Basic Information | |
---|---|
Family ID | F071566 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 45 residues |
Representative Sequence | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQL |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 15.57 % |
% of genes near scaffold ends (potentially truncated) | 35.25 % |
% of genes from short scaffolds (< 2000 bps) | 84.43 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.574 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.754 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.508 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF00459 | Inositol_P | 45.08 |
PF00782 | DSPc | 36.89 |
PF04851 | ResIII | 3.28 |
PF00441 | Acyl-CoA_dh_1 | 2.46 |
PF05706 | CDKN3 | 2.46 |
PF02705 | K_trans | 0.82 |
PF04273 | BLH_phosphatase | 0.82 |
PF02518 | HATPase_c | 0.82 |
PF01546 | Peptidase_M20 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.46 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.82 |
COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.57 % |
Unclassified | root | N/A | 34.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_100297993 | Not Available | 827 | Open in IMG/M |
3300001686|C688J18823_10122802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1800 | Open in IMG/M |
3300002459|JGI24751J29686_10009318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2016 | Open in IMG/M |
3300002568|C688J35102_120887074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2031 | Open in IMG/M |
3300002568|C688J35102_120963068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3314 | Open in IMG/M |
3300004081|Ga0063454_100215712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
3300004114|Ga0062593_101920410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
3300004156|Ga0062589_100940770 | Not Available | 800 | Open in IMG/M |
3300004479|Ga0062595_100793619 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300004479|Ga0062595_102089752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300004480|Ga0062592_100350531 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005093|Ga0062594_102498583 | Not Available | 567 | Open in IMG/M |
3300005162|Ga0066814_10076854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
3300005331|Ga0070670_100576784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1005 | Open in IMG/M |
3300005332|Ga0066388_105110407 | Not Available | 666 | Open in IMG/M |
3300005336|Ga0070680_100366302 | Not Available | 1226 | Open in IMG/M |
3300005338|Ga0068868_100069066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2815 | Open in IMG/M |
3300005338|Ga0068868_101057943 | Not Available | 745 | Open in IMG/M |
3300005339|Ga0070660_100006166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8296 | Open in IMG/M |
3300005435|Ga0070714_100039484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3975 | Open in IMG/M |
3300005435|Ga0070714_100339445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1409 | Open in IMG/M |
3300005436|Ga0070713_100730170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 947 | Open in IMG/M |
3300005438|Ga0070701_11006003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
3300005439|Ga0070711_100197263 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300005439|Ga0070711_100499620 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300005439|Ga0070711_100531192 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300005439|Ga0070711_101074278 | Not Available | 693 | Open in IMG/M |
3300005455|Ga0070663_100319370 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300005458|Ga0070681_10361821 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300005539|Ga0068853_100618233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1030 | Open in IMG/M |
3300005540|Ga0066697_10809430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
3300005544|Ga0070686_100048687 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
3300005553|Ga0066695_10840221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
3300005566|Ga0066693_10213761 | Not Available | 754 | Open in IMG/M |
3300005587|Ga0066654_10827228 | Not Available | 527 | Open in IMG/M |
3300005615|Ga0070702_100033100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2840 | Open in IMG/M |
3300005615|Ga0070702_100244769 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300005616|Ga0068852_100016920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5704 | Open in IMG/M |
3300005617|Ga0068859_100996701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 920 | Open in IMG/M |
3300005713|Ga0066905_101743913 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005764|Ga0066903_100138010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3456 | Open in IMG/M |
3300005764|Ga0066903_105625590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
3300005840|Ga0068870_10171467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1295 | Open in IMG/M |
3300005843|Ga0068860_100501383 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300006028|Ga0070717_10225077 | Not Available | 1650 | Open in IMG/M |
3300006028|Ga0070717_10552023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300006032|Ga0066696_10238777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1171 | Open in IMG/M |
3300006173|Ga0070716_100624722 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300006175|Ga0070712_100435681 | Not Available | 1089 | Open in IMG/M |
3300006175|Ga0070712_100499082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
3300006175|Ga0070712_101464668 | Not Available | 596 | Open in IMG/M |
3300006605|Ga0074057_11847178 | Not Available | 559 | Open in IMG/M |
3300006755|Ga0079222_10000519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9339 | Open in IMG/M |
3300006794|Ga0066658_10723719 | Not Available | 552 | Open in IMG/M |
3300006804|Ga0079221_11076291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300009012|Ga0066710_100393456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2064 | Open in IMG/M |
3300009098|Ga0105245_10059974 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
3300009137|Ga0066709_100901791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1288 | Open in IMG/M |
3300009162|Ga0075423_10168341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2301 | Open in IMG/M |
3300009162|Ga0075423_12324478 | Not Available | 583 | Open in IMG/M |
3300009176|Ga0105242_10101814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2435 | Open in IMG/M |
3300009177|Ga0105248_10459972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1434 | Open in IMG/M |
3300009545|Ga0105237_10703767 | Not Available | 1017 | Open in IMG/M |
3300010401|Ga0134121_11345620 | Not Available | 722 | Open in IMG/M |
3300012212|Ga0150985_118678103 | Not Available | 540 | Open in IMG/M |
3300012929|Ga0137404_10970883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
3300012951|Ga0164300_10808821 | Not Available | 582 | Open in IMG/M |
3300012955|Ga0164298_10068318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1777 | Open in IMG/M |
3300012955|Ga0164298_10416452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 873 | Open in IMG/M |
3300012955|Ga0164298_10649261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
3300012957|Ga0164303_10544296 | Not Available | 752 | Open in IMG/M |
3300012960|Ga0164301_10047626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2184 | Open in IMG/M |
3300012960|Ga0164301_10285029 | Not Available | 1104 | Open in IMG/M |
3300012961|Ga0164302_10132828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1437 | Open in IMG/M |
3300012984|Ga0164309_11206373 | Not Available | 635 | Open in IMG/M |
3300012986|Ga0164304_10340215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
3300012987|Ga0164307_10615850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
3300012989|Ga0164305_11554620 | Not Available | 589 | Open in IMG/M |
3300013296|Ga0157374_11690724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
3300014325|Ga0163163_10660016 | Not Available | 1109 | Open in IMG/M |
3300014969|Ga0157376_11471240 | Not Available | 714 | Open in IMG/M |
3300014969|Ga0157376_12293569 | Not Available | 579 | Open in IMG/M |
3300015200|Ga0173480_11260310 | Not Available | 502 | Open in IMG/M |
3300015358|Ga0134089_10414720 | Not Available | 577 | Open in IMG/M |
3300015373|Ga0132257_101450269 | Not Available | 875 | Open in IMG/M |
3300016422|Ga0182039_11553727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
3300017792|Ga0163161_11757682 | Not Available | 550 | Open in IMG/M |
3300018433|Ga0066667_10748958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 824 | Open in IMG/M |
3300019361|Ga0173482_10492273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 593 | Open in IMG/M |
3300020082|Ga0206353_11768747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1939 | Open in IMG/M |
3300021415|Ga0193694_1033965 | Not Available | 715 | Open in IMG/M |
3300021445|Ga0182009_10171710 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300025900|Ga0207710_10073853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1569 | Open in IMG/M |
3300025906|Ga0207699_11007928 | Not Available | 616 | Open in IMG/M |
3300025907|Ga0207645_10262604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1144 | Open in IMG/M |
3300025914|Ga0207671_10488117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 982 | Open in IMG/M |
3300025915|Ga0207693_10369605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1122 | Open in IMG/M |
3300025921|Ga0207652_10335662 | Not Available | 1365 | Open in IMG/M |
3300025927|Ga0207687_10202352 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300025929|Ga0207664_10093016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2476 | Open in IMG/M |
3300025932|Ga0207690_10597650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
3300025934|Ga0207686_10876468 | Not Available | 723 | Open in IMG/M |
3300025949|Ga0207667_10451338 | Not Available | 1306 | Open in IMG/M |
3300025960|Ga0207651_10169410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1721 | Open in IMG/M |
3300026088|Ga0207641_11065912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 806 | Open in IMG/M |
3300026089|Ga0207648_10203989 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300026319|Ga0209647_1059685 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
3300027725|Ga0209178_1025687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1844 | Open in IMG/M |
3300028381|Ga0268264_12012724 | Not Available | 587 | Open in IMG/M |
3300028718|Ga0307307_10071409 | Not Available | 1036 | Open in IMG/M |
3300028811|Ga0307292_10387024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
3300028884|Ga0307308_10138657 | Not Available | 1164 | Open in IMG/M |
3300031668|Ga0318542_10397085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
3300031680|Ga0318574_10814817 | Not Available | 547 | Open in IMG/M |
3300031938|Ga0308175_100642510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1147 | Open in IMG/M |
3300031938|Ga0308175_101573831 | Not Available | 735 | Open in IMG/M |
3300031939|Ga0308174_10829993 | Not Available | 778 | Open in IMG/M |
3300032064|Ga0318510_10303498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
3300032074|Ga0308173_10030429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3748 | Open in IMG/M |
3300032074|Ga0308173_10830730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 852 | Open in IMG/M |
3300032180|Ga0307471_101591167 | Not Available | 810 | Open in IMG/M |
3300034268|Ga0372943_0003630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 7770 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.46% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.46% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1002979931 | 3300000956 | Soil | LDRRRERRLALELEHRFRAQLNARAEAAARLADDLD* |
C688J18823_101228021 | 3300001686 | Soil | ADVHASRMRRMIHRLLDRRRERRLALELEHRYRAQLDARTEAAARMADDPQLD* |
JGI24751J29686_100093182 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD* |
C688J35102_1208870742 | 3300002568 | Soil | VHASCMRRMIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADDLA* |
C688J35102_1209630682 | 3300002568 | Soil | MRRMIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADDLG* |
Ga0063454_1002157122 | 3300004081 | Soil | MRRMIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADDLA* |
Ga0062593_1019204101 | 3300004114 | Soil | MRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDL |
Ga0062589_1009407702 | 3300004156 | Soil | MLQGMRQRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMVDDLRQA* |
Ga0062595_1007936192 | 3300004479 | Soil | MLQGMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLPQG* |
Ga0062595_1020897521 | 3300004479 | Soil | MRDLITRLRGRRRDRRMARELEQRYRAQIDARSEAAARMSDAA* |
Ga0062592_1003505311 | 3300004480 | Soil | MRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0062594_1024985832 | 3300005093 | Soil | LLDRLMGRRRERTLARELERRARAQLDARAEAAARMADDVRQR* |
Ga0066814_100768542 | 3300005162 | Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQL |
Ga0070670_1005767841 | 3300005331 | Switchgrass Rhizosphere | VHASCMRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD* |
Ga0066388_1051104072 | 3300005332 | Tropical Forest Soil | HACGMRRMLTRLIGRRRDRRLAQQLELRYRAQLDARSEAAARIADDLQPE* |
Ga0070680_1003663021 | 3300005336 | Corn Rhizosphere | RLLGRRREKDLARRLERRARAQIDARAEAAARMADEPRP* |
Ga0068868_1000690662 | 3300005338 | Miscanthus Rhizosphere | MLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE* |
Ga0068868_1010579431 | 3300005338 | Miscanthus Rhizosphere | LMGRRRDRTLARELERRARAQLDARAEAAARMADDVRQTSA* |
Ga0070660_1000061669 | 3300005339 | Corn Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD* |
Ga0070714_1000394843 | 3300005435 | Agricultural Soil | MRRLITRFRGRRRDRQLARTLEQRYRAQIDARSEAAARMSDAA* |
Ga0070714_1003394453 | 3300005435 | Agricultural Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARLADELD* |
Ga0070713_1007301702 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0070701_110060031 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD* |
Ga0070711_1001972632 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VMTRLFGRRRERRLANELELRYRAQLDARSEAAARMADEMRPTA* |
Ga0070711_1004996203 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VHASCMRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0070711_1005311922 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSCMRRMIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADDL* |
Ga0070711_1010742782 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD* |
Ga0070663_1003193703 | 3300005455 | Corn Rhizosphere | VHASCMRRMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD* |
Ga0070681_103618212 | 3300005458 | Corn Rhizosphere | MRGMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0068853_1006182331 | 3300005539 | Corn Rhizosphere | VHASCMRSMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD* |
Ga0066697_108094302 | 3300005540 | Soil | MLQGMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA* |
Ga0070686_1000486873 | 3300005544 | Switchgrass Rhizosphere | MRSMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD* |
Ga0066695_108402211 | 3300005553 | Soil | MRRVIHRLLDRRRERRLALELEHRFRAQLNARAEAA |
Ga0066693_102137612 | 3300005566 | Soil | MLHTMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA* |
Ga0066654_108272282 | 3300005587 | Soil | VHASGVRRVMTRLFGRRRERRLAHELELRYRAQLDARSEAAARMADEMRPTA* |
Ga0070702_1000331003 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VHASCMRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLA* |
Ga0070702_1002447692 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MHASHMRRMLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE* |
Ga0068852_1000169203 | 3300005616 | Corn Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0068859_1009967011 | 3300005617 | Switchgrass Rhizosphere | MIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADD |
Ga0066905_1017439132 | 3300005713 | Tropical Forest Soil | MRRMLTRLIGRRRDRRLAQQLELRYRAQLDARSEAAARIADDLQPE* |
Ga0066903_1001380103 | 3300005764 | Tropical Forest Soil | MRRMFARLFGRRRERRLAHDLELRYRAQLDARSEAAARMADD* |
Ga0066903_1056255902 | 3300005764 | Tropical Forest Soil | MINRLFGRRRDRRLAREIEHRYRAQLDARAEAAARMSDDD* |
Ga0068870_101714673 | 3300005840 | Miscanthus Rhizosphere | MIHRLLDRRRERRLALEREHRFRAQLNARAEAAARMADDL |
Ga0068860_1005013832 | 3300005843 | Switchgrass Rhizosphere | VHASCMRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0070717_102250771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MINRLFERRRERRLAREIEGRYRAQLDARAEAAARMSDDV* |
Ga0070717_105520232 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARLFGRRRERRLAHDLELRYRAQLDARSEAAARMSDD* |
Ga0066696_102387772 | 3300006032 | Soil | MLQAMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA* |
Ga0070716_1006247222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLFGRRRERRLANELELRYRAQLDARSEAAARMADEMRPTA* |
Ga0070712_1004356812 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VHASGVRRVMTRLFGRRRERRLANELELRYRAQLDARSEAAARMADEMRPTA* |
Ga0070712_1004990821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRMIHRLLDRRRERRLAQELEHRFRAQLNARAEAAARLADELD* |
Ga0070712_1014646682 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLRGRRRDRRMARELEQRYRAQIDARSEAAARMSDAA* |
Ga0074057_118471781 | 3300006605 | Soil | SCNSVDFWPADVHASCMRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0079222_100005197 | 3300006755 | Agricultural Soil | MRRMIHRLLDRRRERRLALELELRFRDQLNARAEAAARMADDLQLD* |
Ga0066658_107237192 | 3300006794 | Soil | ASRMRGLITRLRGRRRDRQLARELEQRYRAQLDARSEAAARMSDAA* |
Ga0079221_110762912 | 3300006804 | Agricultural Soil | MRGLITRLRGRRRDRQLARELEQRYRAQLDARSEAAARMSDAA* |
Ga0066710_1003934564 | 3300009012 | Grasslands Soil | MLQGMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA |
Ga0105245_100599745 | 3300009098 | Miscanthus Rhizosphere | MLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE* |
Ga0066709_1009017912 | 3300009137 | Grasslands Soil | MHAVGVHRLLDRLFGRRRERALARELERRVRAQVDARAEAAARMADDLRQA* |
Ga0075423_101683411 | 3300009162 | Populus Rhizosphere | HRLLDRRRERRLALELELRFRDQLNARAEAAARMADDLQLD* |
Ga0075423_123244782 | 3300009162 | Populus Rhizosphere | GRRREKDLARRLEQRARAQLDARAEAAARMADEPRP* |
Ga0105242_101018141 | 3300009176 | Miscanthus Rhizosphere | MIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD* |
Ga0105248_104599723 | 3300009177 | Switchgrass Rhizosphere | MIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDL |
Ga0105237_107037671 | 3300009545 | Corn Rhizosphere | RLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0134121_113456202 | 3300010401 | Terrestrial Soil | VHASCMRGMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0150985_1186781032 | 3300012212 | Avena Fatua Rhizosphere | RRMIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADDLA* |
Ga0137404_109708832 | 3300012929 | Vadose Zone Soil | MRQRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA* |
Ga0164300_108088212 | 3300012951 | Soil | MRGMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLD* |
Ga0164298_100683184 | 3300012955 | Soil | MRRMIHRLIDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0164298_104164522 | 3300012955 | Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLD* |
Ga0164298_106492612 | 3300012955 | Soil | MLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADDLQPE* |
Ga0164303_105442962 | 3300012957 | Soil | DFWPAEVHASCMRGMIPRLLDRRRERRLAMELEHRCRAQLNARAEAAARMADDLD* |
Ga0164301_100476262 | 3300012960 | Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARLADDLQLD* |
Ga0164301_102850292 | 3300012960 | Soil | MRGIIHRLLDRRRNRRLALELEHRYRAQLDSRAEAAARMADD* |
Ga0164302_101328284 | 3300012961 | Soil | DRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0164309_112063731 | 3300012984 | Soil | MRGIIHRLLDRRRDRRLALELEHRYRAQLDSRAEAAARMADD* |
Ga0164304_103402152 | 3300012986 | Soil | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLD* |
Ga0164307_106158502 | 3300012987 | Soil | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARLADELD* |
Ga0164305_115546202 | 3300012989 | Soil | MHASDMRRMLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADDLQPE* |
Ga0157374_116907242 | 3300013296 | Miscanthus Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDVKLD |
Ga0163163_106600163 | 3300014325 | Switchgrass Rhizosphere | LGRRREKELARRLEQRARAQLDARAEAAARMADEPRP* |
Ga0157376_114712401 | 3300014969 | Miscanthus Rhizosphere | PADVHASCMRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD* |
Ga0157376_122935691 | 3300014969 | Miscanthus Rhizosphere | ASCMRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0173480_112603102 | 3300015200 | Soil | DVHASCMRRMIHRLLDRRRERRLALELEHRFRAQLDARAEAAARMADDLQLD* |
Ga0134089_104147202 | 3300015358 | Grasslands Soil | NRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA* |
Ga0132257_1014502691 | 3300015373 | Arabidopsis Rhizosphere | VDFWPADVHASCMRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD* |
Ga0182039_115537272 | 3300016422 | Soil | MRRMIARLFGRRRERRLAQELELRYRAQLDARSEAAARMA |
Ga0163161_117576821 | 3300017792 | Switchgrass Rhizosphere | ASHMRRMLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE |
Ga0066667_107489582 | 3300018433 | Grasslands Soil | MWCMLQAMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLRQA |
Ga0173482_104922731 | 3300019361 | Soil | MRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD |
Ga0206353_117687473 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD |
Ga0193694_10339652 | 3300021415 | Soil | MRRIIHRLLDRRRERRLALELEHRYRAQLDSRAEAAARMADD |
Ga0182009_101717102 | 3300021445 | Soil | MRDLITRLRGRRRDRRMARELEQRYRAQIDARSEAAARMSDAA |
Ga0207710_100738532 | 3300025900 | Switchgrass Rhizosphere | MRRMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD |
Ga0207699_110079282 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDRLFGRRRERRLVHELEQRYRAQLDARSEAAARLADEQPIG |
Ga0207645_102626042 | 3300025907 | Miscanthus Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMAD |
Ga0207671_104881172 | 3300025914 | Corn Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD |
Ga0207693_103696052 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHRLLDRRRERRLALELEHRYRAQLNARAEAAARMADD |
Ga0207652_103356621 | 3300025921 | Corn Rhizosphere | DFWPAEVHASCMRGMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD |
Ga0207687_102023522 | 3300025927 | Miscanthus Rhizosphere | MLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE |
Ga0207664_100930165 | 3300025929 | Agricultural Soil | MRRLITRFRGRRRDRQLARTLEQRYRAQIDARSEAAARMSDAA |
Ga0207690_105976502 | 3300025932 | Corn Rhizosphere | LLDRLMGRRRERTLARELERRARAQLDARAEAAARMADDVRQR |
Ga0207686_108764681 | 3300025934 | Miscanthus Rhizosphere | RLMGRRRDRTLARELERRARAQLDARAEAAARMADDVRQTSA |
Ga0207667_104513383 | 3300025949 | Corn Rhizosphere | LLDRRRERRLALELEHRFRAQLNARAEAAARMADDLRLD |
Ga0207651_101694104 | 3300025960 | Switchgrass Rhizosphere | MRSMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD |
Ga0207641_110659121 | 3300026088 | Switchgrass Rhizosphere | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMVDDLRLD |
Ga0207648_102039893 | 3300026089 | Miscanthus Rhizosphere | MRSMIHRLLDRRRERRLALELEHRFRDQLNARAEAAARMADDLQLD |
Ga0209647_10596852 | 3300026319 | Grasslands Soil | MLQGMRRRVINRLMGRRRERRLAQELELRFRAQLDARAEAAARMADDLPQG |
Ga0209178_10256872 | 3300027725 | Agricultural Soil | MRRMIHRLLDRRRERRLALELELRFRDQLNARAEAAARMADDLQLD |
Ga0268264_120127242 | 3300028381 | Switchgrass Rhizosphere | MHASHMRRMLTRMLGRRRERRLAQQLELRYRAQLDARSEAAARIADNLQPE |
Ga0307307_100714093 | 3300028718 | Soil | MRRMIHRLLDRRRERRLAWELEHRYRAQLNARAEAAARMADDLQLD |
Ga0307292_103870241 | 3300028811 | Soil | MIHRLLDRRRERRLAWELEHRYRAQLNARAEAAARMADD |
Ga0307308_101386573 | 3300028884 | Soil | NSVDFSHANVHASSMRRMIHRLLDRRRERRLAWELEHRYRAQLNARAEAAARMADDLQLD |
Ga0318542_103970852 | 3300031668 | Soil | MIARLFGRRRERRLAQELELRYRAQLDARSEAAARMADD |
Ga0318574_108148172 | 3300031680 | Soil | RVHSSFMRRMIARLFGRRRERRLAQELELRYRAQLDARSEAAARMADD |
Ga0308175_1006425102 | 3300031938 | Soil | MIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLN |
Ga0308175_1015738312 | 3300031938 | Soil | MHASDMRRMLTRLLGRRRERRLAQQLELRYRAQLDARSEAAARIADDLQPE |
Ga0308174_108299931 | 3300031939 | Soil | RDLITRLWGRRRDRRMARELEQRYRAQIDARSEAAARMSDAA |
Ga0318510_103034981 | 3300032064 | Soil | MRRMIARLFGRRRERRLAQELELRYRAQLDARSEAAARMAD |
Ga0308173_100304293 | 3300032074 | Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLN |
Ga0308173_108307302 | 3300032074 | Soil | MRDLITRLWGRRRDRRMAHELEQRYRAQIDARSEAAARMSDAA |
Ga0307471_1015911671 | 3300032180 | Hardwood Forest Soil | MRRMIHRLLDRRRERRLALELEHRFRAQLNARAEAAARMADDLQLD |
Ga0372943_0003630_7056_7187 | 3300034268 | Soil | MRGVIARLLGRRRDRRLARALELRYRAQLDARTEAAARMVDAD |
⦗Top⦘ |