| Basic Information | |
|---|---|
| Family ID | F071612 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKHYPLREFVTHRFGLRDVGAAMQKSMEAESMKVVLEPWR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.64 % |
| % of genes near scaffold ends (potentially truncated) | 95.08 % |
| % of genes from short scaffolds (< 2000 bps) | 86.07 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.180 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.328 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.738 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 19.12% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01261 | AP_endonuc_2 | 48.36 |
| PF13520 | AA_permease_2 | 6.56 |
| PF01408 | GFO_IDH_MocA | 4.10 |
| PF02894 | GFO_IDH_MocA_C | 2.46 |
| PF02776 | TPP_enzyme_N | 1.64 |
| PF00923 | TAL_FSA | 1.64 |
| PF02775 | TPP_enzyme_C | 1.64 |
| PF08240 | ADH_N | 0.82 |
| PF00204 | DNA_gyraseB | 0.82 |
| PF00107 | ADH_zinc_N | 0.82 |
| PF11645 | PDDEXK_5 | 0.82 |
| PF01041 | DegT_DnrJ_EryC1 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 2.46 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 1.64 |
| COG0187 | DNA gyrase/topoisomerase IV, subunit B | Replication, recombination and repair [L] | 0.82 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.82 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.82 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.82 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.82 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.18 % |
| Unclassified | root | N/A | 0.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000734|JGI12535J11911_1014140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300001593|JGI12635J15846_10343706 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300001593|JGI12635J15846_10655642 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300001867|JGI12627J18819_10257281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100816398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300004080|Ga0062385_10787948 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300004082|Ga0062384_100274297 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300005167|Ga0066672_10460765 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005435|Ga0070714_102347315 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005437|Ga0070710_11012264 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005439|Ga0070711_100862974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300005542|Ga0070732_10136057 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005542|Ga0070732_10359385 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005921|Ga0070766_10131593 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300005921|Ga0070766_10822503 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005944|Ga0066788_10139317 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006086|Ga0075019_10366275 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300006102|Ga0075015_100778428 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006162|Ga0075030_100598105 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300006172|Ga0075018_10038346 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300006354|Ga0075021_10401077 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009038|Ga0099829_10330647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300009641|Ga0116120_1193946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300009709|Ga0116227_10515507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300009792|Ga0126374_10673944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300010048|Ga0126373_11242649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300010048|Ga0126373_11797116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300010048|Ga0126373_12738038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300010358|Ga0126370_11731097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300010359|Ga0126376_10389204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300010376|Ga0126381_102214091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300010868|Ga0124844_1121425 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300011270|Ga0137391_10157372 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300012929|Ga0137404_11737934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300014164|Ga0181532_10043910 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300014165|Ga0181523_10034155 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
| 3300016294|Ga0182041_10068167 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300016319|Ga0182033_12149027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300016357|Ga0182032_11291879 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300016387|Ga0182040_10134780 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300016404|Ga0182037_12158099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300016422|Ga0182039_11924238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300017823|Ga0187818_10292931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300017934|Ga0187803_10310977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300017943|Ga0187819_10389083 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300018023|Ga0187889_10492239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300018038|Ga0187855_10940515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300018085|Ga0187772_11048205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300018086|Ga0187769_10102980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2052 | Open in IMG/M |
| 3300018090|Ga0187770_10278314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300018468|Ga0066662_11733625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300020581|Ga0210399_10183240 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300021088|Ga0210404_10529338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021170|Ga0210400_11671902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300021171|Ga0210405_11000322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300021171|Ga0210405_11266882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300021401|Ga0210393_10072698 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
| 3300021406|Ga0210386_10623391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300021406|Ga0210386_10742269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300021407|Ga0210383_10021503 | All Organisms → cellular organisms → Bacteria | 5429 | Open in IMG/M |
| 3300021407|Ga0210383_11023394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300021432|Ga0210384_10155878 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300021433|Ga0210391_10509336 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300021474|Ga0210390_11266083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021479|Ga0210410_11254346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300021560|Ga0126371_10543397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300022515|Ga0224546_1014430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300024179|Ga0247695_1003818 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300025500|Ga0208686_1070343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300025898|Ga0207692_10061932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1941 | Open in IMG/M |
| 3300025916|Ga0207663_11695841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026551|Ga0209648_10424481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300026881|Ga0207739_1009121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300026988|Ga0207834_1029620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027034|Ga0209730_1021016 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027605|Ga0209329_1074094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300027629|Ga0209422_1115477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300027701|Ga0209447_10092239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300027768|Ga0209772_10058327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300027842|Ga0209580_10376258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300027853|Ga0209274_10077956 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300027854|Ga0209517_10183352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
| 3300027869|Ga0209579_10384493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300027889|Ga0209380_10242546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300027894|Ga0209068_10425710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300027898|Ga0209067_10230242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300027903|Ga0209488_10204092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300028762|Ga0302202_10164565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300029915|Ga0311358_10154553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2184 | Open in IMG/M |
| 3300029999|Ga0311339_11402758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300030049|Ga0302191_10043472 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300030507|Ga0302192_10003104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10405 | Open in IMG/M |
| 3300030841|Ga0075384_11055988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031545|Ga0318541_10247609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300031708|Ga0310686_108581445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300031708|Ga0310686_118102996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300031718|Ga0307474_10166812 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300031718|Ga0307474_10532993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300031718|Ga0307474_11140968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300031720|Ga0307469_10040531 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
| 3300031754|Ga0307475_10519395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300031777|Ga0318543_10375053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300031792|Ga0318529_10121088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300031794|Ga0318503_10146830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300031795|Ga0318557_10033711 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300031820|Ga0307473_10276994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300031910|Ga0306923_10108092 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300031947|Ga0310909_11075221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031954|Ga0306926_11238744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300031962|Ga0307479_10260189 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300031962|Ga0307479_12181416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300032035|Ga0310911_10031674 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300032035|Ga0310911_10036544 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300032035|Ga0310911_10485239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300032063|Ga0318504_10650936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032067|Ga0318524_10747143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032076|Ga0306924_11626206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300032174|Ga0307470_11806840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032954|Ga0335083_10219546 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300033158|Ga0335077_10263602 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300033289|Ga0310914_10584776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300034163|Ga0370515_0013624 | Not Available | 3812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026881 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 15 (SPAdes) | Environmental | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12535J11911_10141402 | 3300000734 | Tropical Forest Soil | LGEFVTHRYALRDVNVAMERAIAPESLKVVLEPWR* |
| JGI12635J15846_103437061 | 3300001593 | Forest Soil | GEFVTHRFGLRQVEAAMRKSMDADSMKVVIDPWS* |
| JGI12635J15846_106556421 | 3300001593 | Forest Soil | PLQEFITHKFGLRDVDAAVQKSIDADSMKVVLDPWDV* |
| JGI12627J18819_102572811 | 3300001867 | Forest Soil | YGPGMRQMVRYMKHYPLREFVSHRFGLRDVHAAMQKSMDGDSMKVVLEPWQ* |
| JGIcombinedJ26739_1008163981 | 3300002245 | Forest Soil | RYMKHYPLGEFVTHRFGLRDVESAMQKSIEAESMKVVLEPWQ* |
| Ga0062385_107879481 | 3300004080 | Bog Forest Soil | ARYMKNYPLQEFVTHRFALRDVHAAMQKSIEAESMKVVLEPWQ* |
| Ga0062384_1002742971 | 3300004082 | Bog Forest Soil | YMKHYPLRDFVTHRFPLRGVEAAMEKSIALDSMKVIMEPWT* |
| Ga0066672_104607651 | 3300005167 | Soil | MVRHMKNYPLQEFVTHRFRLQDVEQAMQKSMAADSMKVVLEPWT* |
| Ga0070714_1023473152 | 3300005435 | Agricultural Soil | ARVLSVGGEEPAAYGPGMRQMVRYMKHYPLREFVTHRFGLRAVHAAMQKSMDGDSMKVVLEPWQ* |
| Ga0070710_110122642 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | SVGGEEPAAYGPGMRQMVRYMKHYPLREFVTHRFSLRDVHAAMQKSMDGDSMKVVLEPWQ |
| Ga0070711_1008629741 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EPAAYGPGMRQMVRYMKHYPLREFVTHRFRLRDVHAAMQKSMDGDAMKVVLEPWQ* |
| Ga0070732_101360573 | 3300005542 | Surface Soil | MRQMARYMKHYPLREFVTHRFGLRDVGAAMQKSMEAESMKVVLEPWR* |
| Ga0070732_103593852 | 3300005542 | Surface Soil | AAAYAPSMRQMVRYMRHYPLAEFVTHRFALREVEAAMKQSIARDSMKGVIDPWRN* |
| Ga0070766_101315931 | 3300005921 | Soil | RYMKHYPLREFVSHRFGLRDVHAAMQKSMDGDSIKVVLEPWQ* |
| Ga0070766_108225032 | 3300005921 | Soil | MRQMARYMKKYPLQEFVTHRFGLRDVEAAMQKSIEPGSMKVVLQPWQ* |
| Ga0066788_101393171 | 3300005944 | Soil | RQMARYQKHYPLREFVSHRYRLQDVDAAVHKAIETESIKVVLEPWR* |
| Ga0075019_103662752 | 3300006086 | Watersheds | YMQHYPLGEFVTHRFGLRDVEAAMKKSMAADSMKVVINPWS* |
| Ga0075015_1007784282 | 3300006102 | Watersheds | HYPLREFVTHRFGLRDVEKAMQKSMAADSMKVVLDPWS* |
| Ga0075030_1005981052 | 3300006162 | Watersheds | GPSMRQMARYMRHYPLKEFVTHRFGLRDVDKAMQKSMAADSMKVVLDPWS* |
| Ga0075018_100383461 | 3300006172 | Watersheds | MKQYPLREFVTHRYKLSDVEAAVKKSVEAESMKVVLEPWA* |
| Ga0075021_104010772 | 3300006354 | Watersheds | ARYMKQYPLREFVTHRYKLSDVEAAVKKSVEAESMKVVLEPWG* |
| Ga0099829_103306471 | 3300009038 | Vadose Zone Soil | HYPLGQFVTHRFGLPQVEAAVKKSMAADSMKVVINPWS* |
| Ga0116120_11939461 | 3300009641 | Peatland | AYGPGMRQMARYMKHYPLQELVTHRFALREVEAAMQKSIAADSMKVVLQAWQ* |
| Ga0116227_105155072 | 3300009709 | Host-Associated | QMARYMKHYPLAEFVTHRFSLKDVDLAMAKAMAPDSMKVVIQPWA* |
| Ga0126374_106739442 | 3300009792 | Tropical Forest Soil | YPLREFVTHRYGLRDVNAAMQTAIAPESLKVVLEPWP* |
| Ga0126373_112426492 | 3300010048 | Tropical Forest Soil | YGPGMRQMLRYMKHYPLREFVTHRFGLRDVNAAMQKSMDGDSMKVVLEPWQ* |
| Ga0126373_117971162 | 3300010048 | Tropical Forest Soil | MRQMARYMRHYPLQEFVTHRFGLCHVEAAMKQSMAADSMKVVIDPWS* |
| Ga0126373_127380381 | 3300010048 | Tropical Forest Soil | RYMKHYPLREFVTHRFGLRDVHAAMQKSMEVDSMKVVLEPWH* |
| Ga0126370_117310971 | 3300010358 | Tropical Forest Soil | PLREFVTHRYGLRDVNAAMQTAIAPESLKVVLEPWR* |
| Ga0126376_103892041 | 3300010359 | Tropical Forest Soil | QYPLREFVTHRFALRDVNAAMEKSMALDSLKVVIEPWA* |
| Ga0126381_1022140911 | 3300010376 | Tropical Forest Soil | PSMRQMDRYMKNYPLREFVTHRYGLRDVNTAMKTAIAPDSMKVVLEPWR* |
| Ga0124844_11214252 | 3300010868 | Tropical Forest Soil | MKQYPLREFVTHRFALRDVNAAMEKSMALDSLKVVIEPWA* |
| Ga0137391_101573722 | 3300011270 | Vadose Zone Soil | MKQYPLREFVTHRYGLRDVDAAMAKAIEAESMKVVMEPWR* |
| Ga0137404_117379342 | 3300012929 | Vadose Zone Soil | GEFVTHKYALRDVDAAMAKAIEAESMKVVMEPWR* |
| Ga0181532_100439101 | 3300014164 | Bog | AAYGPGMRQMARYLKHYPLQEFVTHRFGLRDVDAAVKKSIDPESMKVVLDPWR* |
| Ga0181523_100341554 | 3300014165 | Bog | GMRQMARYLKHYPLQEFVTHRFGLRDVDAAVKKSIDMESMKVVLDPWR* |
| Ga0182041_100681671 | 3300016294 | Soil | MKHYPLKEFVTHRFGLRDVHAAMQKSMDVDSMKVVLEPWH |
| Ga0182033_121490271 | 3300016319 | Soil | ARYMKHYPLREFVTHRYALREVNVAMERAIAPESLKVVLEPWR |
| Ga0182032_112918792 | 3300016357 | Soil | YPLREFVTHRFGLREVHVAMQKAIAPDSMKVVFEPWK |
| Ga0182040_101347803 | 3300016387 | Soil | IHEALSAAEFVTHRFGLRDVNAAMQKSMDGDSMKVVLEPWQ |
| Ga0182037_121580991 | 3300016404 | Soil | QMARYMKHYPLREFVTHRFPLREVNTAMRKAIEPDSMKVVFEPWR |
| Ga0182039_119242382 | 3300016422 | Soil | AAYGPGMRQMARYLKQHPLEEFVTHRFGLRDVEAAVKKAIEPKSMKVVLELWR |
| Ga0187818_102929311 | 3300017823 | Freshwater Sediment | YPLGDFVTHRFPLRDVESAVKKSIEAESMKVVLEPWR |
| Ga0187803_103109771 | 3300017934 | Freshwater Sediment | RYMKHYPLREFVTHRFKLRDVDAAMQKSTQLDSMKVVLEPWQ |
| Ga0187819_103890831 | 3300017943 | Freshwater Sediment | PSMRQMARYMKHYPLREFDTHRFPLRDVETAVKKSIEPESMKVVLEPWR |
| Ga0187889_104922391 | 3300018023 | Peatland | MKHYPLQELVTHRFALREVEAAMQKSIAADSMKVVLQAWQ |
| Ga0187855_109405151 | 3300018038 | Peatland | KNYPLREFVTHRFGLPDVRAAMQKSIEPESMKVVLEPWR |
| Ga0187772_110482052 | 3300018085 | Tropical Peatland | MARYTKHYPLKEFVTHRFSLRQVDDAMKQAIAPDSVKVVLDPWI |
| Ga0187769_101029803 | 3300018086 | Tropical Peatland | RQMARYMRHYPLSEFVTHRFGLKQVEQAMQQATAFESMKVVIDPWS |
| Ga0187770_102783141 | 3300018090 | Tropical Peatland | LGVSGEEPAAYGPGMRQMARYMKHYPLHEFVTHRFPLRDVEAAVKKSMEAESMKVALEPW |
| Ga0066662_117336252 | 3300018468 | Grasslands Soil | AKQYPLGQFVTHRFGLRQVDDAMKKSMAADSMKVVIDPWS |
| Ga0210399_101832401 | 3300020581 | Soil | ILGVGGEEPAAYGPGMRQMARYMKNYPLQEFVTHRYGLRDVAAAMKKSVEADSMKVVLEPWQ |
| Ga0210404_105293382 | 3300021088 | Soil | LKHYPLQEFVSHRYGLRDVEAAMQKSIDGKSMKVVLDPWN |
| Ga0210400_116719021 | 3300021170 | Soil | QMARYLKHYPLREFVTHRYGLRDVDAAMAKAIDAESMKVVLEPWR |
| Ga0210405_110003221 | 3300021171 | Soil | MRQMARYMKNYPLQEFVTHRYGLRDVDVAMKKSVEAESMKVVLEPWR |
| Ga0210405_112668821 | 3300021171 | Soil | RQMARYMKHYPLRDFVTHRFPLRGVEAAMEKSIALDSMKVIMEPWT |
| Ga0210393_100726984 | 3300021401 | Soil | SMRQMARYMKNYPLREFVTHRFGLREVNAAMQKSVEPESMKVVMEPWR |
| Ga0210386_106233912 | 3300021406 | Soil | YMNHYPLREFVTHRFGLREVDAAVKQAIEPHSMKVVLEPWR |
| Ga0210386_107422692 | 3300021406 | Soil | MTRYMKHYPLREFVTHRFGLRDVHAAMQKSMQGDSMKVVLEPWQ |
| Ga0210383_100215031 | 3300021407 | Soil | QHYPLGDFVTHHFGLRDVDVAVKKSIEPDSMKVVIDPWAV |
| Ga0210383_110233942 | 3300021407 | Soil | ARILGVGGEEPAAYAPSMRQMARYMKHYPLRDFVTHRFPLRGVEAAMEKSIALDSMKVIMEPWT |
| Ga0210384_101558781 | 3300021432 | Soil | LHEFVTHRFGLREVEAAMKKSMAADSMKVVIDPWS |
| Ga0210391_105093362 | 3300021433 | Soil | AQHYPLQDFVTHRFGLRQVDEAVKKSVEADSMKVVIDPWTV |
| Ga0210390_112660832 | 3300021474 | Soil | QMTRYMKHYPLREFVTHRFGLRDVHAAMQKSMQGDSMKVVLEPWQ |
| Ga0210410_112543461 | 3300021479 | Soil | PAAYGPGMRQMARYQKQYPLGEFVSHRYKLRDVHAAVQKSIESGSMKVVLEPWS |
| Ga0126371_105433973 | 3300021560 | Tropical Forest Soil | QMARYLKRYPLREFVTHRYGLRDVSVAMHQAIQPDSMKVVFEPWRNL |
| Ga0224546_10144302 | 3300022515 | Soil | RQMLRYMKTYPLREFVSHKFGLRDVQAAMNKSMDAESMKVVMEPWQ |
| Ga0247695_10038181 | 3300024179 | Soil | PLREFVTHKYALRDVHAAMAKAIEPESMKVVMEPWR |
| Ga0208686_10703431 | 3300025500 | Peatland | YPLQELVTHRFALREVEAAMQKSIAADSMKVVLQAWQ |
| Ga0207692_100619323 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYGPGMRQMLRYMRHYPLSDFVTHRFALRDVNAAMQKSMAFDSMKVVIQPWT |
| Ga0207663_116958412 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QMLRYMKHYPLREFVTHRFGLRDVHAAMQKSMDGDSMKVVLEPWQ |
| Ga0209648_104244812 | 3300026551 | Grasslands Soil | LHEFVTHRFPLKDVEHAMQKSMASDSMKVVLVPWDS |
| Ga0207739_10091212 | 3300026881 | Tropical Forest Soil | YPLGEFVTHRYALRDVNVAMERAIAPESLKVVLEPWR |
| Ga0207834_10296201 | 3300026988 | Tropical Forest Soil | ARYLKHYPLREFVTHRFALRDVAAAVQKSLDADSLKVVMEPWR |
| Ga0209730_10210161 | 3300027034 | Forest Soil | EEPAAYGPGMRQMVRYMKHYPLREFVTHRFSLRDVHAAMQKSMEADSMKVVLEPWQ |
| Ga0209329_10740942 | 3300027605 | Forest Soil | YPLREFVTHRFGLKQVEEAMKKSMAADSMKVVIDPWS |
| Ga0209422_11154772 | 3300027629 | Forest Soil | RHYPLQEFITHKFGLRDVDAAVQKSIDADSMKVVLDPWDV |
| Ga0209447_100922392 | 3300027701 | Bog Forest Soil | MQHYPLREFVTHRFGLRDVHAAVQKSIEPESMKVVLEPWR |
| Ga0209772_100583272 | 3300027768 | Bog Forest Soil | QMARYMKNYPLQEFVTHRYGLRDVEVAMKKSIEADSMKVVLEPWQ |
| Ga0209580_103762582 | 3300027842 | Surface Soil | KHYPLREFVTHRFGLRDVGAAMQKSMEAESMKVVLEPWR |
| Ga0209274_100779561 | 3300027853 | Soil | GEEPAAYGPGMRQMARYMQHYPLQEFVTHRYGLRDVEAAMQKSMQADSMKVVLQPWQ |
| Ga0209517_101833523 | 3300027854 | Peatlands Soil | PLHEFVTHRFGLRDVEAAMQKSMAADSMKVVIDPWS |
| Ga0209579_103844932 | 3300027869 | Surface Soil | MVRYMKSYPLREFVSHKFGLRDVQAAMNKSMDAESM |
| Ga0209380_102425461 | 3300027889 | Soil | RYMKHYPLREFVSHRFGLRDVHAAMQKSMDGDSIKVVLEPWQ |
| Ga0209068_104257102 | 3300027894 | Watersheds | GPSMRQMARYMKQYPLREFVTHRYKLSDVEAAVKKSVEAESMKVVLEPWA |
| Ga0209067_102302421 | 3300027898 | Watersheds | YMQHYPLGEFVTHRFGLRDVEAAMKKSMAADSMKVVINPWS |
| Ga0209488_102040923 | 3300027903 | Vadose Zone Soil | MRQMARFMRHYPLHEFVTHRFPLKDVEHAMQKSMASDSMKVVLVPWDC |
| Ga0302202_101645653 | 3300028762 | Bog | MARYMKHYPLQEFVTHRFGLSDVDEAMQKAMAPDSMKVVLQPWQS |
| Ga0311358_101545534 | 3300029915 | Bog | YPLADFVTHRFALKDVDQAMAQSIAPDSMKVVIQPWA |
| Ga0311339_114027582 | 3300029999 | Palsa | PLREFVTHRFGLRDVTAAMQKSVEAESMKVVLEPWK |
| Ga0302191_100434723 | 3300030049 | Bog | KHYPLQEFVTHRFGLSDVDEAMQKAMAPDSMKVVLQPWQS |
| Ga0302192_100031041 | 3300030507 | Bog | QMARYMKHYPLQEFVTHRFGLSDVDEAMQKAMAPDSMKVVLQPWQS |
| Ga0075384_110559882 | 3300030841 | Soil | KHYPLRAFVTHRYALRDVDAAMAKAIDAESMKVVMEPWR |
| Ga0318541_102476092 | 3300031545 | Soil | MKHYPLREFVTHRYALREVNVAMERAIAPESLKVVLEPWR |
| Ga0310686_1085814452 | 3300031708 | Soil | YMKHYPLREFVTHRFGLRDVNAAMRKSVEVESMKVVMEPWK |
| Ga0310686_1181029962 | 3300031708 | Soil | YMKHYPLQDFVTHRFGLRDVAAAMQKSMAADSMKVVLQPWN |
| Ga0307474_101668121 | 3300031718 | Hardwood Forest Soil | YPLGGFVTHRFGLRDVETAMKKSMAADSMKVVIDPWS |
| Ga0307474_105329932 | 3300031718 | Hardwood Forest Soil | LKHYPLQEFVTHRFALRDVEAAVQKSIEADSLKVAMEPWG |
| Ga0307474_111409682 | 3300031718 | Hardwood Forest Soil | ARYMKHYPLREFVTHRFGLRDVESAMQKSIEAESMKVVLEPWQ |
| Ga0307469_100405314 | 3300031720 | Hardwood Forest Soil | PAAYGPIMRQMARYMKHYPLREFVTHRFGLRDVEAAMQKSVEAESMKVVLEPWR |
| Ga0307475_105193952 | 3300031754 | Hardwood Forest Soil | ARYQKQYPLGEFVSHRYKLRDVGAAVQKAIEPTSMKVVLEPWS |
| Ga0318543_103750531 | 3300031777 | Soil | QMARYMKHYPLREFVTHRYALREVNVAMERAIAPESLKVVLEPWR |
| Ga0318529_101210881 | 3300031792 | Soil | LKHYPLREFVTHRFRLRDVAAAVEKSIEADSLKVVMEPWR |
| Ga0318503_101468302 | 3300031794 | Soil | LKHYPLREFVTHRFRLRDVAAAVQKSIEADSLKVVMEPWS |
| Ga0318557_100337111 | 3300031795 | Soil | YLKHYPLREFVTHRFRLRDVAAAVEKSIEADSLKVVMEPWR |
| Ga0307473_102769941 | 3300031820 | Hardwood Forest Soil | MRQMARYMKHYPLQEFVTHRFGLHDVEQAMQKAMAADSMKVLIDPWA |
| Ga0306923_101080921 | 3300031910 | Soil | PLREFVTHRFRLRDVAAAVEKSIEADSLKVVMEPWR |
| Ga0310909_110752211 | 3300031947 | Soil | KHYPLREFVTHRYGLRDVNAAMQTAIAPESLKVVLEPWR |
| Ga0306926_112387441 | 3300031954 | Soil | MARYLKHYPLGEFVTHRYALREVNVAMERAIAPESLKVVLEPWR |
| Ga0307479_102601893 | 3300031962 | Hardwood Forest Soil | MKHYPLQDFVTHRFGLQNVEAAMQKSMEANSMKVVLQPWQ |
| Ga0307479_121814162 | 3300031962 | Hardwood Forest Soil | MKHYPLREFVTHRFGLRDVGAAMQKSMEAESMKVVLEPWR |
| Ga0310911_100316741 | 3300032035 | Soil | HYPLREFVTHRFGLRDVETAVQKSIEMESMKVVLEPWR |
| Ga0310911_100365441 | 3300032035 | Soil | SMRQMARYMKHYPLGEFVTHRFALREVNVAMEQAIAPESLKVVLEPWR |
| Ga0310911_104852392 | 3300032035 | Soil | KHYPLREFVTHRYALREVNVAMERAIAPESLKVVLEPWR |
| Ga0318504_106509362 | 3300032063 | Soil | YGPGMRQMARYMKHYPLKEFVTHRFGLRDVHAAMQKSMDVDSMKVVLEPWH |
| Ga0318524_107471431 | 3300032067 | Soil | RYMKHYPLGEFVTHRYALREVKVAMERAIAPESLKVVLEPWR |
| Ga0306924_116262062 | 3300032076 | Soil | PLREFVTHQYALRDVDAAMKKAIEPESMKVVLDPWR |
| Ga0307470_118068401 | 3300032174 | Hardwood Forest Soil | PGMRQMVRYMRQYPLREFVTHRFGLRDVHAAMQKSMDGDSMKVVLEPWQ |
| Ga0335083_102195461 | 3300032954 | Soil | YPLQEFVTHRYGIRDVEAAVKKAIEPESMKVVLDPWR |
| Ga0335077_102636021 | 3300033158 | Soil | ARYMKHYPLREFVSHRFALRDVEAAVHKSMDVESMKVVLEPWR |
| Ga0310914_105847762 | 3300033289 | Soil | EPAAYGPGMRQMLRYMKHYPLREFVTHRFGLRDVNAAMQKSMDGDSMKVVLEPWQ |
| Ga0370515_0013624_27_206 | 3300034163 | Untreated Peat Soil | VGGEEPAAYGPGMRQMARYMKHYPLQEFVTHRFGLRDVEAAMQKSVAADSMKVVLQPWQ |
| ⦗Top⦘ |