NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071681

Metagenome / Metatranscriptome Family F071681

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071681
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 43 residues
Representative Sequence AAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK
Number of Associated Samples 102
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.62 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.180 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(22.131 % of family members)
Environment Ontology (ENVO) Unclassified
(20.492 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.082 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.50%    β-sheet: 8.33%    Coil/Unstructured: 79.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF01494FAD_binding_3 94.26
PF13564DoxX_2 3.28
PF07992Pyr_redox_2 0.82
PF13368Toprim_C_rpt 0.82
PF07167PhaC_N 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 188.52
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 94.26
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 94.26
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 94.26
COG3243Poly-beta-hydroxybutyrate synthaseLipid transport and metabolism [I] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.18 %
UnclassifiedrootN/A0.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02JNL2UAll Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300001356|JGI12269J14319_10188726All Organisms → cellular organisms → Bacteria → Terrabacteria group825Open in IMG/M
3300003218|JGI26339J46600_10067950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia918Open in IMG/M
3300003218|JGI26339J46600_10115692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia646Open in IMG/M
3300003659|JGI25404J52841_10031065All Organisms → cellular organisms → Bacteria → Terrabacteria group1142Open in IMG/M
3300004643|Ga0062591_101610282All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300004977|Ga0072329_1371008All Organisms → cellular organisms → Bacteria → Terrabacteria group992Open in IMG/M
3300005164|Ga0066815_10012071All Organisms → cellular organisms → Bacteria → Terrabacteria group1086Open in IMG/M
3300005327|Ga0070658_10695344All Organisms → cellular organisms → Bacteria → Terrabacteria group882Open in IMG/M
3300005366|Ga0070659_100837069All Organisms → cellular organisms → Bacteria → Terrabacteria group801Open in IMG/M
3300005435|Ga0070714_101260852All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300005435|Ga0070714_102038119All Organisms → cellular organisms → Bacteria → Terrabacteria group559Open in IMG/M
3300005436|Ga0070713_101561727All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300005459|Ga0068867_101132205All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300005541|Ga0070733_10626250All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300005545|Ga0070695_100246341All Organisms → cellular organisms → Bacteria → Terrabacteria group1299Open in IMG/M
3300005614|Ga0068856_101685131All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300005614|Ga0068856_101946590All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300005834|Ga0068851_10660728All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300006028|Ga0070717_10133762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2134Open in IMG/M
3300006028|Ga0070717_10493982All Organisms → cellular organisms → Bacteria → Terrabacteria group1106Open in IMG/M
3300006028|Ga0070717_11138461All Organisms → cellular organisms → Bacteria → Terrabacteria group710Open in IMG/M
3300006086|Ga0075019_11048457All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300006102|Ga0075015_100559009All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300006102|Ga0075015_100934362All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300006163|Ga0070715_10661451All Organisms → cellular organisms → Bacteria → Terrabacteria group619Open in IMG/M
3300006173|Ga0070716_100813395All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300006173|Ga0070716_100833958All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300006237|Ga0097621_100345741All Organisms → cellular organisms → Bacteria → Terrabacteria group1321Open in IMG/M
3300006354|Ga0075021_10788287All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300006755|Ga0079222_10764204All Organisms → cellular organisms → Bacteria → Terrabacteria group780Open in IMG/M
3300006755|Ga0079222_12506560All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300006804|Ga0079221_10709405All Organisms → cellular organisms → Bacteria → Terrabacteria group702Open in IMG/M
3300006893|Ga0073928_10105704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2351Open in IMG/M
3300009523|Ga0116221_1089406All Organisms → cellular organisms → Bacteria → Terrabacteria group1371Open in IMG/M
3300009525|Ga0116220_10073577All Organisms → cellular organisms → Bacteria → Terrabacteria group1435Open in IMG/M
3300009551|Ga0105238_13037744All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300009624|Ga0116105_1053487All Organisms → cellular organisms → Bacteria → Terrabacteria group933Open in IMG/M
3300009683|Ga0116224_10179263All Organisms → cellular organisms → Bacteria → Terrabacteria group1017Open in IMG/M
3300009683|Ga0116224_10433539All Organisms → cellular organisms → Bacteria → Terrabacteria group626Open in IMG/M
3300009683|Ga0116224_10519833All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300009698|Ga0116216_10037614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3000Open in IMG/M
3300009698|Ga0116216_10233174All Organisms → cellular organisms → Bacteria → Terrabacteria group1126Open in IMG/M
3300009698|Ga0116216_10656576All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300009700|Ga0116217_10272478All Organisms → cellular organisms → Bacteria → Terrabacteria group1094Open in IMG/M
3300009824|Ga0116219_10466744All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300009839|Ga0116223_10285218All Organisms → cellular organisms → Bacteria → Terrabacteria group989Open in IMG/M
3300010048|Ga0126373_10530557All Organisms → cellular organisms → Bacteria → Terrabacteria group1223Open in IMG/M
3300010341|Ga0074045_10442812All Organisms → cellular organisms → Bacteria → Terrabacteria group839Open in IMG/M
3300010379|Ga0136449_101988399All Organisms → cellular organisms → Bacteria → Terrabacteria group859Open in IMG/M
3300010379|Ga0136449_102360411All Organisms → cellular organisms → Bacteria → Terrabacteria group769Open in IMG/M
3300010379|Ga0136449_102739880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300010876|Ga0126361_10582875All Organisms → cellular organisms → Bacteria → Terrabacteria group1100Open in IMG/M
3300011084|Ga0138562_1183359All Organisms → cellular organisms → Bacteria → Terrabacteria group538Open in IMG/M
3300012285|Ga0137370_11038672All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300013306|Ga0163162_11886590All Organisms → cellular organisms → Bacteria → Terrabacteria group684Open in IMG/M
3300014199|Ga0181535_10384787All Organisms → cellular organisms → Bacteria → Terrabacteria group824Open in IMG/M
3300015374|Ga0132255_105741527All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300016387|Ga0182040_10648868All Organisms → cellular organisms → Bacteria → Terrabacteria group859Open in IMG/M
3300017823|Ga0187818_10027332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2442Open in IMG/M
3300017926|Ga0187807_1079609All Organisms → cellular organisms → Bacteria → Terrabacteria group1024Open in IMG/M
3300017928|Ga0187806_1372535All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300017946|Ga0187879_10651006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300017955|Ga0187817_10924442All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300018001|Ga0187815_10491683All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300018043|Ga0187887_10166984All Organisms → cellular organisms → Bacteria → Terrabacteria group1315Open in IMG/M
3300020002|Ga0193730_1073391All Organisms → cellular organisms → Bacteria → Terrabacteria group972Open in IMG/M
3300020580|Ga0210403_10999696All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300021374|Ga0213881_10011574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3621Open in IMG/M
3300021377|Ga0213874_10153951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772804Open in IMG/M
3300021475|Ga0210392_10352788All Organisms → cellular organisms → Bacteria → Terrabacteria group1065Open in IMG/M
3300021560|Ga0126371_11661204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300025910|Ga0207684_10410034All Organisms → cellular organisms → Bacteria → Terrabacteria group1165Open in IMG/M
3300025927|Ga0207687_10286678All Organisms → cellular organisms → Bacteria → Terrabacteria group1322Open in IMG/M
3300025939|Ga0207665_11191009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300025986|Ga0207658_10395489All Organisms → cellular organisms → Bacteria → Terrabacteria group1214Open in IMG/M
3300026142|Ga0207698_10190095All Organisms → cellular organisms → Bacteria → Terrabacteria group1828Open in IMG/M
3300027003|Ga0207722_1024844All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300027035|Ga0207776_1028291All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300027039|Ga0207855_1023414All Organisms → cellular organisms → Bacteria → Terrabacteria group839Open in IMG/M
3300027497|Ga0208199_1012372All Organisms → cellular organisms → Bacteria → Terrabacteria group1971Open in IMG/M
3300027604|Ga0208324_1003059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6129Open in IMG/M
3300027725|Ga0209178_1176480All Organisms → cellular organisms → Bacteria → Terrabacteria group748Open in IMG/M
3300027727|Ga0209328_10129905Not Available768Open in IMG/M
3300027853|Ga0209274_10458893All Organisms → cellular organisms → Bacteria → Terrabacteria group659Open in IMG/M
3300027854|Ga0209517_10019543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6396Open in IMG/M
3300027854|Ga0209517_10386017All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300027867|Ga0209167_10481218All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300028380|Ga0268265_12121573All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300028381|Ga0268264_10881701All Organisms → cellular organisms → Bacteria → Terrabacteria group897Open in IMG/M
3300028768|Ga0307280_10022619All Organisms → cellular organisms → Bacteria → Terrabacteria group1821Open in IMG/M
3300030494|Ga0310037_10204894All Organisms → cellular organisms → Bacteria → Terrabacteria group872Open in IMG/M
3300030494|Ga0310037_10324942All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300030707|Ga0310038_10223675All Organisms → cellular organisms → Bacteria → Terrabacteria group885Open in IMG/M
3300031524|Ga0302320_10412249All Organisms → cellular organisms → Bacteria → Terrabacteria group1695Open in IMG/M
3300031564|Ga0318573_10292151All Organisms → cellular organisms → Bacteria → Terrabacteria group872Open in IMG/M
3300031564|Ga0318573_10784992All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300031573|Ga0310915_10123495All Organisms → cellular organisms → Bacteria → Terrabacteria group1769Open in IMG/M
3300031668|Ga0318542_10699177All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300031708|Ga0310686_104357027All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300031716|Ga0310813_10548990All Organisms → cellular organisms → Bacteria → Terrabacteria group1016Open in IMG/M
3300031736|Ga0318501_10202343All Organisms → cellular organisms → Bacteria → Terrabacteria group1039Open in IMG/M
3300031765|Ga0318554_10253471All Organisms → cellular organisms → Bacteria → Terrabacteria group1002Open in IMG/M
3300031769|Ga0318526_10348674All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300031832|Ga0318499_10435938All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300031896|Ga0318551_10312467All Organisms → cellular organisms → Bacteria → Terrabacteria group885Open in IMG/M
3300031897|Ga0318520_10392009All Organisms → cellular organisms → Bacteria → Terrabacteria group848Open in IMG/M
3300031918|Ga0311367_11261105All Organisms → cellular organisms → Bacteria → Terrabacteria group732Open in IMG/M
3300031954|Ga0306926_11643929All Organisms → cellular organisms → Bacteria → Terrabacteria group735Open in IMG/M
3300032008|Ga0318562_10364274All Organisms → cellular organisms → Bacteria → Terrabacteria group840Open in IMG/M
3300032076|Ga0306924_12180890All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300032160|Ga0311301_10041292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae11108Open in IMG/M
3300032160|Ga0311301_10314846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2489Open in IMG/M
3300032160|Ga0311301_12477218All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300032770|Ga0335085_10351255All Organisms → cellular organisms → Bacteria → Terrabacteria group1728Open in IMG/M
3300032805|Ga0335078_12422676All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300032828|Ga0335080_10363656All Organisms → cellular organisms → Bacteria → Terrabacteria group1559Open in IMG/M
3300032828|Ga0335080_11081621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300032892|Ga0335081_10494991All Organisms → cellular organisms → Bacteria → Terrabacteria group1540Open in IMG/M
3300032954|Ga0335083_10765984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300033158|Ga0335077_11982849All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300033289|Ga0310914_10633729All Organisms → cellular organisms → Bacteria → Terrabacteria group962Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil22.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.10%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.28%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.64%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.64%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.82%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.82%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.82%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.82%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004977Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_066393602170459005Grass SoilRVTAAHEDGRLVLTVTGADPDRVRDAVTGFALTIRSGPSPAEQTTNK
JGI12269J14319_1018872623300001356Peatlands SoilTVTGADPGRVRDAVAGFAVTVRCGPSPAEQTTSK*
JGI26339J46600_1006795023300003218Bog Forest SoilETDARVTAAHEDGRLVVTVTGADPGRVRDAIAGFALTVRSGPPPATQTTKE*
JGI26339J46600_1011569223300003218Bog Forest SoilAHEDGRLVVTVTGADPGRVRDAVAGFALTVRCGPPPAPQTTSK*
JGI25404J52841_1003106523300003659Tabebuia Heterophylla RhizosphereYEDGRLVLTVTGAEPGQVRDAIAGYALTVRPGPSPAPRPA*
Ga0062591_10161028223300004643SoilAAAHEDGRLVLTVTGADPGRVREAVAGFALTVRCGPATAPQTAVNDPQKGPRP*
Ga0072329_137100813300004977Peatlands SoilEDGRLVLTVTGADPDRVQDAVAGFALTVRSGPSPTPQSTSK*
Ga0066815_1001207123300005164SoilDGRLVLTVTGADPDPVRDAVAGFALTIRCGPSPAAQTTAN*
Ga0070658_1069534423300005327Corn RhizosphereGRLVLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN*
Ga0070659_10083706913300005366Corn RhizosphereTAAHEDGRLVLIVTGADPGRIREAVAGFAVTVRSGPSPAAQTTAN*
Ga0070714_10126085213300005435Agricultural SoilTAAHENGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQISVNDPQKGPRP*
Ga0070714_10203811913300005435Agricultural SoilQVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTIRCGPATAPQTAVK*
Ga0070713_10156172723300005436Corn, Switchgrass And Miscanthus RhizosphereAAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTANWPAEKGTRP*
Ga0068867_10113220513300005459Miscanthus RhizosphereADARVTAAHEDGRMVLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN*
Ga0070733_1062625023300005541Surface SoilDAGTSAAHEDGRLIVTVTGADPGRVRDAVAGFALTIRVETPTHQTAEH*
Ga0070695_10024634113300005545Corn, Switchgrass And Miscanthus RhizosphereGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK*
Ga0068856_10168513123300005614Corn RhizosphereGRLVLTVTGADPDRVRDAVAGFALTIRCGPATAPQTAVK*
Ga0068856_10194659023300005614Corn RhizosphereHEDGRLVVTVTGAGPGRVRNAVAGFALTVRCGPSPAEQTTTN*
Ga0068851_1066072823300005834Corn RhizosphereAAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN*
Ga0070717_1013376233300006028Corn, Switchgrass And Miscanthus RhizosphereGRLIVTVTGADPGRVRDAVAGFALTVRSGPPPAAQTTAN*
Ga0070717_1049398223300006028Corn, Switchgrass And Miscanthus RhizosphereDGRLVVTVTGADPDRVQDAVAGFALTVRSGPSPIPQTTE*
Ga0070717_1113846123300006028Corn, Switchgrass And Miscanthus RhizosphereDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPRSP*
Ga0075019_1104845723300006086WatershedsDARVTAAHEDGRLVVTVTGADPDRVQDAVAGFALTVRSGPSPTPQSTSK*
Ga0075015_10055900923300006102WatershedsAAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK*
Ga0075015_10093436213300006102WatershedsHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPAN*
Ga0070715_1066145123300006163Corn, Switchgrass And Miscanthus RhizosphereTVTGADPGRVRDAVAGFALTVRSGPSPAAQTAAN*
Ga0070716_10081339523300006173Corn, Switchgrass And Miscanthus RhizosphereVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTIRSGPSPAEQTTNK*
Ga0070716_10083395813300006173Corn, Switchgrass And Miscanthus RhizosphereEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK*
Ga0097621_10034574113300006237Miscanthus RhizosphereVLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN*
Ga0075021_1078828713300006354WatershedsAHEDGRLVLTVTGADPDRVRDAVAGFALTVRAGPSPATQTT*
Ga0079222_1076420413300006755Agricultural SoilQVTAAHDDGRLVLTVNGADPDRVHDAVAGVALTVPCGPATAPQTAVK*
Ga0079222_1250656023300006755Agricultural SoilAHRDGRLVVTVAGADPGQVRDAITGFALAVTTVPWPDPAGEA*
Ga0079221_1070940523300006804Agricultural SoilTAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPRSP*
Ga0073928_1010570413300006893Iron-Sulfur Acid SpringLTVTGADPDRVRDAVAGFALTVRCRPATAPQTTVT*
Ga0116221_108940623300009523Peatlands SoilAAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK*
Ga0116220_1007357713300009525Peatlands SoilTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK*
Ga0105238_1303774413300009551Corn RhizosphereLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN*
Ga0116105_105348723300009624PeatlandTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTPN*
Ga0116224_1017926313300009683Peatlands SoilVVTVTGADPGRVRDAVAGFALTVRSGPSPAPATAAN*
Ga0116224_1043353913300009683Peatlands SoilTAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK*
Ga0116224_1051983313300009683Peatlands SoilTAAHEDGRLVVTVTGTDPGRVREAVAGFALTIRTGPSPAAQTAAN*
Ga0116216_1003761443300009698Peatlands SoilARATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN*
Ga0116216_1023317423300009698Peatlands SoilGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPTAQTTSK*
Ga0116216_1065657613300009698Peatlands SoilAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQITNK*
Ga0116217_1027247813300009700Peatlands SoilHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAEQTTNK*
Ga0116219_1046674413300009824Peatlands SoilAYEDGRLVLTVTGADSSQVRAALAGFALAVRCGPATAPRSP*
Ga0116223_1028521823300009839Peatlands SoilVTVTGADPGRVRDAVAGFALTIRTGPSPAAQTAAN*
Ga0126373_1053055713300010048Tropical Forest SoilHEDGRLVVTVTGADPGLVRDAVAGFALTVRCGPSPAPQTAAQ*
Ga0074045_1044281223300010341Bog Forest SoilVTAAHEDGRLVVTVTGADPDRVQDAVAGFALTVRSAPPPAPQSTKK*
Ga0136449_10198839913300010379Peatlands SoilEHGRLVVTVTGADPGRVRDAVAGFALTVRCGPSPAAQTTSK*
Ga0136449_10236041123300010379Peatlands SoilVTAAHEDGRLVVTVTGADPGRVRDAVAGFALTVRTGPSPAPQSAVN*
Ga0136449_10273988023300010379Peatlands SoilGLPAARAAATHEDGRLVLTVTGADPGRVRDAVAGFALTVRCGPSPCPQTSPK*
Ga0126361_1058287513300010876Boreal Forest SoilRLVLTVTGADPDRVRDAVAGFALTVRSGPSPAAQTTAN*
Ga0138562_118335913300011084Peatlands SoilEDGRLVVTVTGADPGRVREAVAGFALTVRCGPSPAAQTTSK*
Ga0137370_1103867213300012285Vadose Zone SoilQVTAAHENGRLVLTVTVADPGRVRDAVAGFALTVRSGPSPAAQTTAN*
Ga0163162_1188659023300013306Switchgrass RhizosphereVLTVPGADPGRVRDAVAGFALTVLSWPSTAAQTTAN*
Ga0181535_1038478713300014199BogTVTGADPGRVRDAVAGFTLTVRSGPSPAAQTTNK*
Ga0132255_10574152713300015374Arabidopsis RhizosphereTVTGADPGRIRDAVAGFALTVRSGPPPVPRTTNK*
Ga0182040_1064886823300016387SoilAGAAAANEDGRLVLTVTGADPGHVRDAVAGYALTVRPGPSPAPRPA
Ga0187818_1002733213300017823Freshwater SedimentVVTVTGADPGRVRDTVAGFALTIRCGPSPAPEDHREVTRRK
Ga0187807_107960913300017926Freshwater SedimentLPDAQATAAHEDGRLVVTVTGTDPGRVREAVAGFALTIRTGPSPAAQTAAN
Ga0187806_137253513300017928Freshwater SedimentAIAAHEDGRLVVTVTGADPGQVRDALAGFALIVRSAPPPAGRTAAD
Ga0187879_1065100613300017946PeatlandITVTGADPGRVRDAVAGFTLTVRSGPSPAAQTTNK
Ga0187817_1092444223300017955Freshwater SedimentLVLTVTGADPGRVRDAVAGFALTVRCGPAPAPENAVK
Ga0187815_1049168323300018001Freshwater SedimentVTVTGADPGQVRDALAGFALIVRSAPPPAGRTAAD
Ga0187887_1016698423300018043PeatlandATAAHESGRLVITVTGADPDRVQDAVAGFALTVRSGPSPAEQTTNK
Ga0193730_107339113300020002SoilGRLVVTVTGADPGQVRDSVAGFALTVRSGPSPAEQTTNK
Ga0210403_1099969623300020580SoilATAAHEDGRLVLTVTGADPGRARDAVAGFALTIRSGPSPVAQTTAN
Ga0213881_1001157413300021374Exposed RockDARVTAAHEDGRLAVTVTGADPGRVRNAVAGFALTVRCGPSPAPQTIVK
Ga0213874_1015395113300021377Plant RootsVVTVTGADPGRVRDAAAGFALTVRAEPAPAAQTAAT
Ga0210392_1035278823300021475SoilATAAHEDGRLVVTVTGADPSRVRDAVAGFALTVRCGPSSAAQTAAN
Ga0126371_1166120423300021560Tropical Forest SoilARAAAAYEDGRLVLTVTGADPDRVRDAVAGYALTVRPGPSPAPRPA
Ga0207684_1041003423300025910Corn, Switchgrass And Miscanthus RhizosphereRLVVTVTGADPDRVRDAVAGFALTVRCGPSPSPQTAAK
Ga0207687_1028667813300025927Miscanthus RhizosphereGTQVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK
Ga0207665_1119100933300025939Corn, Switchgrass And Miscanthus RhizosphereAGTVTADQEDGRLVVTVTGMDPELVREAVAGFALAVRVAP
Ga0207658_1039548923300025986Switchgrass RhizosphereEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN
Ga0207698_1019009523300026142Corn RhizosphereRVTAAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTANWPAEKGTRP
Ga0207722_102484423300027003Tropical Forest SoilARAAAAHEDGRLVVTVTGADPGQARDAVAGFALTIRTGPSPAPQTTAT
Ga0207776_102829113300027035Tropical Forest SoilAHEDGRLVVTVTGADPGQAREAVAGFALTIRTGPSPASQTTAT
Ga0207855_102341413300027039Tropical Forest SoilRATAAHEDGRLVVTVTGADPGQARDALAGFAITVRSEPSSAPQTAAN
Ga0208199_101237223300027497Peatlands SoilGVADARVTAAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK
Ga0208324_100305963300027604Peatlands SoilEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN
Ga0209178_117648023300027725Agricultural SoilALTVTGADPGRVRDAVAGFALTVRSEPSPAAQTTAN
Ga0209328_1012990523300027727Forest SoilTAAHEDGRLVVTVTGTDHGRVRDAVAGFALTVRSGPPPAPQTTPK
Ga0209274_1045889323300027853SoilVADARVTAAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAEQTTNK
Ga0209517_1001954383300027854Peatlands SoilAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK
Ga0209517_1038601723300027854Peatlands SoilLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK
Ga0209167_1048121823300027867Surface SoilEDGRLIVTVTGADPGRVRDAVAGFALTIRVETPTHQTAEH
Ga0268265_1212157313300028380Switchgrass RhizosphereDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTAN
Ga0268264_1088170123300028381Switchgrass RhizosphereQVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK
Ga0307280_1002261913300028768SoilENGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK
Ga0310037_1020489413300030494Peatlands SoilGLPDARADAAYEHGRLVVTVTGADPGRVRDAVAGFALTVRSRPSPAPAN
Ga0310037_1032494213300030494Peatlands SoilRATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN
Ga0310038_1022367523300030707Peatlands SoilEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTAK
Ga0302320_1041224913300031524BogAHEHGRLVITVTGADPDRVQDAVAGFALTVRSGPSPAEQTTNK
Ga0318573_1029215113300031564SoilLVRGGAGAAAAYEDGRLVLTVTGADPGHVRDAVAGYALTVRPGPSPAPRPA
Ga0318573_1078499213300031564SoilPAAAHQDGRLIVTVTGADPGRVREAVAGFALTIRTGPSPAAQTAAN
Ga0310915_1012349523300031573SoilARATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ
Ga0318542_1069917713300031668SoilAAHEDGRLVVTVTGADPGRVREAVAGFALTIRTGPSPAQTTAN
Ga0310686_10435702723300031708SoilSAAHEDGRLIVTVTGADPGRVRDAVAGFALTIRTGPSPAAPAAAN
Ga0310813_1054899023300031716SoilRLVLTVTGADPGRVRDAVAGFALTVRSGPSPATQTTAN
Ga0318501_1020234323300031736SoilRATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ
Ga0318554_1025347123300031765SoilAAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK
Ga0318526_1034867413300031769SoilVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ
Ga0318499_1043593823300031832SoilAVTAAHEDGRLVVTVTGADLDRVQDAVNGFALTVRCGPLPAPQTAAN
Ga0318551_1031246723300031896SoilATAAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPQTTAK
Ga0318520_1039200913300031897SoilGLTDAQATAAHEDGRLVVTVTGADPGRVREAVAGFALTIRTGPSPAQTTAN
Ga0311367_1126110513300031918FenQVIAAHEDGRLVLTVTGADLGRVRDAVAGFALTVRCGPATAPGSP
Ga0306926_1164392913300031954SoilARATAAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK
Ga0318562_1036427423300032008SoilDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK
Ga0306924_1218089013300032076SoilTAAHEDGRLVVTVTGADPGRVRDAVAGFALAIRIGPSPAPQTTAT
Ga0311301_1004129293300032160Peatlands SoilARATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN
Ga0311301_1031484613300032160Peatlands SoilIAAYEDGRLVLTVTGADSSQVRAALAGFALAVRCGPATAPRSP
Ga0311301_1247721823300032160Peatlands SoilAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK
Ga0335085_1035125523300032770SoilTAEHEDGQLVVTVAGADPARIRDAVTGFALTVRCGPSPAPQTAAQ
Ga0335078_1242267623300032805SoilGLADARVTAAYEDGRLVVTVTGADPGRVQDAVAGFALTVRSGPPPAVQTTSN
Ga0335080_1036365613300032828SoilEDGRLVVTVTGADPGRVRDAVAGFTLFTLTVRSGALPAAQTTSK
Ga0335080_1108162123300032828SoilPDARATAAHENGQLVITVTGADPGRVRDAVAGFTLTVRCGPPPAEQTTNK
Ga0335081_1049499123300032892SoilDGRLVLTVTGADPDRVRDALAGFALTVRCGPATAPENAVR
Ga0335083_1076598413300032954SoilLADPQVTAAHEDGRLVVAVTGADPGRVRDAVAGFALTVRCGPATAPENAVK
Ga0335077_1198284923300033158SoilLVLTVTGADPGRARDAVAGFALTIRSGSSPAAQTTAN
Ga0310914_1063372913300033289SoilGLPDARATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.