| Basic Information | |
|---|---|
| Family ID | F071594 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLF |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.18 % |
| % of genes from short scaffolds (< 2000 bps) | 93.44 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.770 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.279 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF11104 | PilM_2 | 90.16 |
| PF12728 | HTH_17 | 6.56 |
| PF01977 | UbiD | 1.64 |
| PF14520 | HHH_5 | 0.82 |
| PF04350 | PilO | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.64 |
| COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 1.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01A5EKN | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300001089|JGI12683J13190_1008127 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1029603 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300002914|JGI25617J43924_10236480 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300003218|JGI26339J46600_10096264 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005332|Ga0066388_101055299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1369 | Open in IMG/M |
| 3300005445|Ga0070708_101056209 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005531|Ga0070738_10193063 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005538|Ga0070731_11165931 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005553|Ga0066695_10188793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1291 | Open in IMG/M |
| 3300005563|Ga0068855_102161365 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005952|Ga0080026_10050967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300006041|Ga0075023_100107488 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300006172|Ga0075018_10796227 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006796|Ga0066665_10189238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
| 3300006954|Ga0079219_11024046 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009521|Ga0116222_1556627 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009683|Ga0116224_10327582 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010046|Ga0126384_12418512 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010320|Ga0134109_10458336 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010339|Ga0074046_10762328 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010361|Ga0126378_10468497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300010379|Ga0136449_101176992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300011074|Ga0138559_1124995 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300011120|Ga0150983_14376866 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300011120|Ga0150983_15857172 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300011269|Ga0137392_11519432 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300011271|Ga0137393_11564971 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012199|Ga0137383_10671104 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012206|Ga0137380_10260868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1560 | Open in IMG/M |
| 3300012362|Ga0137361_10228047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1692 | Open in IMG/M |
| 3300012363|Ga0137390_10838534 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012363|Ga0137390_11629578 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012923|Ga0137359_10061837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3264 | Open in IMG/M |
| 3300012986|Ga0164304_10710201 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300015371|Ga0132258_13366374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300017966|Ga0187776_11416051 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300017975|Ga0187782_10639140 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300017995|Ga0187816_10318378 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300018007|Ga0187805_10016568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3166 | Open in IMG/M |
| 3300018007|Ga0187805_10550008 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018015|Ga0187866_1011525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4987 | Open in IMG/M |
| 3300018085|Ga0187772_10903644 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300018088|Ga0187771_11762335 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018468|Ga0066662_12398302 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300019192|Ga0184603_141289 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300020199|Ga0179592_10511684 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300020579|Ga0210407_10687659 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300020581|Ga0210399_11264601 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021168|Ga0210406_10485242 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300021171|Ga0210405_10181260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1669 | Open in IMG/M |
| 3300021401|Ga0210393_11277774 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021406|Ga0210386_11675255 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021432|Ga0210384_10847814 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300021444|Ga0213878_10265088 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300021474|Ga0210390_10491273 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300021479|Ga0210410_10492535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300022501|Ga0242645_1032046 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300023259|Ga0224551_1082785 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300024290|Ga0247667_1090008 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300025898|Ga0207692_10767151 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300025906|Ga0207699_11397456 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026304|Ga0209240_1162616 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026304|Ga0209240_1294325 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026309|Ga0209055_1058889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1631 | Open in IMG/M |
| 3300026312|Ga0209153_1004175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4539 | Open in IMG/M |
| 3300026323|Ga0209472_1301404 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026343|Ga0209159_1182295 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300026354|Ga0257180_1017571 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300026371|Ga0257179_1029307 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300026374|Ga0257146_1029051 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300026482|Ga0257172_1046384 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300026532|Ga0209160_1002545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15150 | Open in IMG/M |
| 3300026540|Ga0209376_1387230 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026921|Ga0207860_1003580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2325 | Open in IMG/M |
| 3300026928|Ga0207779_1016074 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300027334|Ga0209529_1060162 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300027502|Ga0209622_1062900 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027562|Ga0209735_1126980 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027641|Ga0208827_1088533 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300027651|Ga0209217_1110275 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300027667|Ga0209009_1166536 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027787|Ga0209074_10036259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1439 | Open in IMG/M |
| 3300027795|Ga0209139_10002857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6449 | Open in IMG/M |
| 3300027846|Ga0209180_10315066 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300027846|Ga0209180_10704140 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027862|Ga0209701_10134240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1523 | Open in IMG/M |
| 3300027882|Ga0209590_10254594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300027908|Ga0209006_11120972 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300029636|Ga0222749_10705857 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300030746|Ga0302312_10407961 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031128|Ga0170823_16319271 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031231|Ga0170824_112024317 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031469|Ga0170819_17358419 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300031543|Ga0318516_10374642 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031544|Ga0318534_10494313 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031573|Ga0310915_10979451 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031679|Ga0318561_10129180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1347 | Open in IMG/M |
| 3300031680|Ga0318574_10619837 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031715|Ga0307476_10508200 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031718|Ga0307474_10495248 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300031720|Ga0307469_10204010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1547 | Open in IMG/M |
| 3300031768|Ga0318509_10169163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300031821|Ga0318567_10717012 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031833|Ga0310917_10478556 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031859|Ga0318527_10308281 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031945|Ga0310913_10543682 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300032035|Ga0310911_10283307 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300032063|Ga0318504_10598263 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300032064|Ga0318510_10205602 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032068|Ga0318553_10491055 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300032173|Ga0315268_12705398 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032174|Ga0307470_10576986 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300032180|Ga0307471_103323567 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300032180|Ga0307471_103866629 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032205|Ga0307472_100791414 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032756|Ga0315742_10232805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300032828|Ga0335080_10559151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300032955|Ga0335076_10013555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8206 | Open in IMG/M |
| 3300033405|Ga0326727_10337918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1441 | Open in IMG/M |
| 3300034130|Ga0370494_197922 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300034177|Ga0364932_0069554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1330 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.82% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.82% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_03544280 | 2170459024 | Grass Soil | MIRINLLGQTRPKAARRPADTGAALPVVFIGAGVLLGGLFLFYFY |
| JGI12683J13190_10081271 | 3300001089 | Forest Soil | MIRINLLGQTRPRAGRRTVDTGSALPMIFIAAGLALGLA |
| JGIcombinedJ26865_10296032 | 3300002347 | Arctic Peat Soil | MIRINLLGQTRPKAARRTADTGAALPLVFIAAGLLLGGLVLFY |
| JGI25617J43924_102364802 | 3300002914 | Grasslands Soil | MIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGGLFLF |
| JGI26339J46600_100962641 | 3300003218 | Bog Forest Soil | MIRINLLGQIRPKSARRPVDTGAALPLVFIGAGVLLGGLFL |
| Ga0066388_1010552993 | 3300005332 | Tropical Forest Soil | MIRINLLGQTRPKAARRPVDTGAALPAVFIGAGILLGGLVLG |
| Ga0070708_1010562092 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLALFLFY |
| Ga0070738_101930631 | 3300005531 | Surface Soil | MIRINLLGQMRPKAARRPVDTGAALPIVFVGAGLVLGGLVL |
| Ga0070731_111659311 | 3300005538 | Surface Soil | MIRINLLGQIRPKAARRPVDTGAAMPIMFIGAGVLLAGLI |
| Ga0066695_101887933 | 3300005553 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGALV |
| Ga0068855_1021613652 | 3300005563 | Corn Rhizosphere | MIRINLLGQAKPKASRRQVDTGAALPVLFIAAGLVF |
| Ga0080026_100509672 | 3300005952 | Permafrost Soil | MIRINLLGQAKPKASRRPVDTGAALPVLFVGAGVLFGAL |
| Ga0075023_1001074881 | 3300006041 | Watersheds | MIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLALFLLY |
| Ga0075018_107962271 | 3300006172 | Watersheds | MIRINLLGQLKPKATRRPVDTGAAMPLLFIAAGLIFGCAILF |
| Ga0066665_101892383 | 3300006796 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGAVV |
| Ga0079219_110240462 | 3300006954 | Agricultural Soil | MIRINLLGQQRPKASRRPVDTGAALPVVFVGAGLVL |
| Ga0116222_15566272 | 3300009521 | Peatlands Soil | MIRINLLGQIRPKTARRPVDTGAALPLVFIGAGVLLGG |
| Ga0116224_103275821 | 3300009683 | Peatlands Soil | MIRINLLGQIRPKAARRAVDTGAAMPLVFVGAGLLLGFLFLFY |
| Ga0126384_124185121 | 3300010046 | Tropical Forest Soil | MIRINLLGQTRPKAARRPVDTGAALPAVFIGAGILLGG |
| Ga0134109_104583362 | 3300010320 | Grasslands Soil | MIRINLLGQIRPKASRRQTMAVDTGGAMPVAFIGIGVA |
| Ga0074046_107623282 | 3300010339 | Bog Forest Soil | MIRINLLGQIRPKSSRRPVDTGAALPVLFIGAGLVL |
| Ga0126378_104684973 | 3300010361 | Tropical Forest Soil | MIRINLLGQTRPKAARRPVDTGAALPAVFIGAGIVLGGL |
| Ga0136449_1011769921 | 3300010379 | Peatlands Soil | MIRINLLGQARPKAARRAADTGAALPLVFMLAGVVLGGLFL |
| Ga0138559_11249953 | 3300011074 | Peatlands Soil | MIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLFLFYFH |
| Ga0150983_143768662 | 3300011120 | Forest Soil | MIRINLLGQIKPKSSRRPVDTGAALPVLFIGIGAALGVVVLVFF* |
| Ga0150983_158571721 | 3300011120 | Forest Soil | MIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLA |
| Ga0137392_115194322 | 3300011269 | Vadose Zone Soil | MIRINLLGQIRPKAARRPVDTGAALPGVFIGAGLVLG |
| Ga0137393_115649711 | 3300011271 | Vadose Zone Soil | MIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLG |
| Ga0137383_106711041 | 3300012199 | Vadose Zone Soil | MIRINLLGQQRPKSARRPVDTGAALPAVFVGAGVVLGGLVL |
| Ga0137380_102608681 | 3300012206 | Vadose Zone Soil | MIRINLLGQIRPKAARRPVDTGAAMPVVFIGAGLVLGALV |
| Ga0137361_102280471 | 3300012362 | Vadose Zone Soil | MIRINLLGQTRPKSARRPVDTGAALPAVFIGAGVVLGGLVLG |
| Ga0137390_108385341 | 3300012363 | Vadose Zone Soil | MIRINLLGQAKPKTSRRQVDTGAALPVLFIGAGLVFGCLILGYL |
| Ga0137390_116295782 | 3300012363 | Vadose Zone Soil | MIRINLLGQARPRAARRRGPVDTGAALPLVFVGAGAAL |
| Ga0137359_100618375 | 3300012923 | Vadose Zone Soil | MIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLG |
| Ga0164304_107102011 | 3300012986 | Soil | MIRINLLGQAKPKASRRQVDTGAALPVLFIAAGLVFGCLILGYL |
| Ga0132258_133663742 | 3300015371 | Arabidopsis Rhizosphere | MIRINLLGQTRPKAARRPVDTGAALPAVFIGAGFLLGGLVL |
| Ga0187776_114160511 | 3300017966 | Tropical Peatland | MIRINLLGQTRPKATRRPVDTGAALPLVFIGAGVLLGGLF |
| Ga0187782_106391402 | 3300017975 | Tropical Peatland | MIRINLLGHVRPKVSRRPVDTGAALPVLFIGAGVAVGVIVLG |
| Ga0187816_103183781 | 3300017995 | Freshwater Sediment | MIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLF |
| Ga0187805_100165681 | 3300018007 | Freshwater Sediment | MIRINLLGQVRPKTARRPVDTGAALPVVFIGAGVALG |
| Ga0187805_105500082 | 3300018007 | Freshwater Sediment | MIRINLLGQIRPKASRRPVDTGAALPILFIGAGFV |
| Ga0187866_10115251 | 3300018015 | Peatland | MIRINLLGQMRPKAARRPVDTGAALPLVFIGAGVLLGGLF |
| Ga0187772_109036441 | 3300018085 | Tropical Peatland | MIRINLLGQTRPKATRRPVDTGAALPLVFIGAGVVLGGLFL |
| Ga0187771_117623351 | 3300018088 | Tropical Peatland | MIRINLLGQARPKAARRPVDTGAALPLVFIGAGVLLGGLFLFY |
| Ga0066662_123983021 | 3300018468 | Grasslands Soil | MIRINLLGQTRPRAARRRGPMMDTGAVTPLVFVGAGAA |
| Ga0184603_1412892 | 3300019192 | Soil | MIRINLLGQIRPKASRRPVDTGAALPVLFIGAGLLLGVL |
| Ga0179592_105116841 | 3300020199 | Vadose Zone Soil | MIRINLLGQTRPKAGRRPVDTGAAMPVVFVGVGAALG |
| Ga0210407_106876592 | 3300020579 | Soil | MIRINLLGQAKPKASRRPVDTGAALPALFVGAGVLFGALI |
| Ga0210399_112646012 | 3300020581 | Soil | MIRINLLGQAKPKASRRPVDTGAALPALFVGAGVL |
| Ga0210406_104852422 | 3300021168 | Soil | MIRINLLGQIKPKSSRRPVDTGAALPVLFIGIGAALGVVVLVFF |
| Ga0210405_101812601 | 3300021171 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLALGA |
| Ga0210393_112777741 | 3300021401 | Soil | MIRINLLGQAKPKASRRPVDTGAALPALFIGAGVLFGALILG |
| Ga0210386_116752551 | 3300021406 | Soil | MIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGGLFL |
| Ga0210384_108478141 | 3300021432 | Soil | MIRINLLGQMRPKTSRRPVDTGAAMPVVFVGAGVVLGALLLFY |
| Ga0213878_102650882 | 3300021444 | Bulk Soil | MIRINLLGQARPKAARRPVDTGAAMPLVFIGAGLLFG |
| Ga0210390_104912732 | 3300021474 | Soil | MIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGLLLGCLFL |
| Ga0210410_104925352 | 3300021479 | Soil | MIRINLLGQTRPRAARRPVDTGAALPVVFIGAGAALGILALFL |
| Ga0242645_10320461 | 3300022501 | Soil | MIRINLLGQIRPKASRRPVDTGAALPVLFIGAGLVLGFLVLGFL |
| Ga0224551_10827851 | 3300023259 | Soil | MIRINLLGQAKPKASRRPVDTGAALPVLFVGAGIL |
| Ga0247667_10900082 | 3300024290 | Soil | MIRINLLGQTRPKAARRPVDTGAALPAVFIGAGVLLGGLVLG |
| Ga0207692_107671512 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGG |
| Ga0207699_113974562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRINLLGQVRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGYLY |
| Ga0209240_11626161 | 3300026304 | Grasslands Soil | MIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGYI |
| Ga0209240_12943252 | 3300026304 | Grasslands Soil | MIRINLLGQIRPRAARRPVDTGAAMPAVFIGAGLLLGALVLGFF |
| Ga0209055_10588891 | 3300026309 | Soil | MIRINLLGQIRPKASRRTVSTGDTGGALPTLFIGAGVILGVLVLGF |
| Ga0209153_10041756 | 3300026312 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGALVLGFF |
| Ga0209472_13014041 | 3300026323 | Soil | MIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLGGLML |
| Ga0209159_11822952 | 3300026343 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVL |
| Ga0257180_10175711 | 3300026354 | Soil | MIRINLLGQQRPRSARRPVDTGAALPAVFIGAGVVLGGLVLGYIYF |
| Ga0257179_10293071 | 3300026371 | Soil | MIRINLLGQTRPKTARRPVDTGAALPAVFIGAGVV |
| Ga0257146_10290512 | 3300026374 | Soil | MIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLGG |
| Ga0257172_10463841 | 3300026482 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGA |
| Ga0209160_100254517 | 3300026532 | Soil | MIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLV |
| Ga0209376_13872301 | 3300026540 | Soil | MIRINLLGQNRPKASRRQTMAVDTGSAMPVAFIGI |
| Ga0207860_10035801 | 3300026921 | Tropical Forest Soil | MIRINLLGQTRPKAARRPVDTGAAMPLVFVAAGFLF |
| Ga0207779_10160741 | 3300026928 | Tropical Forest Soil | MIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGVLLGGLF |
| Ga0209529_10601621 | 3300027334 | Forest Soil | MIRINLLGQTRPKAGRRQVVDTGSAMPAIFLFSGVVLGLAFLTF |
| Ga0209622_10629001 | 3300027502 | Forest Soil | MIRINLLGQTRPKTARRPVDTGAAMPLVFIGAGVLLGGLFLFYF |
| Ga0209735_11269802 | 3300027562 | Forest Soil | MIRINLLGQTRPRAARRPVDTGAAMPVVFVGAGAALGVLALFLL |
| Ga0208827_10885331 | 3300027641 | Peatlands Soil | MIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLFLFYFYH |
| Ga0209217_11102752 | 3300027651 | Forest Soil | MIRINLLGQSRPRASRRPVDTGAALPLVFVGAGVLVGA |
| Ga0209009_11665362 | 3300027667 | Forest Soil | MIRINLLGQQRPKAARRPVDTGAALPAVFIGAGVVLGGLV |
| Ga0209074_100362593 | 3300027787 | Agricultural Soil | MIRINLLGQQRPKASRRPVDTGAALPVVFVGAGLVLGG |
| Ga0209139_100028571 | 3300027795 | Bog Forest Soil | MIRINLLGQIRPKSSRRPVDTGAALPVLFIGAGLVLGFLVLGFL |
| Ga0209180_103150662 | 3300027846 | Vadose Zone Soil | MIRINLLGQARPRAGRRPVDTGAALPMAFIGIGVVVGLVV |
| Ga0209180_107041401 | 3300027846 | Vadose Zone Soil | MIRINLLGQIRPRAARRPVDTGSALPVVFIGAGLVLGALV |
| Ga0209701_101342401 | 3300027862 | Vadose Zone Soil | MIRINLLGQHRPKSARRPVDTGAALPLLFIVAGLVLGLLF |
| Ga0209590_102545941 | 3300027882 | Vadose Zone Soil | MIRINLLGQIRPRAARRPVDTGSALPVVFIGAGLVLGALVLGFFY |
| Ga0209006_111209722 | 3300027908 | Forest Soil | MIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLV |
| Ga0222749_107058572 | 3300029636 | Soil | MIRINLLGQVRPKSARRPVDTGAALPVVFIGAGLVLGALVLGFFY |
| Ga0302312_104079611 | 3300030746 | Palsa | MIRINLLGQVRPRSARRPVDTGAALPLLFIGAGAVLGFV |
| Ga0170823_163192712 | 3300031128 | Forest Soil | MIRINLLGQVKPKSARRPVDTGAALPVLFIGIGAALGVVVLGFFYY |
| Ga0170824_1120243171 | 3300031231 | Forest Soil | MIRINLLGQTRPKAARRPADTGAALPVVFIGAGVL |
| Ga0170819_173584191 | 3300031469 | Forest Soil | MIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGY |
| Ga0318516_103746421 | 3300031543 | Soil | MIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAG |
| Ga0318534_104943131 | 3300031544 | Soil | MIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLGYIY |
| Ga0310915_109794511 | 3300031573 | Soil | MIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGCLFLF |
| Ga0318561_101291803 | 3300031679 | Soil | MIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGVLLGGL |
| Ga0318574_106198372 | 3300031680 | Soil | MIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAGVLVG |
| Ga0307476_105082002 | 3300031715 | Hardwood Forest Soil | MIRINLLGQTRPKATRRAVDTGAAMPLVFIGAGALLGCL |
| Ga0307474_104952481 | 3300031718 | Hardwood Forest Soil | MIRINLLGQIRPRAARRPVDTGAALPALFIGAGVVVGLVVL |
| Ga0307469_102040101 | 3300031720 | Hardwood Forest Soil | MIRIKLLGQAKPKTSRRQVDTGAALPVLFIGAGLVFGCLI |
| Ga0318509_101691631 | 3300031768 | Soil | MIRINLLGQTRPKASRRPTMAVDTGGAMPVAFIGAGVLVGVLVLGFF |
| Ga0318567_107170121 | 3300031821 | Soil | MIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAGVLVGVL |
| Ga0310917_104785561 | 3300031833 | Soil | MIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVL |
| Ga0318527_103082812 | 3300031859 | Soil | MIRINLLGQARPKAARRPVDTGAALPAVFIGAGIL |
| Ga0310913_105436822 | 3300031945 | Soil | MIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGVGVLVGALVLGFF |
| Ga0310911_102833072 | 3300032035 | Soil | MIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGVGVLVGA |
| Ga0318504_105982631 | 3300032063 | Soil | MIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLG |
| Ga0318510_102056021 | 3300032064 | Soil | MIRINLLGQARPKATRRPVDTGAALPLVFIGAGVLLGGLF |
| Ga0318553_104910551 | 3300032068 | Soil | MIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLGYIYY |
| Ga0315268_127053981 | 3300032173 | Sediment | MIRINLLGQARPKAGRKAVDLGSALPAVLMGAGIVFGGAVL |
| Ga0307470_105769861 | 3300032174 | Hardwood Forest Soil | MIRINLLGQTRPRAARRPVDTGAALPLVFVGAGAALGVLALFLLYL |
| Ga0307471_1033235672 | 3300032180 | Hardwood Forest Soil | MIRINLLGQIRPKASRRPVDTGAALPALFVGAGVVLGVLVLGFL |
| Ga0307471_1038666292 | 3300032180 | Hardwood Forest Soil | MIRINLLGQQRPKAARRPVDTGAALPAVFIGAGVVLGGLVLG |
| Ga0307472_1007914141 | 3300032205 | Hardwood Forest Soil | MIRINLLGQAKPKASRRPVDTGAALPALFVGAGVLFGALILGYL |
| Ga0315742_102328051 | 3300032756 | Forest Soil | MIRINLLGQIRPKASRRPVDTGAALPVLFVGAGLVLV |
| Ga0335080_105591512 | 3300032828 | Soil | MIRINLLGQMRPKASRRPVDTGAAMPLVFIGAGILLGGLFLFYF |
| Ga0335076_100135559 | 3300032955 | Soil | MIRINLLGQIRPKATRRPVDTGAALPVLFIGAGLALGLAVLGF |
| Ga0326727_103379183 | 3300033405 | Peat Soil | MIRINLLGQTRPKTARRPVDTGAAMPLVFIGAGVLLG |
| Ga0370494_197922_403_519 | 3300034130 | Untreated Peat Soil | MIRINLLGQTRPKAARRAADTGAALPLVFILAGVVLGGL |
| Ga0364932_0069554_1_114 | 3300034177 | Sediment | MIRINLLGQTRPRAGRRPVPLGTTLPAVLILAGIGFAA |
| ⦗Top⦘ |