| Basic Information | |
|---|---|
| Family ID | F071552 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MLEWKFRLVILLALAGVIAVGLGNLGGLVHNFGW |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.50 % |
| % of genes near scaffold ends (potentially truncated) | 40.16 % |
| % of genes from short scaffolds (< 2000 bps) | 87.70 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.574 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.475 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.131 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00877 | NLPC_P60 | 32.79 |
| PF00990 | GGDEF | 13.93 |
| PF01966 | HD | 4.92 |
| PF00392 | GntR | 2.46 |
| PF02786 | CPSase_L_D2 | 1.64 |
| PF14016 | DUF4232 | 0.82 |
| PF02629 | CoA_binding | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 32.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.57 % |
| Unclassified | root | N/A | 34.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig90273 | Not Available | 622 | Open in IMG/M |
| 2170459002|FZY7DQ102HAEAB | Not Available | 511 | Open in IMG/M |
| 2170459023|GZGNO2B02GRML1 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300000953|JGI11615J12901_10386831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1673 | Open in IMG/M |
| 3300001205|C688J13580_1005257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300001686|C688J18823_10027458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3876 | Open in IMG/M |
| 3300001686|C688J18823_10040584 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300001686|C688J18823_10198091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1356 | Open in IMG/M |
| 3300001686|C688J18823_10288955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300002568|C688J35102_120695029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
| 3300002568|C688J35102_120695138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
| 3300004081|Ga0063454_100971458 | Not Available | 680 | Open in IMG/M |
| 3300004153|Ga0063455_101440414 | Not Available | 534 | Open in IMG/M |
| 3300004479|Ga0062595_102105880 | Not Available | 549 | Open in IMG/M |
| 3300005330|Ga0070690_101771526 | Not Available | 503 | Open in IMG/M |
| 3300005332|Ga0066388_105354260 | Not Available | 651 | Open in IMG/M |
| 3300005355|Ga0070671_100219013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300005435|Ga0070714_100489516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300005439|Ga0070711_100256615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1374 | Open in IMG/M |
| 3300005450|Ga0066682_10126440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1618 | Open in IMG/M |
| 3300005526|Ga0073909_10049637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1518 | Open in IMG/M |
| 3300005532|Ga0070739_10009954 | All Organisms → cellular organisms → Bacteria | 9293 | Open in IMG/M |
| 3300005538|Ga0070731_11162190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300005553|Ga0066695_10104014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1742 | Open in IMG/M |
| 3300005554|Ga0066661_10827847 | Not Available | 541 | Open in IMG/M |
| 3300005560|Ga0066670_10478214 | Not Available | 767 | Open in IMG/M |
| 3300005560|Ga0066670_10556325 | Not Available | 701 | Open in IMG/M |
| 3300005563|Ga0068855_100149545 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300005563|Ga0068855_100592225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1197 | Open in IMG/M |
| 3300005563|Ga0068855_100706297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300005563|Ga0068855_101513076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300005564|Ga0070664_101103746 | Not Available | 747 | Open in IMG/M |
| 3300005576|Ga0066708_10451248 | Not Available | 826 | Open in IMG/M |
| 3300005587|Ga0066654_10507767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300005614|Ga0068856_100071330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3439 | Open in IMG/M |
| 3300005614|Ga0068856_100540126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1187 | Open in IMG/M |
| 3300005764|Ga0066903_100097080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3956 | Open in IMG/M |
| 3300005764|Ga0066903_100290063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2576 | Open in IMG/M |
| 3300005764|Ga0066903_100704189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1781 | Open in IMG/M |
| 3300005764|Ga0066903_100770411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1714 | Open in IMG/M |
| 3300005764|Ga0066903_101167677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1426 | Open in IMG/M |
| 3300005764|Ga0066903_101358899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1332 | Open in IMG/M |
| 3300005764|Ga0066903_101903194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1139 | Open in IMG/M |
| 3300005764|Ga0066903_104908073 | Not Available | 710 | Open in IMG/M |
| 3300005891|Ga0075283_1014536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1201 | Open in IMG/M |
| 3300005900|Ga0075272_1098708 | Not Available | 561 | Open in IMG/M |
| 3300006028|Ga0070717_10729217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300006028|Ga0070717_11782835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300006028|Ga0070717_11917366 | Not Available | 534 | Open in IMG/M |
| 3300006031|Ga0066651_10262250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
| 3300006031|Ga0066651_10464713 | Not Available | 671 | Open in IMG/M |
| 3300006032|Ga0066696_10144774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1477 | Open in IMG/M |
| 3300006032|Ga0066696_10764288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300006034|Ga0066656_11116985 | Not Available | 507 | Open in IMG/M |
| 3300006059|Ga0075017_100137361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1732 | Open in IMG/M |
| 3300006173|Ga0070716_101131257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300006581|Ga0074048_13245506 | Not Available | 609 | Open in IMG/M |
| 3300006794|Ga0066658_10127655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300006804|Ga0079221_10862822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300006804|Ga0079221_11679298 | Not Available | 517 | Open in IMG/M |
| 3300006852|Ga0075433_10316952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300006893|Ga0073928_10688896 | Not Available | 714 | Open in IMG/M |
| 3300007076|Ga0075435_100431418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300007788|Ga0099795_10106194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1107 | Open in IMG/M |
| 3300009137|Ga0066709_100936757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1264 | Open in IMG/M |
| 3300009545|Ga0105237_12025923 | Not Available | 584 | Open in IMG/M |
| 3300009551|Ga0105238_10042991 | All Organisms → cellular organisms → Bacteria | 4573 | Open in IMG/M |
| 3300009551|Ga0105238_10745340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300009792|Ga0126374_10581173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300010159|Ga0099796_10021368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1992 | Open in IMG/M |
| 3300010321|Ga0134067_10044174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1418 | Open in IMG/M |
| 3300010322|Ga0134084_10048093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1248 | Open in IMG/M |
| 3300010358|Ga0126370_12097145 | Not Available | 555 | Open in IMG/M |
| 3300010359|Ga0126376_11200992 | Not Available | 773 | Open in IMG/M |
| 3300010359|Ga0126376_12705707 | Not Available | 545 | Open in IMG/M |
| 3300010361|Ga0126378_11897230 | Not Available | 678 | Open in IMG/M |
| 3300010362|Ga0126377_10557946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1185 | Open in IMG/M |
| 3300010366|Ga0126379_13659101 | Not Available | 515 | Open in IMG/M |
| 3300010400|Ga0134122_10889471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
| 3300010400|Ga0134122_11632566 | Not Available | 670 | Open in IMG/M |
| 3300012199|Ga0137383_10603501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
| 3300012207|Ga0137381_11038689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300012208|Ga0137376_10141054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2069 | Open in IMG/M |
| 3300012212|Ga0150985_104511142 | Not Available | 886 | Open in IMG/M |
| 3300012212|Ga0150985_117535342 | Not Available | 539 | Open in IMG/M |
| 3300012285|Ga0137370_10030527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2796 | Open in IMG/M |
| 3300012469|Ga0150984_104905052 | Not Available | 721 | Open in IMG/M |
| 3300012469|Ga0150984_108867898 | Not Available | 549 | Open in IMG/M |
| 3300012910|Ga0157308_10314096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300012924|Ga0137413_10590481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300012951|Ga0164300_10106826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1239 | Open in IMG/M |
| 3300012951|Ga0164300_10359718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300012971|Ga0126369_11384631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300013104|Ga0157370_11430052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300013296|Ga0157374_12937216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300013307|Ga0157372_10796171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
| 3300013832|Ga0120132_1043297 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300015371|Ga0132258_10718320 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300015371|Ga0132258_13223339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300017937|Ga0187809_10141920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300024182|Ga0247669_1005172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2702 | Open in IMG/M |
| 3300024286|Ga0247687_1009529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300024287|Ga0247690_1017280 | Not Available | 816 | Open in IMG/M |
| 3300024323|Ga0247666_1054734 | Not Available | 804 | Open in IMG/M |
| 3300025916|Ga0207663_10194514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300025916|Ga0207663_10741692 | Not Available | 780 | Open in IMG/M |
| 3300025922|Ga0207646_11173832 | Not Available | 674 | Open in IMG/M |
| 3300025924|Ga0207694_10510814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300025928|Ga0207700_10580603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 997 | Open in IMG/M |
| 3300025929|Ga0207664_10522611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300025939|Ga0207665_10584100 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300025944|Ga0207661_12168952 | Not Available | 502 | Open in IMG/M |
| 3300025961|Ga0207712_11864953 | Not Available | 538 | Open in IMG/M |
| 3300025994|Ga0208142_1018509 | Not Available | 737 | Open in IMG/M |
| 3300028802|Ga0307503_10440534 | Not Available | 689 | Open in IMG/M |
| 3300031819|Ga0318568_10213994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300031938|Ga0308175_103059013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300031939|Ga0308174_10002374 | All Organisms → cellular organisms → Bacteria | 9243 | Open in IMG/M |
| 3300032068|Ga0318553_10712278 | Not Available | 525 | Open in IMG/M |
| 3300032893|Ga0335069_10106925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3525 | Open in IMG/M |
| 3300033550|Ga0247829_11183335 | Not Available | 634 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 7.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.46% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.82% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0273.00005530 | 2166559005 | Simulated | SGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGSLGGSLHHNFGW |
| E1_06877000 | 2170459002 | Grass Soil | MLEWKFRLVILLALAGVLAAGLGSLGGSLHHNFGW |
| FA3_11328710 | 2170459023 | Grass Soil | MLEWKFRLVILLALAGVLAVGLGSLGGSLHHNFGW |
| JGI11615J12901_103868312 | 3300000953 | Soil | MLEWKFRLVILLAAAAMIAAALGNLGWRPHNLGW* |
| C688J13580_10052572 | 3300001205 | Soil | MLEWKFRLVILLALSGTIAAALGIGGLHAFNFSW* |
| C688J18823_100274585 | 3300001686 | Soil | MLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW* |
| C688J18823_100405841 | 3300001686 | Soil | TTFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW* |
| C688J18823_101980912 | 3300001686 | Soil | MLEWKFRLVILMALAGMVAAAVGNLGGLIHNFSW* |
| C688J18823_102889551 | 3300001686 | Soil | MLEWKFRLVVLLAVAGTVAAALGSLGCFLPLNFNW* |
| C688J35102_1206950292 | 3300002568 | Soil | TFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW* |
| C688J35102_1206951382 | 3300002568 | Soil | TFSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW* |
| Ga0063454_1009714582 | 3300004081 | Soil | PGGTMLEWKFRLVILLALAGTIAAGLGHLGGLHPLNFSW* |
| Ga0063455_1014404141 | 3300004153 | Soil | PTMFSPGGTMLEWKFRLVILLALSGTIAAALGIGGLHAFNFSW* |
| Ga0062595_1021058802 | 3300004479 | Soil | SGVPTTFSPGGTMLEWKFRLVILLAVAGSVAAALGNLVTAHNFGW* |
| Ga0070690_1017715261 | 3300005330 | Switchgrass Rhizosphere | PTIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW* |
| Ga0066388_1053542601 | 3300005332 | Tropical Forest Soil | SPGGTMLEWKFRLVILLAVAGMIAAAFGNFGWHPHNFGW* |
| Ga0070671_1002190131 | 3300005355 | Switchgrass Rhizosphere | SPGGTMLEWKFRLVILLALAGTIATALGNLGWHSMNLGW* |
| Ga0070714_1004895162 | 3300005435 | Agricultural Soil | VPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW* |
| Ga0070711_1002566152 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW* |
| Ga0066682_101264401 | 3300005450 | Soil | FSPGGTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW* |
| Ga0073909_100496372 | 3300005526 | Surface Soil | MLEWKFRLVILLALAGVTAAALGNLGGLIHNFSW* |
| Ga0070739_100099547 | 3300005532 | Surface Soil | MLEWKFRLVILLAFAGMVAAAFGNLGWHPLNLGW* |
| Ga0070731_111621901 | 3300005538 | Surface Soil | MLEWKFRLVILLALAGVIAVSLGNLDGLLHCNFGW* |
| Ga0066695_101040142 | 3300005553 | Soil | MLEWKFRLVILLALAGVIAVGLGNFGGLVHNFGW* |
| Ga0066661_108278471 | 3300005554 | Soil | TMLEWKSRLVILLALAAMIAAALGNLGLSHINFGW* |
| Ga0066670_104782141 | 3300005560 | Soil | PGGTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW* |
| Ga0066670_105563251 | 3300005560 | Soil | SPGGTMLEWKFRLVILLAVAGMTAAALGNLGGLIHNFSW* |
| Ga0068855_1001495452 | 3300005563 | Corn Rhizosphere | MLEWKFRLVILLALAGTIAAALGNLGWHSMNLGW* |
| Ga0068855_1005922252 | 3300005563 | Corn Rhizosphere | MLEWKFRLVILLALAGTVAAALGNLGGLIHNFSW* |
| Ga0068855_1007062972 | 3300005563 | Corn Rhizosphere | MLEWKFRLVILLALAGVIAAGLGNLAGSLHVNFGW* |
| Ga0068855_1015130762 | 3300005563 | Corn Rhizosphere | MLEWKFRLVILLAAAAMIAAALGNLGWHSLNLGW* |
| Ga0070664_1011037461 | 3300005564 | Corn Rhizosphere | GGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW* |
| Ga0066708_104512481 | 3300005576 | Soil | AEPTIPPSGVPTTYSPGGTMLEWKFRLVILLAVAGMIAAALGNLGGLIHNFSW* |
| Ga0066654_105077672 | 3300005587 | Soil | MLEWKFRLVILLAVAGMVAAAIGNFGWHPSNFSW* |
| Ga0068856_1000713305 | 3300005614 | Corn Rhizosphere | MLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW* |
| Ga0068856_1005401262 | 3300005614 | Corn Rhizosphere | MLEWKFRLVILLAAAAMIAAVLGNLGWRSLQLGW* |
| Ga0066903_1000970802 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILMAVAGMIAAAVGNLGWHPHNLGW* |
| Ga0066903_1002900632 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILLALAAMLAAALGNIGGPVHNFGW* |
| Ga0066903_1007041892 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILLAVAGMIAAAFGNFGWHPHNFSW* |
| Ga0066903_1007704112 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILAALAVTVAAALGNLGWHPSNLGW* |
| Ga0066903_1011676772 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILLAVAGMIAAALGNFGWHPHNFSW* |
| Ga0066903_1013588992 | 3300005764 | Tropical Forest Soil | MLEWKFRLVIFLALAGTVAAALGNFSWHPLNFSW* |
| Ga0066903_1019031942 | 3300005764 | Tropical Forest Soil | MLEWKFRLVILLAVAGMVAAAFGNFGWHPLNFSW* |
| Ga0066903_1049080731 | 3300005764 | Tropical Forest Soil | RPQFRGSGVPTTFSPGGTMLEWKFRLVILLAVAGMVAAALGNLGGAHLLNFGW* |
| Ga0075283_10145362 | 3300005891 | Rice Paddy Soil | MLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW* |
| Ga0075272_10987082 | 3300005900 | Rice Paddy Soil | FRSGVPTTYSPGGKMLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW* |
| Ga0070717_107292171 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TISVPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW* |
| Ga0070717_117828352 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW* |
| Ga0070717_119173662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEWKFRLVILLALAGILAVGLGNLGGLVHNFGW* |
| Ga0066651_102622502 | 3300006031 | Soil | MLEWKFRLVILLAVAGMTAAALGNLGGLIHNFSW* |
| Ga0066651_104647131 | 3300006031 | Soil | GTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW* |
| Ga0066696_101447742 | 3300006032 | Soil | MLEWKFRLVILLALTGVIAVGLGNLGGLVRNFGW* |
| Ga0066696_107642882 | 3300006032 | Soil | MLEWKFRLVILLAVAGMVAAAFGNFGWHPLNFGW* |
| Ga0066656_111169852 | 3300006034 | Soil | SPGGTMLEWKFRLVILLALAGTVAASLGSLIANHNYGW* |
| Ga0075017_1001373612 | 3300006059 | Watersheds | MLEWKSRLVILLALAGTVAAALGNLGWHPHNLGW* |
| Ga0070716_1011312572 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW* |
| Ga0074048_132455061 | 3300006581 | Soil | LSGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW* |
| Ga0066658_101276552 | 3300006794 | Soil | MLEWKFRLVILLALSGTIAAALGNLGALHPLNFSW* |
| Ga0079221_108628222 | 3300006804 | Agricultural Soil | MLEWKFRLVILRALAGTIAAALGNLGWHSMNLGW* |
| Ga0079221_116792981 | 3300006804 | Agricultural Soil | SGVPTTFSPGGTMLEWKFRLVILLAAAAMIAVALGNLGGQVHNFSW* |
| Ga0075433_103169521 | 3300006852 | Populus Rhizosphere | MLEWKFRLVILLALAGMTAAALGNLGGLIRNFSW* |
| Ga0073928_106888961 | 3300006893 | Iron-Sulfur Acid Spring | MLEWKFRLVILLALACTVAVALGNLGWQPNNLGW* |
| Ga0075435_1004314182 | 3300007076 | Populus Rhizosphere | TIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIRNFSW* |
| Ga0099795_101061942 | 3300007788 | Vadose Zone Soil | MLEWKFRLVTLLALAGVLAVGLGGLALPHFNFGW* |
| Ga0066709_1009367572 | 3300009137 | Grasslands Soil | MLEWKFRLVILLALAGVIAVGLGNLGGLVHNFGW* |
| Ga0105237_120259231 | 3300009545 | Corn Rhizosphere | TTFSPGGTMLEWKFRLVILLAVAGTIAAALGNLGGLIHNFSW* |
| Ga0105238_100429912 | 3300009551 | Corn Rhizosphere | MLERKFRLVILLALAGTIAAALGNLGWHSMNLGW* |
| Ga0105238_107453401 | 3300009551 | Corn Rhizosphere | TYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW* |
| Ga0126374_105811732 | 3300009792 | Tropical Forest Soil | MLEWKFRLVILLAVAGMVAAALGSLPASHLNFGW* |
| Ga0099796_100213682 | 3300010159 | Vadose Zone Soil | MLEWKFRLVTLLALAGVLAVGLGGFALPHFNFGW* |
| Ga0134067_100441742 | 3300010321 | Grasslands Soil | MLEWKFRLVILLALSGTIAAAVRNLGALHALDFSW* |
| Ga0134084_100480932 | 3300010322 | Grasslands Soil | MLEWKFRLVILLALTGVIAVGLGNLGGLVRNYGW* |
| Ga0126370_120971451 | 3300010358 | Tropical Forest Soil | MLEWKFRLVILLAVAGMIAAAFGNFGWHPLNFSW* |
| Ga0126376_112009922 | 3300010359 | Tropical Forest Soil | MLEWKFRLVILMAAAGMVAAAFGNFGWHPLNFSW* |
| Ga0126376_127057072 | 3300010359 | Tropical Forest Soil | MLEWKFRLVILLAVAGMIAAALGSLPGSHLNFGW* |
| Ga0126378_118972302 | 3300010361 | Tropical Forest Soil | MLEWKSRLLILLALAGVLAASSGLIGGLVHNFGW* |
| Ga0126377_105579462 | 3300010362 | Tropical Forest Soil | MLEWKFRLVILLAVAGMVAAAFGNFGWHPHNFGW* |
| Ga0126379_136591012 | 3300010366 | Tropical Forest Soil | FSPGGTMLEWKFRLVILLAAAGMVAAALGSGHGPHNFGW* |
| Ga0134122_108894712 | 3300010400 | Terrestrial Soil | MLEWKFRLVILLALAGVIAAGLGSLGGLVHNFGW* |
| Ga0134122_116325662 | 3300010400 | Terrestrial Soil | GTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW* |
| Ga0137383_106035012 | 3300012199 | Vadose Zone Soil | MLEWKSRLVILLALAAMIAAALGNLGLSHINFGW* |
| Ga0137381_110386892 | 3300012207 | Vadose Zone Soil | MLEWKSRLVILLALAAMIAAALGNFDLSHINFGW* |
| Ga0137376_101410541 | 3300012208 | Vadose Zone Soil | MLEWKFRLVILLALAGVIAVCLGNFGGLVHNFGW* |
| Ga0150985_1045111422 | 3300012212 | Avena Fatua Rhizosphere | LTTFSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW* |
| Ga0150985_1175353422 | 3300012212 | Avena Fatua Rhizosphere | MLEWKFRLVILLALAGVFAVGLGNFGGLVHNFGW* |
| Ga0137370_100305272 | 3300012285 | Vadose Zone Soil | MLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW* |
| Ga0150984_1049050521 | 3300012469 | Avena Fatua Rhizosphere | FSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW* |
| Ga0150984_1088678981 | 3300012469 | Avena Fatua Rhizosphere | LTTFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW* |
| Ga0157308_103140961 | 3300012910 | Soil | MLEWKFRLVILLAFAGMTAAALGNLGGLIHNFSW* |
| Ga0137413_105904812 | 3300012924 | Vadose Zone Soil | MLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW* |
| Ga0164300_101068261 | 3300012951 | Soil | MLEWKFRLVILLALAGMTAAAFGNLGGLIHNFSW* |
| Ga0164300_103597182 | 3300012951 | Soil | MLEWKFRLVILLALAGVTAAALGNLGGLRHIYSR* |
| Ga0126369_113846311 | 3300012971 | Tropical Forest Soil | MLEWKFRLVILMAVAGMIAAAVGNLGWHPLNLGW* |
| Ga0126369_127809942 | 3300012971 | Tropical Forest Soil | MLEWKFRLVILLAVAAMVAAAFGNLGWQLLNLGW* |
| Ga0157370_114300521 | 3300013104 | Corn Rhizosphere | MLEWKFRLVILLALAGTIATALGNLGWHSMNLGW* |
| Ga0157374_129372162 | 3300013296 | Miscanthus Rhizosphere | MLEWKFRLVILLALAGVIAAGLGNRAGSLHVNFGW* |
| Ga0157372_107961712 | 3300013307 | Corn Rhizosphere | MLEWKFRLVILMALAGVVAAGLGNLAGSLHINFGW* |
| Ga0120132_10432972 | 3300013832 | Permafrost | MLEWKFRLVILLALACTVAVALGNLGWQPLNLGW* |
| Ga0132258_107183202 | 3300015371 | Arabidopsis Rhizosphere | MLEWKFRLVILLALAGMTAAAVGSLGGLFHNFSW* |
| Ga0132258_132233392 | 3300015371 | Arabidopsis Rhizosphere | GVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW* |
| Ga0187809_101419202 | 3300017937 | Freshwater Sediment | MLEWKFRLVGLLAVAGIIAAASGDLLGSLVHHNFGW |
| Ga0247669_10051722 | 3300024182 | Soil | MLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW |
| Ga0247687_10095291 | 3300024286 | Soil | MLEWKFRLVILMALAGVIAAGLGNLAGSLHINFGW |
| Ga0247690_10172801 | 3300024287 | Soil | GGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW |
| Ga0247666_10547341 | 3300024323 | Soil | PSGVLTTFSPGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW |
| Ga0207663_101945142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW |
| Ga0207663_107416921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PFREAAPTISESGVLDPTSPGGTMLEWKFRLVILLAVAGSVAAALGNLVTAHNFGW |
| Ga0207646_111738321 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTTFSPGGTMLEWKFRLVILLALAGVIAAGLGNLAGSLHVNFGW |
| Ga0207694_105108141 | 3300025924 | Corn Rhizosphere | PGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW |
| Ga0207700_105806032 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEWKSRLLILLSLAGILAASSGYIGGLVHINFGW |
| Ga0207664_105226111 | 3300025929 | Agricultural Soil | VPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW |
| Ga0207665_105841002 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEWKFRLVILLALAGVIAVGLGNFGGLVHFNFGW |
| Ga0207661_121689522 | 3300025944 | Corn Rhizosphere | GVLTTFSPGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW |
| Ga0207712_118649532 | 3300025961 | Switchgrass Rhizosphere | PTIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW |
| Ga0208142_10185091 | 3300025994 | Rice Paddy Soil | TYSPGGKMLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW |
| Ga0307503_104405342 | 3300028802 | Soil | FSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW |
| Ga0318568_102139941 | 3300031819 | Soil | FSPGGKMLEWKFRLVILSALACTIAVALGNLGWHPGNLGW |
| Ga0308175_1030590132 | 3300031938 | Soil | MLEWKFRLVILLAAAGVIAAAVGNLGCFLPLNFSW |
| Ga0308174_100023743 | 3300031939 | Soil | MLEWKFRLVVLLAVAGTVAAALGSLGCFLPLNFNW |
| Ga0318553_107122781 | 3300032068 | Soil | PGGTMLEWKFRLVILLALAATVAAAFGNLGWHCSNLGW |
| Ga0335069_101069252 | 3300032893 | Soil | MLEWKFRLVILLALAGVIAVGLGNFESLQHINFGW |
| Ga0247829_111833351 | 3300033550 | Soil | PSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW |
| ⦗Top⦘ |