| Basic Information | |
|---|---|
| Family ID | F071697 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NPPEIAYWERGEWWLAGDAKPWQPEAVTVVSDRLVFRPRLTPVA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.95 % |
| % of genes near scaffold ends (potentially truncated) | 79.51 % |
| % of genes from short scaffolds (< 2000 bps) | 96.72 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.295 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.590 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.443 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 12.50% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 8.20 |
| PF01724 | DUF29 | 7.38 |
| PF00211 | Guanylate_cyc | 4.92 |
| PF07589 | PEP-CTERM | 1.64 |
| PF08240 | ADH_N | 1.64 |
| PF03641 | Lysine_decarbox | 0.82 |
| PF01527 | HTH_Tnp_1 | 0.82 |
| PF01068 | DNA_ligase_A_M | 0.82 |
| PF07927 | HicA_toxin | 0.82 |
| PF13007 | LZ_Tnp_IS66 | 0.82 |
| PF13340 | DUF4096 | 0.82 |
| PF13683 | rve_3 | 0.82 |
| PF13358 | DDE_3 | 0.82 |
| PF13384 | HTH_23 | 0.82 |
| PF04352 | ProQ | 0.82 |
| PF01695 | IstB_IS21 | 0.82 |
| PF01565 | FAD_binding_4 | 0.82 |
| PF02586 | SRAP | 0.82 |
| PF11154 | DUF2934 | 0.82 |
| PF01609 | DDE_Tnp_1 | 0.82 |
| PF04226 | Transgly_assoc | 0.82 |
| PF12796 | Ank_2 | 0.82 |
| PF13646 | HEAT_2 | 0.82 |
| PF05239 | PRC | 0.82 |
| PF00496 | SBP_bac_5 | 0.82 |
| PF00072 | Response_reg | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 8.20 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 4.92 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.82 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.82 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.82 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.82 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.82 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.82 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.82 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.82 |
| COG3109 | sRNA-binding protein ProQ | Signal transduction mechanisms [T] | 0.82 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.82 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.82 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.30 % |
| All Organisms | root | All Organisms | 37.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004082|Ga0062384_101484327 | Not Available | 501 | Open in IMG/M |
| 3300005332|Ga0066388_103974266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300005345|Ga0070692_10951516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus | 597 | Open in IMG/M |
| 3300005435|Ga0070714_100934733 | Not Available | 842 | Open in IMG/M |
| 3300005435|Ga0070714_102119288 | Not Available | 548 | Open in IMG/M |
| 3300005436|Ga0070713_100221734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
| 3300005436|Ga0070713_101218945 | Not Available | 728 | Open in IMG/M |
| 3300005439|Ga0070711_100199387 | Not Available | 1543 | Open in IMG/M |
| 3300005439|Ga0070711_101719813 | Not Available | 550 | Open in IMG/M |
| 3300005459|Ga0068867_101230790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 689 | Open in IMG/M |
| 3300005534|Ga0070735_10591907 | Not Available | 658 | Open in IMG/M |
| 3300005537|Ga0070730_10219100 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005563|Ga0068855_100097337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 3389 | Open in IMG/M |
| 3300005564|Ga0070664_100551403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300005614|Ga0068856_100389482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1413 | Open in IMG/M |
| 3300006028|Ga0070717_11141029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 710 | Open in IMG/M |
| 3300006028|Ga0070717_11310790 | Not Available | 658 | Open in IMG/M |
| 3300006028|Ga0070717_11692192 | Not Available | 572 | Open in IMG/M |
| 3300006058|Ga0075432_10099744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
| 3300006059|Ga0075017_100413458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
| 3300006163|Ga0070715_10356440 | Not Available | 801 | Open in IMG/M |
| 3300006175|Ga0070712_101328476 | Not Available | 627 | Open in IMG/M |
| 3300006175|Ga0070712_101369100 | Not Available | 617 | Open in IMG/M |
| 3300006237|Ga0097621_100388579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1247 | Open in IMG/M |
| 3300006237|Ga0097621_101235549 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300006755|Ga0079222_12151827 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300007788|Ga0099795_10291674 | Not Available | 715 | Open in IMG/M |
| 3300009098|Ga0105245_10753765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1010 | Open in IMG/M |
| 3300009148|Ga0105243_12550211 | Not Available | 551 | Open in IMG/M |
| 3300009156|Ga0111538_12785746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 612 | Open in IMG/M |
| 3300009176|Ga0105242_10649878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1025 | Open in IMG/M |
| 3300009177|Ga0105248_11843850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 686 | Open in IMG/M |
| 3300009792|Ga0126374_11279366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 591 | Open in IMG/M |
| 3300010048|Ga0126373_10738777 | Not Available | 1044 | Open in IMG/M |
| 3300010048|Ga0126373_12810250 | Not Available | 543 | Open in IMG/M |
| 3300010154|Ga0127503_10832146 | Not Available | 575 | Open in IMG/M |
| 3300010361|Ga0126378_10736489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1097 | Open in IMG/M |
| 3300010361|Ga0126378_10965257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 957 | Open in IMG/M |
| 3300010361|Ga0126378_12110554 | Not Available | 643 | Open in IMG/M |
| 3300010361|Ga0126378_13043698 | Not Available | 534 | Open in IMG/M |
| 3300010366|Ga0126379_12341716 | Not Available | 634 | Open in IMG/M |
| 3300010375|Ga0105239_10411353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1532 | Open in IMG/M |
| 3300010376|Ga0126381_101548921 | Not Available | 958 | Open in IMG/M |
| 3300010376|Ga0126381_102243814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 785 | Open in IMG/M |
| 3300010376|Ga0126381_104695525 | Not Available | 526 | Open in IMG/M |
| 3300010396|Ga0134126_10957173 | Not Available | 960 | Open in IMG/M |
| 3300010397|Ga0134124_12265299 | Not Available | 583 | Open in IMG/M |
| 3300012212|Ga0150985_116841101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 567 | Open in IMG/M |
| 3300012989|Ga0164305_10661795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
| 3300013306|Ga0163162_11052944 | Not Available | 921 | Open in IMG/M |
| 3300013307|Ga0157372_12135276 | Not Available | 643 | Open in IMG/M |
| 3300014325|Ga0163163_11836069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 666 | Open in IMG/M |
| 3300014968|Ga0157379_12625778 | Not Available | 505 | Open in IMG/M |
| 3300014969|Ga0157376_11005196 | Not Available | 857 | Open in IMG/M |
| 3300014969|Ga0157376_12019352 | Not Available | 614 | Open in IMG/M |
| 3300015200|Ga0173480_10234303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 991 | Open in IMG/M |
| 3300015371|Ga0132258_12249955 | Not Available | 1368 | Open in IMG/M |
| 3300015371|Ga0132258_13479865 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300015372|Ga0132256_102010052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 684 | Open in IMG/M |
| 3300015372|Ga0132256_103042836 | Not Available | 564 | Open in IMG/M |
| 3300015374|Ga0132255_102960187 | Not Available | 725 | Open in IMG/M |
| 3300016319|Ga0182033_11071516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 719 | Open in IMG/M |
| 3300016357|Ga0182032_11812255 | Not Available | 533 | Open in IMG/M |
| 3300016371|Ga0182034_11679266 | Not Available | 558 | Open in IMG/M |
| 3300016404|Ga0182037_11626723 | Not Available | 575 | Open in IMG/M |
| 3300016422|Ga0182039_10652499 | Not Available | 924 | Open in IMG/M |
| 3300016422|Ga0182039_11244190 | Not Available | 673 | Open in IMG/M |
| 3300016445|Ga0182038_11731731 | Not Available | 563 | Open in IMG/M |
| 3300018476|Ga0190274_11871036 | Not Available | 695 | Open in IMG/M |
| 3300020582|Ga0210395_10105680 | Not Available | 2083 | Open in IMG/M |
| 3300020583|Ga0210401_10409517 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300020583|Ga0210401_11206866 | Not Available | 615 | Open in IMG/M |
| 3300021374|Ga0213881_10533575 | Not Available | 533 | Open in IMG/M |
| 3300021403|Ga0210397_11589263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300021420|Ga0210394_10472106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
| 3300021475|Ga0210392_10012186 | Not Available | 4650 | Open in IMG/M |
| 3300021475|Ga0210392_11324452 | Not Available | 539 | Open in IMG/M |
| 3300021478|Ga0210402_10447314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1200 | Open in IMG/M |
| 3300021478|Ga0210402_11684896 | Not Available | 561 | Open in IMG/M |
| 3300021560|Ga0126371_10678557 | Not Available | 1179 | Open in IMG/M |
| 3300021560|Ga0126371_11494667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus sphagnicola | 804 | Open in IMG/M |
| 3300021560|Ga0126371_13093630 | Not Available | 563 | Open in IMG/M |
| 3300021560|Ga0126371_13770445 | Not Available | 511 | Open in IMG/M |
| 3300022527|Ga0242664_1049318 | Not Available | 765 | Open in IMG/M |
| 3300025915|Ga0207693_11225883 | Not Available | 565 | Open in IMG/M |
| 3300025925|Ga0207650_11084768 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025928|Ga0207700_10025671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4096 | Open in IMG/M |
| 3300025930|Ga0207701_10384981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1210 | Open in IMG/M |
| 3300025931|Ga0207644_11878144 | Not Available | 501 | Open in IMG/M |
| 3300025938|Ga0207704_11362283 | Not Available | 607 | Open in IMG/M |
| 3300025945|Ga0207679_12186385 | Not Available | 502 | Open in IMG/M |
| 3300025960|Ga0207651_10773016 | Not Available | 850 | Open in IMG/M |
| 3300026078|Ga0207702_11648090 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027857|Ga0209166_10384770 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300028790|Ga0307283_10029046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1220 | Open in IMG/M |
| 3300028876|Ga0307286_10136905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300031092|Ga0308204_10053750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300031231|Ga0170824_127280847 | Not Available | 816 | Open in IMG/M |
| 3300031572|Ga0318515_10308246 | Not Available | 849 | Open in IMG/M |
| 3300031680|Ga0318574_10847769 | Not Available | 535 | Open in IMG/M |
| 3300031682|Ga0318560_10557299 | Not Available | 621 | Open in IMG/M |
| 3300031748|Ga0318492_10586248 | Not Available | 594 | Open in IMG/M |
| 3300031765|Ga0318554_10525637 | Not Available | 669 | Open in IMG/M |
| 3300031777|Ga0318543_10472251 | Not Available | 562 | Open in IMG/M |
| 3300031799|Ga0318565_10374238 | Not Available | 691 | Open in IMG/M |
| 3300031890|Ga0306925_10909067 | Not Available | 905 | Open in IMG/M |
| 3300031890|Ga0306925_10930074 | Not Available | 892 | Open in IMG/M |
| 3300031893|Ga0318536_10567468 | Not Available | 569 | Open in IMG/M |
| 3300031897|Ga0318520_10818188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 585 | Open in IMG/M |
| 3300031912|Ga0306921_11462147 | Not Available | 749 | Open in IMG/M |
| 3300031942|Ga0310916_11517498 | Not Available | 546 | Open in IMG/M |
| 3300031954|Ga0306926_11280292 | Not Available | 857 | Open in IMG/M |
| 3300031954|Ga0306926_11579523 | Not Available | 754 | Open in IMG/M |
| 3300031954|Ga0306926_12315936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 595 | Open in IMG/M |
| 3300031981|Ga0318531_10275685 | Not Available | 760 | Open in IMG/M |
| 3300032008|Ga0318562_10377849 | Not Available | 824 | Open in IMG/M |
| 3300032008|Ga0318562_10913785 | Not Available | 501 | Open in IMG/M |
| 3300032009|Ga0318563_10714180 | Not Available | 538 | Open in IMG/M |
| 3300032044|Ga0318558_10612399 | Not Available | 544 | Open in IMG/M |
| 3300032261|Ga0306920_100818320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1366 | Open in IMG/M |
| 3300032261|Ga0306920_103918457 | Not Available | 542 | Open in IMG/M |
| 3300034817|Ga0373948_0149245 | Not Available | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062384_1014843271 | 3300004082 | Bog Forest Soil | VILGQNPPEIAYWERGEWWLAGDPKPWHPEAVTVVSDRLVFKPRLTPVA* |
| Ga0066388_1039742662 | 3300005332 | Tropical Forest Soil | AYWERGEWWLAGDAKPWHSEAVTAVSERLVFKPRLAPVA* |
| Ga0070692_109515161 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VILGQNPPEIAYWERGEWWLAGDAKPWQPDAVTVASERLVFKPRLAPVA* |
| Ga0070714_1009347332 | 3300005435 | Agricultural Soil | NPPEIAYWERGEWWLAGDAKPWQPEAVTVVSDRLVFRPRLTPVA* |
| Ga0070714_1021192881 | 3300005435 | Agricultural Soil | VVLGQNPPEVAYSQRGESWLAGDAKPWAGDAVTVVSDRLIYRPPLKPVA* |
| Ga0070713_1002217344 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAYWERGEWWLSGDAKPWQPDAVTVVSDRLVFRPRLAPVA* |
| Ga0070713_1012189451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VQTASGACRWLSWVELGQNPPEIAYWERAGDAKPWQPEAVTVVSDRLVFRPRLTPVA* |
| Ga0070711_1001993871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VQTASGACRWLSWVELGQNPPEIAYWGEGGDAKPWQPEAVTVVSDRLVFRPRLTPVA* |
| Ga0070711_1017198131 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LGQNPPEIAYWERGEWWLAGEARPWQPAAVNVLGDKLVFRPRLTPVAGRAPWHP* |
| Ga0068867_1012307902 | 3300005459 | Miscanthus Rhizosphere | GQNPPEIAYWERGEWWLAGDAKPWHPDAVAVISERLVFKPRLAPVA* |
| Ga0070735_105919071 | 3300005534 | Surface Soil | NPPEVAYWERGEWWLCSNEMPWQPEAVTVVSDRLVFRPRLSPVA* |
| Ga0070730_102191002 | 3300005537 | Surface Soil | PEIAYWERGEWWLCGESRPWRPDSVTVVSNRLVFRPKPLPVA* |
| Ga0068855_10009733710 | 3300005563 | Corn Rhizosphere | PEVAYWERGEWWLACDAKPWQPEAVTVVSERLVFKPRLSPVA* |
| Ga0070664_1005514033 | 3300005564 | Corn Rhizosphere | RGEWWLAGDPNPWQPEAVTVISERLVFTPRLKPVA* |
| Ga0068856_1003894821 | 3300005614 | Corn Rhizosphere | VILGQNPPEIAYWERGEWWLAGDAKPWQPDAVTVASERLVFKPRL |
| Ga0070717_111410291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QNPPEIAYWERGEWWLAGEARPWHPEAVTVASDRLVFKPRLKPVAA* |
| Ga0070717_113107901 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VILGQNPPEIAYRERGERWLAGDARPWKAEAATFASESSGIQT* |
| Ga0070717_116921923 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ILGQNPPEIAYWERGEWWLAGDAKPWHPEAVTVASDRLVFTPRLKPVA* |
| Ga0075432_100997442 | 3300006058 | Populus Rhizosphere | VILGQNPPEIAYWERGEWWLAGDAKPWHSEAVTVASDRLV* |
| Ga0075017_1004134582 | 3300006059 | Watersheds | GFYGVILGQNPPAIAYWERGEWWLAGEARPWQPEAATVASERLVFKPRLAPVV* |
| Ga0070715_103564402 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PEIAYWERGEWWLAGDAKPWQPEAVVVISDRLVFTPRLRPVT* |
| Ga0070712_1013284761 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGEWWLAGDAKPWQPEAVTVVSDRLVFRPRLTPVA* |
| Ga0070712_1013691003 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AYWERGEWWLAGDARPWQPDAVIVLGDKLVFRPRLTPVV* |
| Ga0097621_1003885791 | 3300006237 | Miscanthus Rhizosphere | VIVGQNPPEIAYWERGEWWLAGDAKPWHPEAVTVASDRLVFTPRLKPVA* |
| Ga0097621_1012355492 | 3300006237 | Miscanthus Rhizosphere | LGQNPPEIAYWERGEWWLANDAKPRQSEAVTVVSDRLVFKPRLSPVA* |
| Ga0079222_121518272 | 3300006755 | Agricultural Soil | VVLGQNPPEVACWERGEWWLAGDAKPWQAEAVTVVSDRLMYRPPLKPVAYLRSSFV* |
| Ga0099795_102916742 | 3300007788 | Vadose Zone Soil | VVLGENPPEIAYREHGEWWLAGDARPWQPDAVNVLSDKLVFRPRLTSVAGRDVWPP* |
| Ga0105245_107537653 | 3300009098 | Miscanthus Rhizosphere | FYWVIVGQNPPEIAYWERGEWWLAGDAKPWHPEAVTVASDRLVFTPRLKPVA* |
| Ga0105243_125502111 | 3300009148 | Miscanthus Rhizosphere | RGEWWLANDAKPRQSEAVTVVSDRLVFKPRLSPVA* |
| Ga0111538_127857461 | 3300009156 | Populus Rhizosphere | RGEWWLACDAKPWQPEAGTVVSERWVFKPRLAPVA* |
| Ga0105242_106498781 | 3300009176 | Miscanthus Rhizosphere | QNPPEIAYWEHGEWWLAGDAKPWQSEAVTVVSERLVFKPRLSPVA* |
| Ga0105248_118438503 | 3300009177 | Switchgrass Rhizosphere | RLEGFYWVILGQNPPEVAYWERGEWWLAGDAKPWQPEAVTVVSERLV* |
| Ga0126374_112793661 | 3300009792 | Tropical Forest Soil | WVMLGKNPPEIAYWERGEWWLAGDPKAWQPDAVSVVSDRLVFKPRLSRVA* |
| Ga0126373_107387771 | 3300010048 | Tropical Forest Soil | WERGEWWLAGDPKPWHSDAVTVVSERLVFEPRLTPVA* |
| Ga0126373_128102502 | 3300010048 | Tropical Forest Soil | GPDPPEIAYWERGEWWLAGNATPWQPVVVTVVSDRLVFKPRLAPVA* |
| Ga0127503_108321462 | 3300010154 | Soil | VILGQNPPEIAYWERGEWWLCGEGRPWHPEAVSVASDRLVFKPKLVPVA* |
| Ga0126378_107364891 | 3300010361 | Tropical Forest Soil | YWERGEWWLAGDPRPWHPEAVTVVSGRLMFKPKLVPVA* |
| Ga0126378_109652571 | 3300010361 | Tropical Forest Soil | PEIAYWERGEWWLAGDPKPWQPEAVTVVSDRLVFKPKLVPVA* |
| Ga0126378_121105541 | 3300010361 | Tropical Forest Soil | SPSRDAWWLAGDARPWQPGAVTVLSERLVFRPRLVPVA* |
| Ga0126378_130436981 | 3300010361 | Tropical Forest Soil | ERGEWWLAGDPKPWQPDAVTVLSDRLVFRPRLAPVA* |
| Ga0126379_123417162 | 3300010366 | Tropical Forest Soil | MGRNPPEIAYWERGEWWLAGDSKPWQPEAVTVASERLVFKPRLVPVA* |
| Ga0105239_104113534 | 3300010375 | Corn Rhizosphere | EIAYWERAEWWLAGDAKPWHPDAVAVISERLVFKPRLAPVA* |
| Ga0126381_1015489212 | 3300010376 | Tropical Forest Soil | VSLGQNPPEIAYWERGEWWLAGDPKPWQPEAVTVLSNRLVFRPRVAPVAA* |
| Ga0126381_1022438141 | 3300010376 | Tropical Forest Soil | VTAGAGPDPPEIAYWERGEWWLAGDPNPWQTEAVTVVSDRLVFRPRLTPVA* |
| Ga0126381_1046955251 | 3300010376 | Tropical Forest Soil | PKIADWERGEWWLAGDAKPWHADAVTVASDRLIFRPRLTPVA* |
| Ga0134126_109571731 | 3300010396 | Terrestrial Soil | VQTASGACRWLSWVELGQNPPEIAYWERGEWWLAGDAKPWQPEAVNVVSDRLVFRPRLTPVA* |
| Ga0134124_122652991 | 3300010397 | Terrestrial Soil | VILGQNPPEIAYWERGEWWLSGDAKPWQPDAVTVVSDRLVFRPRLAPVA* |
| Ga0150985_1168411013 | 3300012212 | Avena Fatua Rhizosphere | PEIAYWERGEWWLAGDPKPWQPEAVTVASERLVFTPRLTPVA* |
| Ga0164305_106617952 | 3300012989 | Soil | VLGPNPLEIAYWERSEWWLRGEDSPWKPEAVRIASDRLVFRPRLSPVAYNVG |
| Ga0163162_110529442 | 3300013306 | Switchgrass Rhizosphere | VLGQNPPEIAYWERGEWWLTGDGKPWQPDAVNVLSDRLMFRPRLMPVA* |
| Ga0157372_121352763 | 3300013307 | Corn Rhizosphere | GEWWLAGDAKPWQLEAVTVVSERLVFKPRLSPVA* |
| Ga0163163_118360692 | 3300014325 | Switchgrass Rhizosphere | VVLGQNPPEIAYWERGEWWLANDAKPRQSEAVTVVSDRLVFKPRLSPVA* |
| Ga0157379_126257781 | 3300014968 | Switchgrass Rhizosphere | YWVPEIAYWERGERWLAGDARPWQPDGVTVLGDRLVFRPRLMPVS* |
| Ga0157376_110051963 | 3300014969 | Miscanthus Rhizosphere | QNPPEIAYRERGEWWLAGDAKPWQPDAVTVARDRLLFTPRLKPAA* |
| Ga0157376_120193522 | 3300014969 | Miscanthus Rhizosphere | EGSYWVVLGQNPREIAYREQGEWWLAGDAEPWQPDAVTVLGDKLVVRPRGCR* |
| Ga0173480_102343032 | 3300015200 | Soil | LGQNPPEIAYWERGEWWLAGDAKPWHPDAVAVVSERLVFAPRLKPVA* |
| Ga0132258_122499551 | 3300015371 | Arabidopsis Rhizosphere | NPPEIAYWERGEWWLAGDPKPWHPEAVTVASDRLVFKPRLAPVA* |
| Ga0132258_134798652 | 3300015371 | Arabidopsis Rhizosphere | MREGFYWVILGQNPPEIAYWERGEWWLAGDPKPWLPDAVIAVSERLVPVA* |
| Ga0132256_1020100522 | 3300015372 | Arabidopsis Rhizosphere | VILGQNPPEIAYWERNEWWLAGDARPWRPDAVSVVSDRLVFRPQLMPVA* |
| Ga0132256_1030428362 | 3300015372 | Arabidopsis Rhizosphere | LGQNPPEIAYWVSGEWWLAGEAKPWHPKAVTVVSDPLVFKPRLAPVA* |
| Ga0132255_1029601874 | 3300015374 | Arabidopsis Rhizosphere | RGEWWLAGDPKPWRPEAVTVVSDQLVLKPRLVPVA* |
| Ga0182033_110715162 | 3300016319 | Soil | YWERGEWWLCGEDRPWQPEAVNVVSNRLVFRPRLFPVA |
| Ga0182032_118122551 | 3300016357 | Soil | GTAGGLLLGGLGQNPPEIAYLERGEWWLAGDPTPWPPEAVTVVSDRLVFKPRLVPAA |
| Ga0182034_116792662 | 3300016371 | Soil | WERGEWWLCGESRPWHPDAVTVASDRLVFKPRLAPVA |
| Ga0182037_116267231 | 3300016404 | Soil | WVVLGQNPPEIAYWERGEWWLAGDARPWQPEAVTVLSDRLVFRPRLVPIA |
| Ga0182039_106524993 | 3300016422 | Soil | VLGQNPPEIAYWERGEWWLAGDPRPWQPDAVTAVSGRLVFRPRLVAVA |
| Ga0182039_112441901 | 3300016422 | Soil | VLGQNPPEIAYWERGEWWLAGDARPWQPEAVTVLSDRLMFRPRLVPVA |
| Ga0182038_117317311 | 3300016445 | Soil | NPPEIAYRERGEWWLCGEDRPWQPEAVTVASDRLVFKPRLSPVA |
| Ga0190274_118710361 | 3300018476 | Soil | RNPPEIAYWERGEWWLAGDAKPWHPDAVAVVSERLVFTPRLKPVA |
| Ga0210395_101056806 | 3300020582 | Soil | VILGQNPPEIAYWERGEWWLAGEAKPWHPEAVTVVSDRL |
| Ga0210401_104095171 | 3300020583 | Soil | PPEIAYWERGEWWLAGDPKPWHPEAVTVVSDRLVFKPKLVPVA |
| Ga0210401_112068661 | 3300020583 | Soil | EIAYWERGEWWLAGEPRPWQPEAVTVASDRLVFKPRLALVA |
| Ga0213881_105335752 | 3300021374 | Exposed Rock | MPAGRRPWERGEWWLAGDARPWHDDAVTIASDRLVFRPALLPAA |
| Ga0210397_115892631 | 3300021403 | Soil | GFYWVTLGQNPPEIAYWERGEWWLAGDPRPWQPDAVEVLSDTLVYRPRPRLVPAA |
| Ga0210394_104721063 | 3300021420 | Soil | VAYWERGEWWLCANEKPWHPDAVTVVSDRLVYRPRLTPVA |
| Ga0210392_100121865 | 3300021475 | Soil | VILGQHPPEIAYGERGEWWLAGEAKPWHPEAVTVVSDRLVFKP |
| Ga0210392_113244521 | 3300021475 | Soil | SQNPPEIAYWERREWWLAGDAKSWQPEAVTVVSDRLIFRPRTALW |
| Ga0210402_104473142 | 3300021478 | Soil | VVLGQNPPEIAYWERGERWLAGDARPWQPDAVNVLSDKLVFGRLTPVA |
| Ga0210402_116848963 | 3300021478 | Soil | NPPEIACWESGEWWLAGEARPWHPKAVTVASDRLVFTPQLKPVA |
| Ga0126371_106785571 | 3300021560 | Tropical Forest Soil | VVLGQNPPEIAYWERGEWWLAGDPKPWHQEAVTVVSDRLVFKPRL |
| Ga0126371_114946671 | 3300021560 | Tropical Forest Soil | IAYWERGEWWLAGDPRPWRSDAVIVASEQLVFKPRLAPVA |
| Ga0126371_130936302 | 3300021560 | Tropical Forest Soil | FYWVALGQNPPEIAYWERGEWWLAGDARPWQADAVTVLSDRLVFRPRLAPVA |
| Ga0126371_137704452 | 3300021560 | Tropical Forest Soil | NPPEIAYWERGEWWLAGSATPWQPDAVTVISERLVFKPRLTPVA |
| Ga0242664_10493182 | 3300022527 | Soil | VILGQNPPEIAYWERGEWWLAGEAKPRHPEALTVVSDRLVFKP |
| Ga0207693_112258832 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGEWWLAGDAKPWQPEAVTVVSDRLVFRPRLTPVA |
| Ga0207650_110847682 | 3300025925 | Switchgrass Rhizosphere | EIAYWERGEWWLAGDAKPWLPEAATVVSERLVFTPRLKPVA |
| Ga0207700_100256716 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAYWERGEWWLSGDAKPWQPDAVTVVSDRLVFRPRLAPVA |
| Ga0207701_103849811 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ILGRNPPEVAYWERGEWWLACDAKPWQPEAVTVVSERWVFKPRLAPVA |
| Ga0207644_118781441 | 3300025931 | Switchgrass Rhizosphere | PEVAYCERGEWWLAGDSKPWQPEAVTVIIERLVFTPRLKPVA |
| Ga0207704_113622833 | 3300025938 | Miscanthus Rhizosphere | WERGEWWLAGDAKPWQPDAVTVASHRLLFKPRLTPVA |
| Ga0207679_121863851 | 3300025945 | Corn Rhizosphere | EPTRDAYWERGEWWLTGDPKPWQPEAVTVASDRLVFRPQLTPVA |
| Ga0207651_107730161 | 3300025960 | Switchgrass Rhizosphere | TGSAASGWLAGDAKPRQPEAVTVVSERLVFKPRLSSVA |
| Ga0207702_116480902 | 3300026078 | Corn Rhizosphere | GRFYWVVLGQNPPEVAYWERGEWWLAGDAKPWHAEAVTVVSDRLICRPPLKPVA |
| Ga0209166_103847702 | 3300027857 | Surface Soil | GQNPPEIAYWERGEWWLCGESRPWRPDSVTVVSNRLVFRPKPLPVA |
| Ga0307283_100290461 | 3300028790 | Soil | GQNPPEIAYWERGEWWLAGDARPWQPDAVNVLSDKLVFTPRPTPVAGRDPWRP |
| Ga0307286_101369051 | 3300028876 | Soil | WVILGQNPPEIAYWERGEWWLTGDPKPWHPEAVTVVSERLVFKPRLAAVV |
| Ga0308204_100537503 | 3300031092 | Soil | LGQNPPEIAYWERGEWWLAGDARPWQPAAVNVLSDKLVFRPRLAPVAGRDLWHP |
| Ga0170824_1272808474 | 3300031231 | Forest Soil | ACWERGEWWLAGDAKPWQPEAVTVVSDRLVFKPRLAPVP |
| Ga0318515_103082464 | 3300031572 | Soil | VVLGRNPPEIAYWERGEWWLAGDPKPWHPEAVTVVSDRLVFKPRLVPVA |
| Ga0318574_108477691 | 3300031680 | Soil | WERGEWWLAGDPKPWHPEAVTVVSDRLVFKPRLMPVA |
| Ga0318560_105572991 | 3300031682 | Soil | NCLLEAGEWWLAGDARPWRPEAVTVLSDRLVFRPRLVPIA |
| Ga0318492_105862483 | 3300031748 | Soil | WERAVWWLAGDPKPWHPDAVTVVSDRLVFKPRLMPVA |
| Ga0318554_105256373 | 3300031765 | Soil | VVLGQNPPEIAYWERGEWWLAGDARPWQPEAVTVLSDRLVFRPRLVPIA |
| Ga0318543_104722511 | 3300031777 | Soil | VVLGRNPPEIAYRERGEWRLAGDPKPWHSEAVTVVSDRAVFK |
| Ga0318565_103742382 | 3300031799 | Soil | WVVLGQNPPEIAYWERGEWWLAGDPKPWQPEAVTVASDRLVFKPRLAPVA |
| Ga0306925_109090672 | 3300031890 | Soil | VVLGQNPPEIAYWERGEWWLAGDARPWQPEAVTVLSDRLVFRPRLVPVA |
| Ga0306925_109300742 | 3300031890 | Soil | GQNPPEIAYWERGEWWLAGDPKPWQPEAVTVVSDRLAFKPRLAPVA |
| Ga0318536_105674681 | 3300031893 | Soil | GRNPPEIAYWERGEWWLAGDPKPWHPEAVTVVSDRLVFKPRLVPVA |
| Ga0318520_108181882 | 3300031897 | Soil | VLGQNPPEVAYWERGEWWLCGEDRPWQPEAVNVVSNRLVFRPRLFPVA |
| Ga0306921_114621472 | 3300031912 | Soil | AYWTRGEWWLVGDTQPYQPEACSVVSDRLVFKPRLAPVA |
| Ga0310916_115174981 | 3300031942 | Soil | VILGQNPPEIAYWERGEWWLAGDPKPWQPEAVTVVSDRLAFKPRLAPVA |
| Ga0306926_112802921 | 3300031954 | Soil | YWERGEWWLAGDPKPWQPEAATAISDRLVFKPRLVPVA |
| Ga0306926_115795231 | 3300031954 | Soil | GFYWVILGQNPPEIAHRERGEWWLAGDAKPWHADAVTVASDRLIFRPRLTPVA |
| Ga0306926_123159361 | 3300031954 | Soil | EIAYWERGEWWLAGDAKPWQAEAVTVVSDRLVFKPRLAPVA |
| Ga0318531_102756852 | 3300031981 | Soil | VVLDKNPPEIAYWERGEWWLAGDPKPWQPEAVTVVSERLVFKPRLVPVA |
| Ga0318562_103778494 | 3300032008 | Soil | YWERGEWWLAGDPKPWQPEAVTVVSDRLVFKPRLVPVA |
| Ga0318562_109137851 | 3300032008 | Soil | YWERGEWWLAGDPKPWQPEAVTVVSDRLVFEPRLAPVV |
| Ga0318563_107141801 | 3300032009 | Soil | YWVVLGQNPPEIAYWERGEWWLAGDARPWQPEAVTVLSDRLVFRPRLVPVA |
| Ga0318558_106123991 | 3300032044 | Soil | GQNPPEIAYWERGEWWLAGDPKPWRQEAVAVASERLVFKPRLAPVA |
| Ga0306920_1008183201 | 3300032261 | Soil | LGQKPEIAYWERGEWGLAGDPKPWNPEAVTVVSDRLVFKPRLAPVA |
| Ga0306920_1039184572 | 3300032261 | Soil | VLGQNPPEIAYWERSEWWLAGDARPWQPEAVTVLGDRLVFQPRLAPAA |
| Ga0373948_0149245_1_108 | 3300034817 | Rhizosphere Soil | RGEWWLAGDAKPWQSEAVTVVSERLVFKPRLSPVA |
| ⦗Top⦘ |