| Basic Information | |
|---|---|
| Family ID | F071534 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VGQADDLPAIRPYERDLPDISNDVRQQAVETEKAIRERAK |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.52 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.689 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.770 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.475 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 22.95 |
| PF12838 | Fer4_7 | 22.95 |
| PF00436 | SSB | 9.84 |
| PF00326 | Peptidase_S9 | 4.92 |
| PF00877 | NLPC_P60 | 2.46 |
| PF14559 | TPR_19 | 1.64 |
| PF05746 | DALR_1 | 0.82 |
| PF06172 | Cupin_5 | 0.82 |
| PF03745 | DUF309 | 0.82 |
| PF00128 | Alpha-amylase | 0.82 |
| PF06782 | UPF0236 | 0.82 |
| PF00006 | ATP-synt_ab | 0.82 |
| PF01977 | UbiD | 0.82 |
| PF04405 | ScdA_N | 0.82 |
| PF01161 | PBP | 0.82 |
| PF12704 | MacB_PCD | 0.82 |
| PF01434 | Peptidase_M41 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 9.84 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 9.84 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 2.46 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.82 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.82 |
| COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.82 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.82 |
| COG2846 | Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domains | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.69 % |
| Unclassified | root | N/A | 21.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101342337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300001084|JGI12648J13191_1028694 | Not Available | 547 | Open in IMG/M |
| 3300001593|JGI12635J15846_10171676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1464 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100339799 | Not Available | 1383 | Open in IMG/M |
| 3300002562|JGI25382J37095_10269258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300004091|Ga0062387_101650122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300004092|Ga0062389_101763641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300004971|Ga0072324_1233632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300005174|Ga0066680_10313947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300005591|Ga0070761_10270002 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300005591|Ga0070761_10633334 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005602|Ga0070762_11182618 | Not Available | 529 | Open in IMG/M |
| 3300005891|Ga0075283_1073463 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006028|Ga0070717_10589751 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300006028|Ga0070717_10968280 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300006050|Ga0075028_100288012 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006052|Ga0075029_100793426 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006173|Ga0070716_101607584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300006174|Ga0075014_100903725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300006642|Ga0075521_10397661 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006755|Ga0079222_10280670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300006854|Ga0075425_101079134 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300006871|Ga0075434_101392084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300009089|Ga0099828_10073355 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300009521|Ga0116222_1243101 | Not Available | 776 | Open in IMG/M |
| 3300009525|Ga0116220_10121329 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300009672|Ga0116215_1200852 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009700|Ga0116217_10632487 | Not Available | 665 | Open in IMG/M |
| 3300009762|Ga0116130_1159482 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009824|Ga0116219_10384328 | Not Available | 784 | Open in IMG/M |
| 3300009839|Ga0116223_10519725 | Not Available | 692 | Open in IMG/M |
| 3300009839|Ga0116223_10592877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300010043|Ga0126380_10894819 | Not Available | 737 | Open in IMG/M |
| 3300010048|Ga0126373_10176166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2054 | Open in IMG/M |
| 3300010325|Ga0134064_10021139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1844 | Open in IMG/M |
| 3300010376|Ga0126381_101574433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300011064|Ga0138525_1012565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300011120|Ga0150983_14367616 | Not Available | 610 | Open in IMG/M |
| 3300011120|Ga0150983_15020508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300011120|Ga0150983_16103145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300011269|Ga0137392_10045550 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
| 3300011270|Ga0137391_10038183 | All Organisms → cellular organisms → Bacteria | 4062 | Open in IMG/M |
| 3300012207|Ga0137381_11118907 | Not Available | 677 | Open in IMG/M |
| 3300012210|Ga0137378_11499583 | Not Available | 585 | Open in IMG/M |
| 3300012989|Ga0164305_10441403 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300014164|Ga0181532_10069794 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300014657|Ga0181522_10146109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300016294|Ga0182041_10093002 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300017955|Ga0187817_10211484 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300017970|Ga0187783_10064207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2707 | Open in IMG/M |
| 3300017970|Ga0187783_10181723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300017970|Ga0187783_10880813 | Not Available | 645 | Open in IMG/M |
| 3300017974|Ga0187777_10059158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2472 | Open in IMG/M |
| 3300018006|Ga0187804_10578265 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018008|Ga0187888_1260224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300018017|Ga0187872_10009917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6036 | Open in IMG/M |
| 3300018038|Ga0187855_10040100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2957 | Open in IMG/M |
| 3300018042|Ga0187871_10037942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2969 | Open in IMG/M |
| 3300018086|Ga0187769_11265827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300019268|Ga0181514_1623650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300020582|Ga0210395_11314631 | Not Available | 529 | Open in IMG/M |
| 3300020583|Ga0210401_10363982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300021401|Ga0210393_11557314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300021402|Ga0210385_11012924 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021407|Ga0210383_10505644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300021420|Ga0210394_11302932 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021432|Ga0210384_11011970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300021433|Ga0210391_10890073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300021433|Ga0210391_10989640 | Not Available | 655 | Open in IMG/M |
| 3300021433|Ga0210391_11134034 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300021474|Ga0210390_11584419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021559|Ga0210409_10557742 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300022504|Ga0242642_1066829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300022522|Ga0242659_1066677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300022717|Ga0242661_1101429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300022724|Ga0242665_10168580 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300023259|Ga0224551_1103409 | Not Available | 504 | Open in IMG/M |
| 3300025898|Ga0207692_10393432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300025928|Ga0207700_10970624 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300025929|Ga0207664_11986627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300026323|Ga0209472_1116783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300026524|Ga0209690_1078429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300027370|Ga0209010_1092990 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027505|Ga0209218_1101736 | Not Available | 601 | Open in IMG/M |
| 3300027698|Ga0209446_1188647 | Not Available | 531 | Open in IMG/M |
| 3300027706|Ga0209581_1162590 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300027853|Ga0209274_10510335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300027884|Ga0209275_10837928 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027905|Ga0209415_10216901 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300027905|Ga0209415_10829551 | Not Available | 639 | Open in IMG/M |
| 3300028015|Ga0265353_1028659 | Not Available | 554 | Open in IMG/M |
| 3300028785|Ga0302201_10226062 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300028882|Ga0302154_10344076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300029908|Ga0311341_10449556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300030044|Ga0302281_10313229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300030058|Ga0302179_10511232 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300030399|Ga0311353_10106399 | All Organisms → cellular organisms → Bacteria | 2723 | Open in IMG/M |
| 3300030580|Ga0311355_10631647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300030659|Ga0316363_10197053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300030659|Ga0316363_10224841 | Not Available | 772 | Open in IMG/M |
| 3300030760|Ga0265762_1100697 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031122|Ga0170822_10359519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031231|Ga0170824_104371044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300031231|Ga0170824_124697893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031474|Ga0170818_107413569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300031708|Ga0310686_116542541 | Not Available | 622 | Open in IMG/M |
| 3300031720|Ga0307469_11225524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300031753|Ga0307477_10915136 | Not Available | 578 | Open in IMG/M |
| 3300031820|Ga0307473_11447729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031823|Ga0307478_10248723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
| 3300031912|Ga0306921_11648410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300032001|Ga0306922_12026327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300032160|Ga0311301_11574062 | Not Available | 802 | Open in IMG/M |
| 3300032180|Ga0307471_100147778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2253 | Open in IMG/M |
| 3300032515|Ga0348332_11004445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032770|Ga0335085_11372266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300032783|Ga0335079_12218172 | Not Available | 523 | Open in IMG/M |
| 3300032892|Ga0335081_10009749 | All Organisms → cellular organisms → Bacteria | 15477 | Open in IMG/M |
| 3300032896|Ga0335075_11597529 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032898|Ga0335072_10755483 | Not Available | 939 | Open in IMG/M |
| 3300032898|Ga0335072_10964131 | Not Available | 788 | Open in IMG/M |
| 3300033405|Ga0326727_11143195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.11% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.28% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.46% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013423372 | 3300000364 | Soil | LIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIHARAR* |
| JGI12648J13191_10286941 | 3300001084 | Forest Soil | QLDDLPAIRPYERDLPDISNDVRQQALETERAIHERTSK* |
| JGI12635J15846_101716761 | 3300001593 | Forest Soil | GQPDDIPAILPYERDLPDIPVHVRQQALETEKAIRAREK* |
| JGIcombinedJ26739_1003397991 | 3300002245 | Forest Soil | YLIGQPDDLPAIRPYERNLPDVSNNVRQQAIETEQAIRKRSGS* |
| JGI25382J37095_102692581 | 3300002562 | Grasslands Soil | LYLIGKPEDIPAIQSYERDLPDIPEHVREQAAETERAIRQRGK* |
| Ga0062387_1016501221 | 3300004091 | Bog Forest Soil | ALYLIGQSEDLPAIRRYERDVPEVSNDVRQQAVETEKAIVQRSQH* |
| Ga0062389_1017636411 | 3300004092 | Bog Forest Soil | LIGQPDDLPAIRPYQRDLADISNDVRQQAMETEQAIKKRSGQ* |
| Ga0072324_12336323 | 3300004971 | Peatlands Soil | QVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQSRAGAH* |
| Ga0066680_103139471 | 3300005174 | Soil | LIGQLEDLPAIQPYERSLPDIPERVKQQAVLAEKAIRERAK* |
| Ga0070761_102700021 | 3300005591 | Soil | RALYLIGQLEDLPAILPYERDLPDISTDVRQQAIETENAIRSREAH* |
| Ga0070761_106333341 | 3300005591 | Soil | RALYLIGQPDDLSAIRPYERDLPDISNDVRQQAVESEQAIRNRTSK* |
| Ga0070762_111826182 | 3300005602 | Soil | LDDLSAIRPYERDLPDISNDVRQQAEQTEKAIRTRAGTPTTTAQ* |
| Ga0075283_10734632 | 3300005891 | Rice Paddy Soil | DLPAVTPYERDVPEISAQVRQQATETEKAIRQRARL* |
| Ga0070717_105897513 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIQARVK* |
| Ga0070717_109682803 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GQADDLAAIRPYERDVPDVSNDVRQQAQETERAIRGRTSVH* |
| Ga0075028_1002880123 | 3300006050 | Watersheds | LYLIGQPEDLDAIRPYERDLPDISNAVRQQASETEQAIRKRAGLN* |
| Ga0075029_1007934262 | 3300006052 | Watersheds | AVRPYERELPDVSNDVRQQALETDKAIRARAGVN* |
| Ga0070716_1016075841 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RALYLVGLPEDLDAIRPYQRDLPSISNDVRKQAVEAEKAIQARAAK* |
| Ga0075014_1009037252 | 3300006174 | Watersheds | YIVGQIDDLPAIRMYERDLPDISNDVRKQALETEKAIRARAG* |
| Ga0075521_103976611 | 3300006642 | Arctic Peat Soil | LYLVGQVDDLAAIRPYERDLPDISNDVRQQAQETEKAIRDRSANK* |
| Ga0079222_102806701 | 3300006755 | Agricultural Soil | ALRALYIIGQPDDLPAVRRYERDLPDISNDIRQQALETEKAIQNRVVPAQP* |
| Ga0075425_1010791341 | 3300006854 | Populus Rhizosphere | PAIRPYQRELPEIPDHVRKQAVETEQAIRRRVPGPL* |
| Ga0075434_1013920842 | 3300006871 | Populus Rhizosphere | LYVIGQPDDLNAVLPYQRDLPNISNDIRQQAMETEKAIRSRAAAAQP* |
| Ga0099828_100733556 | 3300009089 | Vadose Zone Soil | VVGQPDELAAISPYARELRDISNDVRQEAVETEKAILGRAK* |
| Ga0116222_12431011 | 3300009521 | Peatlands Soil | QVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN* |
| Ga0116220_101213291 | 3300009525 | Peatlands Soil | VGQADDLPAIRPYERDLPDISNDVRQQAVETEKAIRERAK* |
| Ga0116215_12008521 | 3300009672 | Peatlands Soil | DLPAIRPYERDLPDISNDVRRQAVETEKAIQSRNQH* |
| Ga0116217_106324872 | 3300009700 | Peatlands Soil | YLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN* |
| Ga0116130_11594822 | 3300009762 | Peatland | IGQPDDLSAIQPYERDLPDISNDVRQQAVETEKAIRARMK* |
| Ga0116219_103843282 | 3300009824 | Peatlands Soil | ALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN* |
| Ga0116223_105197251 | 3300009839 | Peatlands Soil | RALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN* |
| Ga0116223_105928771 | 3300009839 | Peatlands Soil | RALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQSRAGAH* |
| Ga0126380_108948191 | 3300010043 | Tropical Forest Soil | LPAIRPYERDLADVSNDVRQQAQQTEKAIQSRAQ* |
| Ga0126373_101761663 | 3300010048 | Tropical Forest Soil | PDDLAAVRPYERDLPDISNDVRLQATDTEKAIRERTDAQSSPDATR* |
| Ga0134064_100211394 | 3300010325 | Grasslands Soil | QADDIPAINPYERDLPDIPEHVREQAAETERAIRQRGK* |
| Ga0126381_1015744331 | 3300010376 | Tropical Forest Soil | GQPDDLSAVLRYQRDLPNISNDIRQQAIETEKAIRSRAAPAQP* |
| Ga0138525_10125652 | 3300011064 | Peatlands Soil | ALRALYVVGQLDDLAAIRPYERDLPDVSNDMRQQAVETEKAIQSRAK* |
| Ga0150983_143676161 | 3300011120 | Forest Soil | AIRPYERDLADISNDVRQQAVETEQAIEKRSGSQ* |
| Ga0150983_150205082 | 3300011120 | Forest Soil | VVGQMDDLAAVRPYERELPEISNDVRLQAAATEKAIRSRAGVD* |
| Ga0150983_161031452 | 3300011120 | Forest Soil | RALYLVGQPDDIAAVLPYERESPDIPDHVRQQAVETVRAIRLREEAVD* |
| Ga0137392_100455501 | 3300011269 | Vadose Zone Soil | LIGQPDDLAAIRPYERDLPDVSNDVRRQAQETEQAIRKRSGS* |
| Ga0137391_100381834 | 3300011270 | Vadose Zone Soil | QPDDLAAIRPYERDLPDVSNDVRRQAHETEQAIRKRSGS* |
| Ga0137381_111189071 | 3300012207 | Vadose Zone Soil | IVGQMDDLTAIRPYERDLPDISNDVRQQAAETEKAIQTRSTATNK* |
| Ga0137378_114995831 | 3300012210 | Vadose Zone Soil | LYLVGQIGDLAAIQPYERDLPDISNNVRQQALETEKAIRARAGVN* |
| Ga0164305_104414033 | 3300012989 | Soil | LYLIGQPEDISSIQPYERDLPDVSNDVRQQAEQTEKAIRARSEN* |
| Ga0181532_100697941 | 3300014164 | Bog | IEDLPAIVPYERDLPDISNDVRQQAAETEKAIRERAK* |
| Ga0181522_101461091 | 3300014657 | Bog | DLPAIRPYERDLPDISNDVRQQAQETEKAIQLRGK* |
| Ga0182041_100930025 | 3300016294 | Soil | YLVGQPEDIAAILPYERDLPDTPDQVRQQAVETEKAIRDREK |
| Ga0187817_102114843 | 3300017955 | Freshwater Sediment | ALYLVGQVDDLAAIRPYERDLPDISNDVRQQAQETEKAIQGRNQN |
| Ga0187783_100642072 | 3300017970 | Tropical Peatland | LYLVGQPEDIAAILPYERDLPDTSDRVRQQAIETEKAIRERDK |
| Ga0187783_101817231 | 3300017970 | Tropical Peatland | LIGQPEDIPAILPYERELLDISDDVRKQAAETERAIRERTK |
| Ga0187783_108808132 | 3300017970 | Tropical Peatland | RALYLIGQPDDLAAIRPYQRDLPDISNDVRQQAMETEQAIRRRDSR |
| Ga0187777_100591583 | 3300017974 | Tropical Peatland | EDIAAILPYERDLPDTPDQVRQQAIETEKAIRDREK |
| Ga0187804_105782651 | 3300018006 | Freshwater Sediment | PEDLPAIRSYQRDLPDISNDIRQQAVETEKSINNRATAPPK |
| Ga0187888_12602241 | 3300018008 | Peatland | LRALYLIGQPDDLAAIRPYERDLADISNDVRQQAAETERAIQQRAK |
| Ga0187872_100099171 | 3300018017 | Peatland | YLVGQMDNLAAIRPYERNLPNIPDHVRQQALETEKAIRTRASMN |
| Ga0187855_100401001 | 3300018038 | Peatland | LYLVGQIDDLAAVLPYERDLPDISNDVRQQAVETEKAIRQRAKS |
| Ga0187871_100379421 | 3300018042 | Peatland | GQPEDLPAILPYERDLPDISTDVRQQAIETEKAIRSR |
| Ga0187769_112658272 | 3300018086 | Tropical Peatland | DIAAVQPFERELPDISNDVRQQAIETERAIRDRSH |
| Ga0181514_16236502 | 3300019268 | Peatland | VGQLDDLAAIRPYERDLPDISNDVRQQAVETEKAIVARAGSN |
| Ga0210395_113146312 | 3300020582 | Soil | DDLPAIRLYQRDLPDVSNDVRQQAMETEKAIRARTGSN |
| Ga0210401_103639821 | 3300020583 | Soil | LVGQSDDLAAVRPYERDLPDISNDVRQQALETEKAIRGRSLAPSDK |
| Ga0210393_115573142 | 3300021401 | Soil | LIGQPDDIPAIRSYERDLPDVSNDVRQQALETEQAIRKRSGS |
| Ga0210385_110129242 | 3300021402 | Soil | ALYLIGQPEDIAAVSPYERELPDISNDVRNQAVETEKAIRQRER |
| Ga0210383_105056444 | 3300021407 | Soil | RALYVVGQIDDLPAIRPYERDLPDISNDVRQQASETERAIQARNQR |
| Ga0210394_113029321 | 3300021420 | Soil | TDDLPAIRPYERDLPDVSSDVRRQAAETEQAIQKRSGS |
| Ga0210384_110119701 | 3300021432 | Soil | RALYLVGQPDDLSAIRPYERDLPDISNDVRQQALETDKAIRARAQVVEDRN |
| Ga0210391_108900732 | 3300021433 | Soil | FDDLPAIRPYERDLPDISNDVRQQAAETEKAIRKRSGE |
| Ga0210391_109896402 | 3300021433 | Soil | DLAAIRPYERELPEISNDVRQQAVETEKAIRTRADKNGPS |
| Ga0210391_111340342 | 3300021433 | Soil | LYVVGQRDDLTAVLPYERDLPGISNDVRQQALETEKAIRARAEKNGPS |
| Ga0210390_115844192 | 3300021474 | Soil | RALYLVGQINDLPAIRPYERDLPDISNDVRQQAVETEKAIQNRNQH |
| Ga0210409_105577422 | 3300021559 | Soil | LPAIRPYERDLSDISNDVRQQAVETEQAIRKRSGS |
| Ga0242642_10668291 | 3300022504 | Soil | GQPDDLPAIRPYERDLPDISNDVRHQAAETEKAIQTRSAAPNK |
| Ga0242659_10666772 | 3300022522 | Soil | YLVGEAEDIPSVLPYERELPDISNDVREQATITERAIRERTK |
| Ga0242661_11014292 | 3300022717 | Soil | EDIPSVLPYERELPDISNDVREQATITERAIRERTK |
| Ga0242665_101685801 | 3300022724 | Soil | YLIGQPEDIAAVSPYERELPDVSNDVRLQAMETEKAIRQRER |
| Ga0224551_11034092 | 3300023259 | Soil | DDLPAILPYERDLPDISNDVRQQAAEAERAIRERVK |
| Ga0207692_103934323 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPYERDLPNISNDIRQQAVETDKAIRNRVVPAQP |
| Ga0207700_109706241 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIQARVK |
| Ga0207664_119866272 | 3300025929 | Agricultural Soil | VIGQPDDLAAVLPYERDLPNVSNDIRQQAVETEKAIRSRVAPAQP |
| Ga0209472_11167831 | 3300026323 | Soil | GQPEDIPAIQPYERDLPDIPEHVREQAVATEKAIRDRAK |
| Ga0209690_10784291 | 3300026524 | Soil | ALYLIGQADDIPAINPYERDLPDIPEHVREQAAETDRAIRQRGK |
| Ga0209010_10929902 | 3300027370 | Forest Soil | IGQLEDLPAILPYERDLPDISTDVRQQAIETENAIRSREAH |
| Ga0209218_11017361 | 3300027505 | Forest Soil | IGQLDDIPAIRPYERDLPDISNDVRQQAQETEKAIQQRAGAPTATR |
| Ga0209446_11886471 | 3300027698 | Bog Forest Soil | IGQPEDIAAVSPYERELPDISNDVRKQAMETEKAIRQRER |
| Ga0209581_11625903 | 3300027706 | Surface Soil | YIVGQMDDLAAIRPYERDVPDVSNDVRQQAVETEKAIRARASAN |
| Ga0209274_105103351 | 3300027853 | Soil | IDDLAAIRPYERDLPDISNDVRQQATETEKAILQRAKQ |
| Ga0209275_108379281 | 3300027884 | Soil | ALYLVGQPEDTAAVLPYERELPEISNDVRKQAIETDKAIRKRANPSASD |
| Ga0209415_102169013 | 3300027905 | Peatlands Soil | IGQPDDLPAIRPYERDLPDISNDVRQQAVEAEQAIRKRSGS |
| Ga0209415_108295511 | 3300027905 | Peatlands Soil | LPRIRPYELDLPDISNDVRRQAVETEKAIQGRYQH |
| Ga0265353_10286591 | 3300028015 | Soil | RALYLIGRLDDLSAIRPYERDLPDISNDVRQQAEETEKAIRTRAGTPTTTAQ |
| Ga0302201_102260621 | 3300028785 | Bog | PDDLSAIRPYERDLPDVSNDVRQQAAATEEAIRKRSGS |
| Ga0302154_103440761 | 3300028882 | Bog | ALYLIGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK |
| Ga0311341_104495562 | 3300029908 | Bog | IGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK |
| Ga0302281_103132291 | 3300030044 | Fen | LIGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK |
| Ga0302179_105112321 | 3300030058 | Palsa | IGQPDDLPAIRPYQRDLPDISNDVRQQAVETEQAIRSRDSR |
| Ga0311353_101063991 | 3300030399 | Palsa | GQLDDLPAIRPYERDLPDISNDVRQQAQETEKAIQLRAK |
| Ga0311355_106316471 | 3300030580 | Palsa | DIPAIRPYERDLPDISNDVRQQAQETEKAIQQRAK |
| Ga0316363_101970532 | 3300030659 | Peatlands Soil | DIAAVSRYERELPDISNDERNQAIETEKAIRDRTK |
| Ga0316363_102248411 | 3300030659 | Peatlands Soil | GQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN |
| Ga0265762_11006972 | 3300030760 | Soil | QLEDLPAILPYERDLPDISTDSRQQAIETENAIRSREAH |
| Ga0170822_103595191 | 3300031122 | Forest Soil | LIGQPEDIAAVSPFEREVPDISNDVRNQAIETEKAIRERTK |
| Ga0170824_1043710442 | 3300031231 | Forest Soil | LRALYIVGQLDDLTAIRPYERDLPDVSNDVRQQAAETEKAIQARSAGSANKERN |
| Ga0170824_1246978932 | 3300031231 | Forest Soil | YIVGQVDDLAAIRPYERDLPDISNDVRQQAAETEKAIRARAGVS |
| Ga0170818_1074135693 | 3300031474 | Forest Soil | VGQIDDLTAVLPYERDLPGISNDVHQQAQETEKAIRDRSTSK |
| Ga0310686_1165425412 | 3300031708 | Soil | LPAIRPYERDLPDISNDVRQQAAETEQAIQKRSGS |
| Ga0307469_112255242 | 3300031720 | Hardwood Forest Soil | GHPEDLSAIRPYERDVPDVSNDVRQQAQETEKAIQKRSASSD |
| Ga0307477_109151362 | 3300031753 | Hardwood Forest Soil | DDLPAIRPYERDVPDVSNDVRRQAQETEKAIQARAR |
| Ga0307473_114477291 | 3300031820 | Hardwood Forest Soil | DLIMIQRYERDSPQISDRVRQQAALTEKAIRKRSAEQP |
| Ga0307478_102487231 | 3300031823 | Hardwood Forest Soil | PDDLPSVRPYERDVPEVSNDVRQQAQETEKAISKRAAPPS |
| Ga0306921_116484102 | 3300031912 | Soil | RYLVGQPEDIAAILPYERDLPDTPDQVRQQAVETEKAIRDREK |
| Ga0306922_120263271 | 3300032001 | Soil | DLSAIRPYRRDLPDVSSRVRQQASLTESAIRERANKEP |
| Ga0311301_115740621 | 3300032160 | Peatlands Soil | LRALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN |
| Ga0307471_1001477781 | 3300032180 | Hardwood Forest Soil | RALYLVGQWDDIPAILPYERELPEISDRVRQQALSTENAIRSGAAKVP |
| Ga0348332_110044451 | 3300032515 | Plant Litter | DIRAVSPFEREVPDISNDVRNQAIETEKAIRERTK |
| Ga0335085_113722661 | 3300032770 | Soil | YLIGQAEDLQAIRPYERDVPDVSNDVRQQAQETEKAIEARRDK |
| Ga0335079_122181721 | 3300032783 | Soil | PQDLDTIRPYERDVPDVSNDVRQQALETEKAIQARAK |
| Ga0335081_100097491 | 3300032892 | Soil | LQAVRPYERDLPDISNDVRQQAQETEKAIQLKSNH |
| Ga0335075_115975291 | 3300032896 | Soil | PDDLQAVRAYERDLPDISKDVRQQALETDQAIRRRAGTS |
| Ga0335072_107554833 | 3300032898 | Soil | DDLAVVRPYERELPDISNDVRQQALETDKAIRARAGMS |
| Ga0335072_109641311 | 3300032898 | Soil | GQPEDVAAIRPYERELPEISQRVRQQALDTEKAIQQRNR |
| Ga0326727_111431952 | 3300033405 | Peat Soil | QVDDLSAVRPYERDLPDVPNDVRQQAVETEKAIRARAK |
| ⦗Top⦘ |