMG/M |
| 3300031946|Ga0310910_10117805 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 1995 | Open in IMG/M |
| 3300031946|Ga0310910_10715960 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031959|Ga0318530_10232110 | Not Available | 759 | Open in IMG/M |
| 3300031962|Ga0307479_10351031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1458 | Open in IMG/M |
| 3300032041|Ga0318549_10382254 | Not Available | 635 | Open in IMG/M |
| 3300032180|Ga0307471_102067964 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032261|Ga0306920_101236776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300032783|Ga0335079_10064988 | All Organisms → cellular organisms → Bacteria | 4156 | Open in IMG/M |
| 3300032892|Ga0335081_11420066 | Not Available | 774 | Open in IMG/M |
| 3300033289|Ga0310914_11895487 | Not Available | 501 | Open in IMG/M |
| 3300033402|Ga0326728_10270003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 1592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00063490 | 2199352024 | Soil | MDQRKVRNRILIFLVLAGVVAYVLVRLSGREPVAKIAAVSPVRDNLVSSIS |
| JGIcombinedJ26739_1002672751 | 3300002245 | Forest Soil | MDQRKLRNRILLFLVVAAIVAYVLVRLSGREPVVKIAAVTPVRD |
| JGIcombinedJ26739_1004407341 | 3300002245 | Forest Soil | MDKRFRNRTILLLIGAAVLAFVLVRLSGRQPVAKISAMIPGRQNIISSVTSNG |
| JGI26337J50220_10368781 | 3300003370 | Bog Forest Soil | MDRRLRNRIVIFLVLAGVAAFVLVKLSGRQPVAKISAVAPIREDLASSI |
| Ga0062385_103745531 | 3300004080 | Bog Forest Soil | MEKKLRNRVLLFLALAAIAAFVLVKISGRQPVAKIAATRPLRENIISSVSS |
| Ga0062386_1005797031 | 3300004152 | Bog Forest Soil | MDKKLRNRTLLFLLLVGIVVFVLIHWSGRQPVAKISAVRPVRQNVVASITSN |
| Ga0066388_1060629732 | 3300005332 | Tropical Forest Soil | MDRRLRNRILLFLLAAGILAYVLVLLSGRQPVTKLSATFPTREN |
| Ga0066388_1077787622 | 3300005332 | Tropical Forest Soil | MERKLRNRILIFLALAAVVAFVLVKLSGRQPVAKIMAVKPVRENLVASVSSN |
| Ga0070708_1009744521 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRRLRNRILLFLLAAGILAYVLVLLSGRQPVAKLSATYP |
| Ga0066695_100878644 | 3300005553 | Soil | MDRRLRNRILLFLVLAAAAAYGLYRLSGRQPAAKIAA |
| Ga0070717_108279162 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRRLRNRILLILLAAGILAYVLLLLSGRQPVAKLSA |
| Ga0075028_1004326812 | 3300006050 | Watersheds | MDRKLRNRILIFLAIAGVVAYGLVRLSGRQPVAKISVIQPIRETLVS |
| Ga0075029_1002870611 | 3300006052 | Watersheds | MDKKFRNRTLLLLLLAGILAFFLIRASGKQPVAKISAMQPVREDIVSSIS |
| Ga0070715_102398922 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MERKLRNRILIFLAAAGIVAYLLVRLSGRQPVARIMAVKPVRENLVASVSTNG |
| Ga0070765_1011031221 | 3300006176 | Soil | MDRRLRNRIVILLLLAGAAAPFLVWLSGRKPAAKI |
| Ga0070765_1013269322 | 3300006176 | Soil | MDRKLRNRILIFLVLAGIVAFALIRFSGRQPVAKIFAV |
| Ga0070765_1022459731 | 3300006176 | Soil | MDRRLRNRILIFLALAGASALVLIKVSGRQPLAKISAVTPV |
| Ga0075434_1004161001 | 3300006871 | Populus Rhizosphere | VDRRLRNRILIFLLLAGIAAIVLISLSGRQPVAKISAVMPV |
| Ga0075426_114614231 | 3300006903 | Populus Rhizosphere | MERKLRNRILIFLVAAGIVAFLLVRLSGRQPIAKIMAVKPV |
| Ga0075435_1008238861 | 3300007076 | Populus Rhizosphere | MERKLRNRVLIFLLVAGIVAFVLVRISGRQPVAKISAMTPKRQN |
| Ga0099792_103630641 | 3300009143 | Vadose Zone Soil | MDRRLRNRIVIFLVLAAIVAFVLVRLSGRQPVAKISAVTP |
| Ga0116218_13892102 | 3300009522 | Peatlands Soil | MDRKLRNRTLLLLGLAAVVAFVLIRVSGHQPVAKISATSPVRQNITLLIS |
| Ga0116221_12757303 | 3300009523 | Peatlands Soil | MDKKLRNRVLVFLLLAGIVAFLLVRVSGRQPVAKIS |
| Ga0126380_103937902 | 3300010043 | Tropical Forest Soil | MDRRLRNRILVFLLAAGILAYVLVLMSGRQPVAKLSATYATRE |
| Ga0126380_107906711 | 3300010043 | Tropical Forest Soil | MERKLRNRILIFLALAAVVAFVLVRLSGRQPVARIMVVKPVRENLVASV |
| Ga0126373_128621511 | 3300010048 | Tropical Forest Soil | MDRRLRNRILLFLLAAGISAYVLVLLSGRQPVAKLSATVPTRENIVSSVS |
| Ga0134080_102227931 | 3300010333 | Grasslands Soil | MERKLRNRILIFLAAAGIVAYLLVRLSGRQPVAKVMAVRP |
| Ga0126376_108901121 | 3300010359 | Tropical Forest Soil | MDRKLRNRILLFLVLAAIAATALISLSGRQPVAKISAVLPVRENI |
| Ga0126372_101593391 | 3300010360 | Tropical Forest Soil | MDRKLRNRTLLFLALAAIVAFVLVRLSGRQPVAKISATTPVRQNIVSSIISN |
| Ga0126372_120773561 | 3300010360 | Tropical Forest Soil | MERKLRNRILIFLALAAVVAFVLVKLSGRQPVAKIMAVKPVREN |
| Ga0126378_129817462 | 3300010361 | Tropical Forest Soil | MDRKLRNRTLLLLVLAGIIAFVLVRISGRQPVAKIAATRPVRQ |
| Ga0126378_133235551 | 3300010361 | Tropical Forest Soil | MDRRLRNRILIFLFAAGVLAYVLVLLSGRQPVAKLSATYPTREN |
| Ga0126377_124396871 | 3300010362 | Tropical Forest Soil | MDRRLRNRILFYLLGAGVLAYVLFLLSGRQPVAKLSAV |
| Ga0126379_106414643 | 3300010366 | Tropical Forest Soil | MDKKLRNRTLLFLLAAGIVAFVLIKISERQPVAKIAAVRPFRQ |
| Ga0134121_129293051 | 3300010401 | Terrestrial Soil | MDRRLRNKIVLFLLAAALVAYGLVWLSGRQPVAKIAAVTPM |
| Ga0137393_116183412 | 3300011271 | Vadose Zone Soil | MDRRLRNRIVIFLILAAVVAIVLVRLSGRQPVAKISAVTP |
| Ga0137363_112741071 | 3300012202 | Vadose Zone Soil | MDRRFRNRILIFLLLATVAAFALVELSGRKPVAKISAVTPTREN |
| Ga0137362_104548871 | 3300012205 | Vadose Zone Soil | MDRRLRNRIILFLALAAVAAVILVRLSGRQPVAKISAVTPV |
| Ga0137380_107792003 | 3300012206 | Vadose Zone Soil | MDRRLRNRILLFLVLAAAAAYGLYRLSGRQPAAKIA |
| Ga0137390_101086861 | 3300012363 | Vadose Zone Soil | MDRRLRNRIVILLVLAGIVAYALVRLTGRQPVAKISAVTPVREN |
| Ga0137395_107304352 | 3300012917 | Vadose Zone Soil | MDRRLRNRILIFLALAAIVAFALVRLSGRQPVAKISAVTPIRENVISSISS |
| Ga0137394_109207721 | 3300012922 | Vadose Zone Soil | MDRRLRNRILLILLAAGILAYMLLLLSGRQPVAKLSAVTPTRENIVS |
| Ga0137419_105213511 | 3300012925 | Vadose Zone Soil | MDRRLRNRILLILLAAGILAYLLLLLSGRQPVAKLSAVKPT |
| Ga0137407_110690402 | 3300012930 | Vadose Zone Soil | MIGFQEFMDKKLRNRTLLFLLLAGIVAFVLIKVSGRQPVAKIS |
| Ga0153915_102955831 | 3300012931 | Freshwater Wetlands | MERKLRNRILLFLLLAGVIAYLLVRISGRQPVAKI |
| Ga0153915_122382142 | 3300012931 | Freshwater Wetlands | MERKLRNRILLFLLLAGVIAYLLVRISGRQPVAKIAAVLPARENLVASISSN |
| Ga0137410_103071361 | 3300012944 | Vadose Zone Soil | MDRRLRNRVLIFLALAAIVAFALVRLSGRQPVAKISAVTPIRENVISSI |
| Ga0137405_12048511 | 3300015053 | Vadose Zone Soil | MERKLRNRILIFLAAAGIVIFLAAAGIVAYLLVRLSGRQP |
| Ga0167661_10466551 | 3300015167 | Glacier Forefield Soil | MDQRKVRNRILIFLALAAIVAYALVRLSGREPVVKIAAVMPVL |
| Ga0167638_10315422 | 3300015197 | Glacier Forefield Soil | MDQRKLRNRILLFLLVAGIVAYALVRLSGREPVVKIAAVTPV |
| Ga0137403_101554674 | 3300015264 | Vadose Zone Soil | LIFLLLAGIAAIVLISLSGRQPVAKISAVMPVRENIVASL |
| Ga0182036_107084902 | 3300016270 | Soil | MDRRLRNRILIFLFAAGVLAYLLVLLSGRQPVAKLSA |
| Ga0182033_111771161 | 3300016319 | Soil | MDRKLRNRTLLFLALAAVVAFVLVRLSGRQPVAKISATTPVRQNIVSSVS |
| Ga0182040_107914781 | 3300016387 | Soil | MERKLRNRVLIFLLVAGIVAFVLVRMSGRQPVAKISAMTPKRQNIVSSISSN |
| Ga0182037_116642982 | 3300016404 | Soil | MDRKLRNRTLLFLALAAVVAFALVRLSGRQPVAKISATTPVRQNIVSSV |
| Ga0182039_100402374 | 3300016422 | Soil | MDRKLRNRALLFLALAGIVAFALVRLSGRQPVAKISAT |
| Ga0182039_118539141 | 3300016422 | Soil | MDRRLRNRILVFLLAAGILAYVLILLSGRQPVAKLSATY |
| Ga0187802_104550312 | 3300017822 | Freshwater Sediment | MDRKLRNRTLLLLGLAAVVAFVLVRVSGRQPIAKISAARPVRQNIVSSTSSN |
| Ga0187825_104201922 | 3300017930 | Freshwater Sediment | MDRRLTRRTLLLLALAAVVAFVLIRVSGRQPVAKISATSPV |
| Ga0187801_101719643 | 3300017933 | Freshwater Sediment | MDERLQLIMDRKLRNRTLLLLGLAAVVAFVLIRVSGRQPVAKISATSPVRQNIMSSIG |
| Ga0187803_101564691 | 3300017934 | Freshwater Sediment | MDRRLTRRTLLLLALAAVVAFVLIRVSGRQPVAKISATSPVRQ |
| Ga0187785_107329922 | 3300017947 | Tropical Peatland | MDKTLRNRTLLFLLLAGIVAFVLVRVSGRQPVAKISAVRPVRQNIVSSI |
| Ga0187817_101969581 | 3300017955 | Freshwater Sediment | MDKTLRNRLLVFLLVAGIVAYYLVWVSGRQPVAKISATTPV |
| Ga0187779_109712992 | 3300017959 | Tropical Peatland | MAAQLQDFMERKLRNRVLIFLLVAGIVAFVLVRISGRQPVAKISAMTPMRQNIV |
| Ga0187780_107340691 | 3300017973 | Tropical Peatland | MDKKLRNRLVVFLLLAGIVAFVLVRISGRQPVAKVSATTP |
| Ga0187777_105275452 | 3300017974 | Tropical Peatland | MDKKLRNRTLFLLVLAGIVAFVLVRISGRQPVAKIAATRPVRQNIAS |
| Ga0187784_107356561 | 3300018062 | Tropical Peatland | MDKKLRNRTISLLVLAALLAFVLIHVSGRQPVAKISASRP |
| Ga0187772_101413591 | 3300018085 | Tropical Peatland | MDRKLRNWTLLLLGLAAVVAFVLVRVSGRQPVAKI |
| Ga0187771_100529544 | 3300018088 | Tropical Peatland | MDKRWRNRTLLLLGLAALAVIVLMRVSGRQPVAKISVTAPVRQDIVSSIIS |
| Ga0179594_101333902 | 3300020170 | Vadose Zone Soil | MDQRKVRNRILICLVLAGVVAYVLVRLSGREPVAKIAAVSPVRDNV |
| Ga0210403_110595271 | 3300020580 | Soil | MDRRLRNRILIFLVLAAVVAFALVRLSGRQPVAKISAVSPIRENVISSISS |
| Ga0210399_110793561 | 3300020581 | Soil | MDRKLRNRILIFLVLAGIVAFTLIRFSGRQPVAKILAVTPIRANVVSSISSN |
| Ga0210395_111361862 | 3300020582 | Soil | MLRNRVLILLGLAAIIAFVLVKVSGRQPVAKISATTPV |
| Ga0210406_111340481 | 3300021168 | Soil | MDRRLRNRIVIFLVLAAIVAFVLVRLTGRQPVAKIAAVTP |
| Ga0210408_102579203 | 3300021178 | Soil | MDKKLRNRTLLFLLLAGIVAFALIKYSGHQPVAKISA |
| Ga0210408_110443691 | 3300021178 | Soil | MDRRLRNRIVIFLVLAAVVAFALVRLSGRQPVAKISAVTPVRENLISS |
| Ga0210383_105160432 | 3300021407 | Soil | MDKKLRNRTLLFLLLVVIVVIVFIKVSGRQPAAKISAVKPFRENI |
| Ga0210398_100240711 | 3300021477 | Soil | MDQRKLRNRILLFLVVAGIVAYVLVRLSGREPVAKIAAVTPVRDNLVSS |
| Ga0210402_105197832 | 3300021478 | Soil | MLRNRVLILLGLAAIIAFVLVRVSGRQPVAKISATT |
| Ga0224564_11161291 | 3300024271 | Soil | MDRRLRNRIVILLLLAGAAAPLLVWLSGRKPAAKISAMTP |
| Ga0208321_10090881 | 3300025409 | Peatland | MDKKLRNRVFAFLLLAGIVAFLLVRISGRPPVAKISATTPVRRNIVASIS |
| Ga0208036_10154041 | 3300025419 | Peatland | MDKKLRNRVFAFLLLAGIVAFLLVRISGRPPVAKIS |
| Ga0207693_109915712 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRRLRNRILLILLAAGILAYVLLLLSGRQPVAKL |
| Ga0207641_105940661 | 3300026088 | Switchgrass Rhizosphere | MDRRLRNRILLFLLAAGILAYVLVLLSGRKPVAKLSATYPTRENIV |
| Ga0209470_13806051 | 3300026324 | Soil | MDRRLRNRLLFFLLAAAILAYLLFLLSGRQPVTKLSAVVPSHE |
| Ga0179593_11459391 | 3300026555 | Vadose Zone Soil | MDKKLRNRTLLLLLLAGIVAFVLIKVSGRQPVAKISAVKPFRHNI |
| Ga0179587_105038021 | 3300026557 | Vadose Zone Soil | MDRRLRNRILIFLALAAIAAFILVRLSGRQPVAKISAVLPIREN |
| Ga0207781_10159431 | 3300026890 | Tropical Forest Soil | MDRKLRNRTLLFLALAGIVAFVLVRLSGRQPVAKISATTPVRQNIVSS |
| Ga0207817_10061292 | 3300026979 | Tropical Forest Soil | MDRKLRNRTLLFLALAGIVAFVLVRLSGRQPVAKISATTPVRQNI |
| Ga0207815_10059861 | 3300027014 | Tropical Forest Soil | MDRKLRNRTLLFLALAAIVAFVLVRLSGRQPVAKISAT |
| Ga0207819_10410751 | 3300027024 | Tropical Forest Soil | MDRKLRNRTILFLLLAGIVAFILVRASGRQPVAKISAMRPARENIVSSV |
| Ga0209529_10263681 | 3300027334 | Forest Soil | MDRRLRNRILIFLLAATVLALILIKVSGRQPVAKISAVTPIRQNIIASIS |
| Ga0209004_10133491 | 3300027376 | Forest Soil | MDKKLRNRTLLFLLLAGIVAFVLIKVSGRQPAAKISA |
| Ga0209656_101676361 | 3300027812 | Bog Forest Soil | MEKKLRNRVLIFLLVAGIVAYVLVRVSGRQPVAKIT |
| Ga0209166_103352013 | 3300027857 | Surface Soil | MERKLRNRILIFLVAAGIVAYLLVRLSGRQPVARIMAVKPVRENLVASVST |
| Ga0209583_101587961 | 3300027910 | Watersheds | MDKKLRNRTLLFLLLAGFVAFVLIKVSGRQPVAKISAVKPFRQN |
| Ga0265352_10124002 | 3300028021 | Soil | MERRLRNRIVISLLLAVVAAIFLVWLSGRKPAAKISAV |
| Ga0268264_104285931 | 3300028381 | Switchgrass Rhizosphere | MDRRLRNRILVFLLAAGILAYVLVLLSGRQPVAKL |
| Ga0308309_104099122 | 3300028906 | Soil | MDRRLRNRIVIFLLLAGVLALVLIKVSGRQPVAKISAVTPVRENI |
| Ga0311368_103285612 | 3300029882 | Palsa | MERVLRNRILIFLVLAAVGAVVLIRLSGRQPVAKITAVRPVRQNIVAFI |
| Ga0302178_104815831 | 3300030013 | Palsa | MERVLRNRILIFLVLAAVGAVVLIRLSGRQPVAKITAVRPVR |
| Ga0302309_102890742 | 3300030687 | Palsa | MDHRLRNRILIFLALAAVAAYALVRLSGRQPVAKISAVTPIREN |
| Ga0170818_1092418153 | 3300031474 | Forest Soil | MDRRLRNRILLILLAAGILAYMLLLLSGRQPVAKLSAVKP |
| Ga0318573_103817141 | 3300031564 | Soil | MDRKLRNRTLVLLVVAGVIAFILVKLSGKQPVAKIAATVPVR |
| Ga0318496_105052042 | 3300031713 | Soil | MDRKLRNRTLLFLALAAVVAFVLVRLSGRQPVAKISATTPVRQNIVSSVSS |
| Ga0307476_106631681 | 3300031715 | Hardwood Forest Soil | MDRKLRNRTLLFLALAAIVAFVLVRLSGRQPVAKISATTPVRQ |
| Ga0307474_116314791 | 3300031718 | Hardwood Forest Soil | MDRRLRNRILIFLVLAGATALVLIRVSGRQPVAKISAVTPVRENIIASI |
| Ga0307469_101390781 | 3300031720 | Hardwood Forest Soil | MDRRLRNRIVIFLVLAGIVAFALVRLSGRQPVAKISAVSPMRE |
| Ga0307478_105546681 | 3300031823 | Hardwood Forest Soil | MDRRLRNRIVIFLALAAVAVFVLVRLTGRQPVAKIAAV |
| Ga0310917_108766601 | 3300031833 | Soil | MDRKLRNRTLLFLALAAVVAFALVRLSGRQPVAKI |
| Ga0306925_114775601 | 3300031890 | Soil | MDRKLRNRTLLFLALAAVVAFALVRLSGRQPVAKIS |
| Ga0310910_101178053 | 3300031946 | Soil | MDRKLRNRTLVLLALAAVTAFILIRVSGRQPVAKIAATR |
| Ga0310910_107159601 | 3300031946 | Soil | MDKKLRNRTLLFLLLAGIAVFAFIRLSNRQPVAKIAAVLPVRQNIV |
| Ga0318530_102321101 | 3300031959 | Soil | MDRKLRNRTLLFLALAAVVAFALVRLSGRQPVAKISATTPVRQNIVSSVSSN |
| Ga0307479_103510311 | 3300031962 | Hardwood Forest Soil | MDRRLRNRIVIFLVLAAIVAFVLVRLTGRQPVAKIAA |
| Ga0318549_103822541 | 3300032041 | Soil | MDRRLRNRILIFLFASGVLAYVLVLLSGRQPVAKL |
| Ga0307471_1020679642 | 3300032180 | Hardwood Forest Soil | MDRRLRNRIVIFLVLAAVAVIVLVRLTGRQPVAKI |
| Ga0306920_1012367762 | 3300032261 | Soil | MDRRLRNRILIFLFAAGVLAYLLVLLSGRQPVAKLSATYPPAKISSPP |
| Ga0335079_100649885 | 3300032783 | Soil | MDRKLRNRIVFFLLGAGVVAFVLVKLSGRQPVAKISAVTPMREN |
| Ga0335081_114200662 | 3300032892 | Soil | MDRKLRNRALILLGFAAIIAFALVRLSGRQPVAKIAATR |
| Ga0310914_118954871 | 3300033289 | Soil | MDRKLRNRTLVLLALAAVTAFILIRVSGRQPVAKIA |
| Ga0326728_102700033 | 3300033402 | Peat Soil | MDKKLRNRVLVFLLLAGIVAYLLVRISGRQPVAKISA |
| ⦗Top⦘ |