NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071594

Metagenome / Metatranscriptome Family F071594

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071594
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 40 residues
Representative Sequence MIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLF
Number of Associated Samples 116
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.18 %
% of genes from short scaffolds (< 2000 bps) 93.44 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.590 % of family members)
Environment Ontology (ENVO) Unclassified
(23.770 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.279 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 32.35%    β-sheet: 0.00%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF11104PilM_2 90.16
PF12728HTH_17 6.56
PF01977UbiD 1.64
PF14520HHH_5 0.82
PF04350PilO 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 1.64
COG3167Type IV pilus assembly protein PilOCell motility [N] 1.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01A5EKNAll Organisms → cellular organisms → Bacteria517Open in IMG/M
3300001089|JGI12683J13190_1008127All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300002347|JGIcombinedJ26865_1029603All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300002914|JGI25617J43924_10236480All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300003218|JGI26339J46600_10096264All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005332|Ga0066388_101055299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1369Open in IMG/M
3300005445|Ga0070708_101056209All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005531|Ga0070738_10193063All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005538|Ga0070731_11165931All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005553|Ga0066695_10188793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1291Open in IMG/M
3300005563|Ga0068855_102161365All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005952|Ga0080026_10050967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300006041|Ga0075023_100107488All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300006172|Ga0075018_10796227All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006796|Ga0066665_10189238All Organisms → cellular organisms → Bacteria → Acidobacteria1590Open in IMG/M
3300006954|Ga0079219_11024046All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300009521|Ga0116222_1556627All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009683|Ga0116224_10327582All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300010046|Ga0126384_12418512All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010320|Ga0134109_10458336All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010339|Ga0074046_10762328All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010361|Ga0126378_10468497All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300010379|Ga0136449_101176992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1210Open in IMG/M
3300011074|Ga0138559_1124995All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300011120|Ga0150983_14376866All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300011120|Ga0150983_15857172All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300011269|Ga0137392_11519432All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300011271|Ga0137393_11564971All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012199|Ga0137383_10671104All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012206|Ga0137380_10260868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1560Open in IMG/M
3300012362|Ga0137361_10228047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1692Open in IMG/M
3300012363|Ga0137390_10838534All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300012363|Ga0137390_11629578All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012923|Ga0137359_10061837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3264Open in IMG/M
3300012986|Ga0164304_10710201All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300015371|Ga0132258_13366374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300017966|Ga0187776_11416051All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300017975|Ga0187782_10639140All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300017995|Ga0187816_10318378All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300018007|Ga0187805_10016568All Organisms → cellular organisms → Bacteria → Acidobacteria3166Open in IMG/M
3300018007|Ga0187805_10550008All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018015|Ga0187866_1011525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4987Open in IMG/M
3300018085|Ga0187772_10903644All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300018088|Ga0187771_11762335All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018468|Ga0066662_12398302All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300019192|Ga0184603_141289All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300020199|Ga0179592_10511684All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300020579|Ga0210407_10687659All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300020581|Ga0210399_11264601All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300021168|Ga0210406_10485242All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300021171|Ga0210405_10181260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1669Open in IMG/M
3300021401|Ga0210393_11277774All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021406|Ga0210386_11675255All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021432|Ga0210384_10847814All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300021444|Ga0213878_10265088All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300021474|Ga0210390_10491273All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300021479|Ga0210410_10492535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300022501|Ga0242645_1032046All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300023259|Ga0224551_1082785All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300024290|Ga0247667_1090008All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025898|Ga0207692_10767151All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300025906|Ga0207699_11397456All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300026304|Ga0209240_1162616All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300026304|Ga0209240_1294325All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300026309|Ga0209055_1058889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1631Open in IMG/M
3300026312|Ga0209153_1004175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4539Open in IMG/M
3300026323|Ga0209472_1301404All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300026343|Ga0209159_1182295All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300026354|Ga0257180_1017571All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300026371|Ga0257179_1029307All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300026374|Ga0257146_1029051All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300026482|Ga0257172_1046384All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300026532|Ga0209160_1002545All Organisms → cellular organisms → Bacteria → Acidobacteria15150Open in IMG/M
3300026540|Ga0209376_1387230All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300026921|Ga0207860_1003580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2325Open in IMG/M
3300026928|Ga0207779_1016074All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300027334|Ga0209529_1060162All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300027502|Ga0209622_1062900All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300027562|Ga0209735_1126980All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027641|Ga0208827_1088533All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300027651|Ga0209217_1110275All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300027667|Ga0209009_1166536All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027787|Ga0209074_10036259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1439Open in IMG/M
3300027795|Ga0209139_10002857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6449Open in IMG/M
3300027846|Ga0209180_10315066All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300027846|Ga0209180_10704140All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300027862|Ga0209701_10134240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1523Open in IMG/M
3300027882|Ga0209590_10254594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1121Open in IMG/M
3300027908|Ga0209006_11120972All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300029636|Ga0222749_10705857All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300030746|Ga0302312_10407961All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031128|Ga0170823_16319271All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031231|Ga0170824_112024317All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031469|Ga0170819_17358419All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300031543|Ga0318516_10374642All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300031544|Ga0318534_10494313All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031573|Ga0310915_10979451All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031679|Ga0318561_10129180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1347Open in IMG/M
3300031680|Ga0318574_10619837All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031715|Ga0307476_10508200All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031718|Ga0307474_10495248All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300031720|Ga0307469_10204010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1547Open in IMG/M
3300031768|Ga0318509_10169163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1210Open in IMG/M
3300031821|Ga0318567_10717012All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031833|Ga0310917_10478556All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300031859|Ga0318527_10308281All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031945|Ga0310913_10543682All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300032035|Ga0310911_10283307All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300032063|Ga0318504_10598263All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300032064|Ga0318510_10205602All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300032068|Ga0318553_10491055All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300032173|Ga0315268_12705398All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032174|Ga0307470_10576986All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300032180|Ga0307471_103323567All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032180|Ga0307471_103866629All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300032205|Ga0307472_100791414All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300032756|Ga0315742_10232805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1246Open in IMG/M
3300032828|Ga0335080_10559151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1208Open in IMG/M
3300032955|Ga0335076_10013555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8206Open in IMG/M
3300033405|Ga0326727_10337918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1441Open in IMG/M
3300034130|Ga0370494_197922All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300034177|Ga0364932_0069554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1330Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.28%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.28%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.28%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.64%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.64%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.82%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.82%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.82%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.82%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.82%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.82%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.82%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001089Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3EnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019192Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026921Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes)EnvironmentalOpen in IMG/M
3300026928Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300034130Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_035442802170459024Grass SoilMIRINLLGQTRPKAARRPADTGAALPVVFIGAGVLLGGLFLFYFY
JGI12683J13190_100812713300001089Forest SoilMIRINLLGQTRPRAGRRTVDTGSALPMIFIAAGLALGLA
JGIcombinedJ26865_102960323300002347Arctic Peat SoilMIRINLLGQTRPKAARRTADTGAALPLVFIAAGLLLGGLVLFY
JGI25617J43924_1023648023300002914Grasslands SoilMIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGGLFLF
JGI26339J46600_1009626413300003218Bog Forest SoilMIRINLLGQIRPKSARRPVDTGAALPLVFIGAGVLLGGLFL
Ga0066388_10105529933300005332Tropical Forest SoilMIRINLLGQTRPKAARRPVDTGAALPAVFIGAGILLGGLVLG
Ga0070708_10105620923300005445Corn, Switchgrass And Miscanthus RhizosphereMIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLALFLFY
Ga0070738_1019306313300005531Surface SoilMIRINLLGQMRPKAARRPVDTGAALPIVFVGAGLVLGGLVL
Ga0070731_1116593113300005538Surface SoilMIRINLLGQIRPKAARRPVDTGAAMPIMFIGAGVLLAGLI
Ga0066695_1018879333300005553SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGALV
Ga0068855_10216136523300005563Corn RhizosphereMIRINLLGQAKPKASRRQVDTGAALPVLFIAAGLVF
Ga0080026_1005096723300005952Permafrost SoilMIRINLLGQAKPKASRRPVDTGAALPVLFVGAGVLFGAL
Ga0075023_10010748813300006041WatershedsMIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLALFLLY
Ga0075018_1079622713300006172WatershedsMIRINLLGQLKPKATRRPVDTGAAMPLLFIAAGLIFGCAILF
Ga0066665_1018923833300006796SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGAVV
Ga0079219_1102404623300006954Agricultural SoilMIRINLLGQQRPKASRRPVDTGAALPVVFVGAGLVL
Ga0116222_155662723300009521Peatlands SoilMIRINLLGQIRPKTARRPVDTGAALPLVFIGAGVLLGG
Ga0116224_1032758213300009683Peatlands SoilMIRINLLGQIRPKAARRAVDTGAAMPLVFVGAGLLLGFLFLFY
Ga0126384_1241851213300010046Tropical Forest SoilMIRINLLGQTRPKAARRPVDTGAALPAVFIGAGILLGG
Ga0134109_1045833623300010320Grasslands SoilMIRINLLGQIRPKASRRQTMAVDTGGAMPVAFIGIGVA
Ga0074046_1076232823300010339Bog Forest SoilMIRINLLGQIRPKSSRRPVDTGAALPVLFIGAGLVL
Ga0126378_1046849733300010361Tropical Forest SoilMIRINLLGQTRPKAARRPVDTGAALPAVFIGAGIVLGGL
Ga0136449_10117699213300010379Peatlands SoilMIRINLLGQARPKAARRAADTGAALPLVFMLAGVVLGGLFL
Ga0138559_112499533300011074Peatlands SoilMIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLFLFYFH
Ga0150983_1437686623300011120Forest SoilMIRINLLGQIKPKSSRRPVDTGAALPVLFIGIGAALGVVVLVFF*
Ga0150983_1585717213300011120Forest SoilMIRINLLGQARPRAARRPVDTGAALPLVFVGAGAALGVLA
Ga0137392_1151943223300011269Vadose Zone SoilMIRINLLGQIRPKAARRPVDTGAALPGVFIGAGLVLG
Ga0137393_1156497113300011271Vadose Zone SoilMIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLG
Ga0137383_1067110413300012199Vadose Zone SoilMIRINLLGQQRPKSARRPVDTGAALPAVFVGAGVVLGGLVL
Ga0137380_1026086813300012206Vadose Zone SoilMIRINLLGQIRPKAARRPVDTGAAMPVVFIGAGLVLGALV
Ga0137361_1022804713300012362Vadose Zone SoilMIRINLLGQTRPKSARRPVDTGAALPAVFIGAGVVLGGLVLG
Ga0137390_1083853413300012363Vadose Zone SoilMIRINLLGQAKPKTSRRQVDTGAALPVLFIGAGLVFGCLILGYL
Ga0137390_1162957823300012363Vadose Zone SoilMIRINLLGQARPRAARRRGPVDTGAALPLVFVGAGAAL
Ga0137359_1006183753300012923Vadose Zone SoilMIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLG
Ga0164304_1071020113300012986SoilMIRINLLGQAKPKASRRQVDTGAALPVLFIAAGLVFGCLILGYL
Ga0132258_1336637423300015371Arabidopsis RhizosphereMIRINLLGQTRPKAARRPVDTGAALPAVFIGAGFLLGGLVL
Ga0187776_1141605113300017966Tropical PeatlandMIRINLLGQTRPKATRRPVDTGAALPLVFIGAGVLLGGLF
Ga0187782_1063914023300017975Tropical PeatlandMIRINLLGHVRPKVSRRPVDTGAALPVLFIGAGVAVGVIVLG
Ga0187816_1031837813300017995Freshwater SedimentMIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLF
Ga0187805_1001656813300018007Freshwater SedimentMIRINLLGQVRPKTARRPVDTGAALPVVFIGAGVALG
Ga0187805_1055000823300018007Freshwater SedimentMIRINLLGQIRPKASRRPVDTGAALPILFIGAGFV
Ga0187866_101152513300018015PeatlandMIRINLLGQMRPKAARRPVDTGAALPLVFIGAGVLLGGLF
Ga0187772_1090364413300018085Tropical PeatlandMIRINLLGQTRPKATRRPVDTGAALPLVFIGAGVVLGGLFL
Ga0187771_1176233513300018088Tropical PeatlandMIRINLLGQARPKAARRPVDTGAALPLVFIGAGVLLGGLFLFY
Ga0066662_1239830213300018468Grasslands SoilMIRINLLGQTRPRAARRRGPMMDTGAVTPLVFVGAGAA
Ga0184603_14128923300019192SoilMIRINLLGQIRPKASRRPVDTGAALPVLFIGAGLLLGVL
Ga0179592_1051168413300020199Vadose Zone SoilMIRINLLGQTRPKAGRRPVDTGAAMPVVFVGVGAALG
Ga0210407_1068765923300020579SoilMIRINLLGQAKPKASRRPVDTGAALPALFVGAGVLFGALI
Ga0210399_1126460123300020581SoilMIRINLLGQAKPKASRRPVDTGAALPALFVGAGVL
Ga0210406_1048524223300021168SoilMIRINLLGQIKPKSSRRPVDTGAALPVLFIGIGAALGVVVLVFF
Ga0210405_1018126013300021171SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLALGA
Ga0210393_1127777413300021401SoilMIRINLLGQAKPKASRRPVDTGAALPALFIGAGVLFGALILG
Ga0210386_1167525513300021406SoilMIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGGLFL
Ga0210384_1084781413300021432SoilMIRINLLGQMRPKTSRRPVDTGAAMPVVFVGAGVVLGALLLFY
Ga0213878_1026508823300021444Bulk SoilMIRINLLGQARPKAARRPVDTGAAMPLVFIGAGLLFG
Ga0210390_1049127323300021474SoilMIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGLLLGCLFL
Ga0210410_1049253523300021479SoilMIRINLLGQTRPRAARRPVDTGAALPVVFIGAGAALGILALFL
Ga0242645_103204613300022501SoilMIRINLLGQIRPKASRRPVDTGAALPVLFIGAGLVLGFLVLGFL
Ga0224551_108278513300023259SoilMIRINLLGQAKPKASRRPVDTGAALPVLFVGAGIL
Ga0247667_109000823300024290SoilMIRINLLGQTRPKAARRPVDTGAALPAVFIGAGVLLGGLVLG
Ga0207692_1076715123300025898Corn, Switchgrass And Miscanthus RhizosphereMIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGG
Ga0207699_1139745623300025906Corn, Switchgrass And Miscanthus RhizosphereMIRINLLGQVRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGYLY
Ga0209240_116261613300026304Grasslands SoilMIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGYI
Ga0209240_129432523300026304Grasslands SoilMIRINLLGQIRPRAARRPVDTGAAMPAVFIGAGLLLGALVLGFF
Ga0209055_105888913300026309SoilMIRINLLGQIRPKASRRTVSTGDTGGALPTLFIGAGVILGVLVLGF
Ga0209153_100417563300026312SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGALVLGFF
Ga0209472_130140413300026323SoilMIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLGGLML
Ga0209159_118229523300026343SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVL
Ga0257180_101757113300026354SoilMIRINLLGQQRPRSARRPVDTGAALPAVFIGAGVVLGGLVLGYIYF
Ga0257179_102930713300026371SoilMIRINLLGQTRPKTARRPVDTGAALPAVFIGAGVV
Ga0257146_102905123300026374SoilMIRINLLGQIRPKASRRPVDTGAALPIVFVGAGLVLGG
Ga0257172_104638413300026482SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLVLGA
Ga0209160_1002545173300026532SoilMIRINLLGQIRPKAARRPVDTGAALPVVFIGAGLV
Ga0209376_138723013300026540SoilMIRINLLGQNRPKASRRQTMAVDTGSAMPVAFIGI
Ga0207860_100358013300026921Tropical Forest SoilMIRINLLGQTRPKAARRPVDTGAAMPLVFVAAGFLF
Ga0207779_101607413300026928Tropical Forest SoilMIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGVLLGGLF
Ga0209529_106016213300027334Forest SoilMIRINLLGQTRPKAGRRQVVDTGSAMPAIFLFSGVVLGLAFLTF
Ga0209622_106290013300027502Forest SoilMIRINLLGQTRPKTARRPVDTGAAMPLVFIGAGVLLGGLFLFYF
Ga0209735_112698023300027562Forest SoilMIRINLLGQTRPRAARRPVDTGAAMPVVFVGAGAALGVLALFLL
Ga0208827_108853313300027641Peatlands SoilMIRINLLGQTRPKAARRPVDTGAALPLVFIGAGVLLGGLFLFYFYH
Ga0209217_111027523300027651Forest SoilMIRINLLGQSRPRASRRPVDTGAALPLVFVGAGVLVGA
Ga0209009_116653623300027667Forest SoilMIRINLLGQQRPKAARRPVDTGAALPAVFIGAGVVLGGLV
Ga0209074_1003625933300027787Agricultural SoilMIRINLLGQQRPKASRRPVDTGAALPVVFVGAGLVLGG
Ga0209139_1000285713300027795Bog Forest SoilMIRINLLGQIRPKSSRRPVDTGAALPVLFIGAGLVLGFLVLGFL
Ga0209180_1031506623300027846Vadose Zone SoilMIRINLLGQARPRAGRRPVDTGAALPMAFIGIGVVVGLVV
Ga0209180_1070414013300027846Vadose Zone SoilMIRINLLGQIRPRAARRPVDTGSALPVVFIGAGLVLGALV
Ga0209701_1013424013300027862Vadose Zone SoilMIRINLLGQHRPKSARRPVDTGAALPLLFIVAGLVLGLLF
Ga0209590_1025459413300027882Vadose Zone SoilMIRINLLGQIRPRAARRPVDTGSALPVVFIGAGLVLGALVLGFFY
Ga0209006_1112097223300027908Forest SoilMIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLV
Ga0222749_1070585723300029636SoilMIRINLLGQVRPKSARRPVDTGAALPVVFIGAGLVLGALVLGFFY
Ga0302312_1040796113300030746PalsaMIRINLLGQVRPRSARRPVDTGAALPLLFIGAGAVLGFV
Ga0170823_1631927123300031128Forest SoilMIRINLLGQVKPKSARRPVDTGAALPVLFIGIGAALGVVVLGFFYY
Ga0170824_11202431713300031231Forest SoilMIRINLLGQTRPKAARRPADTGAALPVVFIGAGVL
Ga0170819_1735841913300031469Forest SoilMIRINLLGQQRPKSARRPVDTGAALPAVFIGAGVVLGGLVLGY
Ga0318516_1037464213300031543SoilMIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAG
Ga0318534_1049431313300031544SoilMIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLGYIY
Ga0310915_1097945113300031573SoilMIRINLLGQTRPKASRRPVDTGAALPLVFIGAGVLLGCLFLF
Ga0318561_1012918033300031679SoilMIRINLLGQIRPKAARRPVDTGAAMPLVFIGAGVLLGGL
Ga0318574_1061983723300031680SoilMIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAGVLVG
Ga0307476_1050820023300031715Hardwood Forest SoilMIRINLLGQTRPKATRRAVDTGAAMPLVFIGAGALLGCL
Ga0307474_1049524813300031718Hardwood Forest SoilMIRINLLGQIRPRAARRPVDTGAALPALFIGAGVVVGLVVL
Ga0307469_1020401013300031720Hardwood Forest SoilMIRIKLLGQAKPKTSRRQVDTGAALPVLFIGAGLVFGCLI
Ga0318509_1016916313300031768SoilMIRINLLGQTRPKASRRPTMAVDTGGAMPVAFIGAGVLVGVLVLGFF
Ga0318567_1071701213300031821SoilMIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGAGVLVGVL
Ga0310917_1047855613300031833SoilMIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVL
Ga0318527_1030828123300031859SoilMIRINLLGQARPKAARRPVDTGAALPAVFIGAGIL
Ga0310913_1054368223300031945SoilMIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGVGVLVGALVLGFF
Ga0310911_1028330723300032035SoilMIRINLLGQTRPRASRRPTMAVDTGGAMPVAFIGVGVLVGA
Ga0318504_1059826313300032063SoilMIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLG
Ga0318510_1020560213300032064SoilMIRINLLGQARPKATRRPVDTGAALPLVFIGAGVLLGGLF
Ga0318553_1049105513300032068SoilMIRINLLGQARPKAARRPVDTGAALPAVFIGAGILLGGLVLGYIYY
Ga0315268_1270539813300032173SedimentMIRINLLGQARPKAGRKAVDLGSALPAVLMGAGIVFGGAVL
Ga0307470_1057698613300032174Hardwood Forest SoilMIRINLLGQTRPRAARRPVDTGAALPLVFVGAGAALGVLALFLLYL
Ga0307471_10332356723300032180Hardwood Forest SoilMIRINLLGQIRPKASRRPVDTGAALPALFVGAGVVLGVLVLGFL
Ga0307471_10386662923300032180Hardwood Forest SoilMIRINLLGQQRPKAARRPVDTGAALPAVFIGAGVVLGGLVLG
Ga0307472_10079141413300032205Hardwood Forest SoilMIRINLLGQAKPKASRRPVDTGAALPALFVGAGVLFGALILGYL
Ga0315742_1023280513300032756Forest SoilMIRINLLGQIRPKASRRPVDTGAALPVLFVGAGLVLV
Ga0335080_1055915123300032828SoilMIRINLLGQMRPKASRRPVDTGAAMPLVFIGAGILLGGLFLFYF
Ga0335076_1001355593300032955SoilMIRINLLGQIRPKATRRPVDTGAALPVLFIGAGLALGLAVLGF
Ga0326727_1033791833300033405Peat SoilMIRINLLGQTRPKTARRPVDTGAAMPLVFIGAGVLLG
Ga0370494_197922_403_5193300034130Untreated Peat SoilMIRINLLGQTRPKAARRAADTGAALPLVFILAGVVLGGL
Ga0364932_0069554_1_1143300034177SedimentMIRINLLGQTRPRAGRRPVPLGTTLPAVLILAGIGFAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.