| Basic Information | |
|---|---|
| Family ID | F071516 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTL |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.38 % |
| % of genes near scaffold ends (potentially truncated) | 92.62 % |
| % of genes from short scaffolds (< 2000 bps) | 95.90 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.082 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (13.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.230 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.344 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF05717 | TnpB_IS66 | 77.05 |
| PF01527 | HTH_Tnp_1 | 11.48 |
| PF13817 | DDE_Tnp_IS66_C | 1.64 |
| PF13408 | Zn_ribbon_recom | 0.82 |
| PF00891 | Methyltransf_2 | 0.82 |
| PF13340 | DUF4096 | 0.82 |
| PF01609 | DDE_Tnp_1 | 0.82 |
| PF13007 | LZ_Tnp_IS66 | 0.82 |
| PF01526 | DDE_Tnp_Tn3 | 0.82 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.82 |
| PF00753 | Lactamase_B | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 77.05 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.82 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.82 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.82 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.82 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.08 % |
| Unclassified | root | N/A | 4.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10403532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300001867|JGI12627J18819_10096660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1221 | Open in IMG/M |
| 3300004081|Ga0063454_102015273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300004082|Ga0062384_100575107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300004153|Ga0063455_100075829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1280 | Open in IMG/M |
| 3300005093|Ga0062594_102049622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300005187|Ga0066675_11129398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300005327|Ga0070658_11609674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300005328|Ga0070676_10723930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300005329|Ga0070683_100926976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300005332|Ga0066388_101029431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1383 | Open in IMG/M |
| 3300005437|Ga0070710_10638338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300005542|Ga0070732_10280979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300005568|Ga0066703_10726337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300005602|Ga0070762_10500710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 796 | Open in IMG/M |
| 3300005602|Ga0070762_10835431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
| 3300006028|Ga0070717_11411371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300006047|Ga0075024_100045205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1829 | Open in IMG/M |
| 3300006047|Ga0075024_100143907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300006052|Ga0075029_100973375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300006174|Ga0075014_100604489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300006176|Ga0070765_100652812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 993 | Open in IMG/M |
| 3300006237|Ga0097621_102215660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300009144|Ga0058702_10252593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300009500|Ga0116229_10313743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1322 | Open in IMG/M |
| 3300009709|Ga0116227_11151315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300010339|Ga0074046_10823107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300010341|Ga0074045_10438876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300010341|Ga0074045_10612209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300010343|Ga0074044_10037944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. SK-3 | 3355 | Open in IMG/M |
| 3300010343|Ga0074044_10039115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3300 | Open in IMG/M |
| 3300010371|Ga0134125_11075172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300010373|Ga0134128_10512529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1337 | Open in IMG/M |
| 3300010395|Ga0058701_10782668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300011119|Ga0105246_11250226 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012498|Ga0157345_1030875 | Not Available | 600 | Open in IMG/M |
| 3300012509|Ga0157334_1056665 | Not Available | 555 | Open in IMG/M |
| 3300012683|Ga0137398_10906329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300012957|Ga0164303_11227666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300012960|Ga0164301_11545237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300012984|Ga0164309_10840631 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300013308|Ga0157375_11150447 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300014745|Ga0157377_10810577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300015372|Ga0132256_100109327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2707 | Open in IMG/M |
| 3300015374|Ga0132255_105668877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300017656|Ga0134112_10270372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300018067|Ga0184611_1177938 | Not Available | 756 | Open in IMG/M |
| 3300018072|Ga0184635_10274966 | Not Available | 665 | Open in IMG/M |
| 3300020582|Ga0210395_10278607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1257 | Open in IMG/M |
| 3300020583|Ga0210401_11454689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300021078|Ga0210381_10109692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300021086|Ga0179596_10342458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300021171|Ga0210405_10300238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1269 | Open in IMG/M |
| 3300021180|Ga0210396_10967059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300021377|Ga0213874_10126382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
| 3300021441|Ga0213871_10040723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300021441|Ga0213871_10171966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300021444|Ga0213878_10052837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1589 | Open in IMG/M |
| 3300025878|Ga0209584_10037375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1693 | Open in IMG/M |
| 3300025914|Ga0207671_10307365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1253 | Open in IMG/M |
| 3300025915|Ga0207693_10353165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1150 | Open in IMG/M |
| 3300025941|Ga0207711_11587371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300025944|Ga0207661_11068056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300026023|Ga0207677_10863911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300026121|Ga0207683_10791368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300026142|Ga0207698_11821347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300027097|Ga0208861_101026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300027257|Ga0208996_1059832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300028268|Ga0255348_1067723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300028566|Ga0302147_10333037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300028574|Ga0302153_10124643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 880 | Open in IMG/M |
| 3300028665|Ga0302160_10045866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300028747|Ga0302219_10321358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300028748|Ga0302156_10130483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
| 3300028778|Ga0307288_10114840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 991 | Open in IMG/M |
| 3300028813|Ga0302157_10151753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1376 | Open in IMG/M |
| 3300029636|Ga0222749_10321653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300029911|Ga0311361_10447508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1322 | Open in IMG/M |
| 3300029913|Ga0311362_10434552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
| 3300029915|Ga0311358_10330623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1272 | Open in IMG/M |
| 3300029920|Ga0302142_1188347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300029922|Ga0311363_11159823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300029954|Ga0311331_11601193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300029956|Ga0302150_10019112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2734 | Open in IMG/M |
| 3300029984|Ga0311332_10368485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300029990|Ga0311336_10786351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300029992|Ga0302276_10137784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300030020|Ga0311344_10375889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1319 | Open in IMG/M |
| 3300030020|Ga0311344_10390696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1284 | Open in IMG/M |
| 3300030688|Ga0311345_10331126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1415 | Open in IMG/M |
| 3300030740|Ga0265460_10941461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300030743|Ga0265461_13202528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300031057|Ga0170834_108775484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1304 | Open in IMG/M |
| 3300031092|Ga0308204_10365054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031231|Ga0170824_123223028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300031261|Ga0302140_11134017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300031469|Ga0170819_13698846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031472|Ga0272437_1024905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5906 | Open in IMG/M |
| 3300031472|Ga0272437_1306950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300031474|Ga0170818_114991683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300031520|Ga0272428_1159283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300031524|Ga0302320_10613411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1267 | Open in IMG/M |
| 3300031708|Ga0310686_104101566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1372 | Open in IMG/M |
| 3300031708|Ga0310686_116698474 | Not Available | 850 | Open in IMG/M |
| 3300031880|Ga0318544_10416295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300031938|Ga0308175_102499620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 578 | Open in IMG/M |
| 3300031996|Ga0308176_12074433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300032008|Ga0318562_10460889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300032008|Ga0318562_10687022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300032059|Ga0318533_11350581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300032063|Ga0318504_10131037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
| 3300032074|Ga0308173_12234279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300032829|Ga0335070_11655950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300033168|Ga0272423_1162868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
| 3300033168|Ga0272423_1165192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1034 | Open in IMG/M |
| 3300033402|Ga0326728_10234173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1779 | Open in IMG/M |
| 3300034127|Ga0370489_0091149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300034129|Ga0370493_0107197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300034159|Ga0370509_0324384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300034163|Ga0370515_0127883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium multivorum | 1092 | Open in IMG/M |
| 3300034196|Ga0370503_0089140 | Not Available | 1040 | Open in IMG/M |
| 3300034691|Ga0370488_189626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 13.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 4.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 4.10% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 4.10% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.28% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.64% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.64% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027097 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF019 (SPAdes) | Environmental | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| 3300034691 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_104035321 | 3300001661 | Forest Soil | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIH |
| JGI12627J18819_100966604 | 3300001867 | Forest Soil | MSLATEPLPANPSVLRIFAADLQAELARKDIEIAANAAEI |
| Ga0063454_1020152731 | 3300004081 | Soil | LVHSGMSLASIPLPSDPTALRAFAAGLQAELARKELEIAANAAEIHAKTLHIEK |
| Ga0062384_1005751073 | 3300004082 | Bog Forest Soil | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKTLHI |
| Ga0063455_1000758293 | 3300004153 | Soil | MFLANQPLPADPEALRAFAADLQAELARKDIELAANAAEIHAKTLHIEKL |
| Ga0062594_1020496221 | 3300005093 | Soil | VSLANHPLPADPSALRVFAADLQAELARKNIELERKTIEIAANAAEIHAKTLHIEKLKM |
| Ga0066675_111293982 | 3300005187 | Soil | MSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLK |
| Ga0070658_116096741 | 3300005327 | Corn Rhizosphere | MSLASMALPSDPAALRALAAGLQAELARKELEIAANAAEIH |
| Ga0070676_107239303 | 3300005328 | Miscanthus Rhizosphere | LANHPLPADPSALRVFAADLQAELARKNIELAANAAEIHAKALHI |
| Ga0070683_1009269761 | 3300005329 | Corn Rhizosphere | MSLASDALPTDPQELRQFAVSLQAELARKEIELAANAAEIHAKTLH |
| Ga0066388_1010294314 | 3300005332 | Tropical Forest Soil | MSLATDPLPTNPSALRIFAADLQAELARKDIEIAANAAEIHA |
| Ga0070710_106383383 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLK |
| Ga0070732_102809791 | 3300005542 | Surface Soil | MSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEI |
| Ga0066703_107263372 | 3300005568 | Soil | MSLAHQPLPVDPQALQLFAADLQAELARKEIELAAN |
| Ga0070762_105007103 | 3300005602 | Soil | MSLATEPLPANPSVLRIFAADLQAELARKDIEIAANADEIHAKTLHIEKLKM |
| Ga0070762_108354313 | 3300005602 | Soil | MSLVNTPLPADPEALRRFAASLQAELARKDIEIAAH |
| Ga0070717_114113711 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLASLPLPSDPAALRALAAGLQAELARKELEIAANAA |
| Ga0075024_1000452052 | 3300006047 | Watersheds | MSLATQPLPDDPTALRNFAVDLQAELARKDIEIAANAAEIHAKTLVSAQPG* |
| Ga0075024_1001439071 | 3300006047 | Watersheds | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKTL |
| Ga0075029_1009733751 | 3300006052 | Watersheds | MSLATDPLPANPSALRIFAADLQAELARKDIEIAANAAEIHAK |
| Ga0075014_1006044893 | 3300006174 | Watersheds | VSLANSPLPSDPLALRIFAADLQAELARKDIELAANAAEI |
| Ga0070765_1006528121 | 3300006176 | Soil | MSLANSPLPPDPEALRSFAVDLQAELARKEIELAANAAEIYAKTLHIEKL |
| Ga0097621_1022156601 | 3300006237 | Miscanthus Rhizosphere | MSLATDPLPASPSALRIFAADLQAELARKDIEIAANA |
| Ga0058702_102525933 | 3300009144 | Agave | MFLATHPLPADPAELRSFAVSLRAELARKDLELAAN |
| Ga0116229_103137434 | 3300009500 | Host-Associated | MSLASAPLPTDPDALRLFAAGLQAELARKELEIAANAAEIHAKTLHIEKL |
| Ga0116227_111513151 | 3300009709 | Host-Associated | MSLATHPLPTDPAELRRFAVGLQAELARKEIELAANAAEIHAKTLH |
| Ga0074046_108231071 | 3300010339 | Bog Forest Soil | MSLAHHPLPTDPLALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLKMQ |
| Ga0074045_104388764 | 3300010341 | Bog Forest Soil | MSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKL |
| Ga0074045_106122093 | 3300010341 | Bog Forest Soil | MSLAHHPLPSDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKL |
| Ga0074044_100379446 | 3300010343 | Bog Forest Soil | MSLAHHPLPTDPQTLHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLK |
| Ga0074044_100391153 | 3300010343 | Bog Forest Soil | MSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIE |
| Ga0134125_110751722 | 3300010371 | Terrestrial Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTRS* |
| Ga0134128_105125294 | 3300010373 | Terrestrial Soil | MSLASMALPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTL |
| Ga0058701_107826682 | 3300010395 | Agave | VSLANHPLPTDLSALRSFAADLQAELARKTIELERKTIEIAANAADPRQDAAH* |
| Ga0105246_112502263 | 3300011119 | Miscanthus Rhizosphere | MSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTLHIEKL |
| Ga0157345_10308751 | 3300012498 | Arabidopsis Rhizosphere | MSLASDPLPTDPEALRQFAAGLQTELARKEIEIAA |
| Ga0157334_10566651 | 3300012509 | Soil | MSLASDPLPTDPEALRQFAAGLQTELARKEIEIAANAA |
| Ga0137398_109063291 | 3300012683 | Vadose Zone Soil | MSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTLHIEKLKMQL |
| Ga0164303_112276661 | 3300012957 | Soil | MSLATLPLPDDPTALRDLAVDLQAELARKEIEIAANAAEIHAK |
| Ga0164301_115452372 | 3300012960 | Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHA |
| Ga0164309_108406313 | 3300012984 | Soil | MSLASLPLRDDPDALRAFATGLQAELARRDIEITARDA |
| Ga0157375_111504473 | 3300013308 | Miscanthus Rhizosphere | MHPLPADPAELRSFAVSLQAELARKDLELAANAAEIHA |
| Ga0157377_108105771 | 3300014745 | Miscanthus Rhizosphere | MSLATLPLPDDPTALRDLAVDLQAELACKDIEIAANAAEIHAKTLHIEKLKMQLA |
| Ga0132256_1001093274 | 3300015372 | Arabidopsis Rhizosphere | MSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTLHIEKLK |
| Ga0132255_1056688771 | 3300015374 | Arabidopsis Rhizosphere | MSLATLQLPDDPTALRNLAVDLQAELARKDIEIAANAAEIYAK |
| Ga0134112_102703721 | 3300017656 | Grasslands Soil | MSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIY |
| Ga0184611_11779382 | 3300018067 | Groundwater Sediment | DDPTALRNLAVGLQAELARKDIEIAANAAEIHAKSKRSPCHV |
| Ga0184635_102749661 | 3300018072 | Groundwater Sediment | LPLTDDPTALRNLAVGLQAELARKDIEIAANAAEIHAKSKRSPCHV |
| Ga0210395_102786074 | 3300020582 | Soil | MSLATEPLPANPSVLRIFAADLQAELARKDIEIAANAAEIHAKTLHI |
| Ga0210401_114546892 | 3300020583 | Soil | MSLATDPLPANPSALRIFAADLRAELARKDIEVAANSAEIP |
| Ga0210381_101096923 | 3300021078 | Groundwater Sediment | MSLANLPLPDDPTALRNLAVDLQAELARKDIEIAANAAEIHAKTLH |
| Ga0179596_103424583 | 3300021086 | Vadose Zone Soil | MSLAILPLPDDPSALRSFAVDLQAELARKDIEIAANAA |
| Ga0210405_103002384 | 3300021171 | Soil | MSLATLPLPDDPTALRSFAVDLQAELARRDIEIAANAA |
| Ga0210396_109670591 | 3300021180 | Soil | MSLATEPLPANPSALRIFAADLQAELARKDIEIAANA |
| Ga0213874_101263821 | 3300021377 | Plant Roots | MSLASAPLPTDPEALRVFAANLQAELARKDLEIAANAAEIH |
| Ga0213871_100407231 | 3300021441 | Rhizosphere | MSLAHQPLPADPQALQLFAADLQAELARKEIELAANAAEIYAKTLHIE |
| Ga0213871_101719663 | 3300021441 | Rhizosphere | MSLASMPLPSDPTALRALAAGLQAELARKELEIAAN |
| Ga0213878_100528372 | 3300021444 | Bulk Soil | MSLASVPLPDDPTALRVLAASLQAELARKDMEMQKS |
| Ga0209584_100373754 | 3300025878 | Arctic Peat Soil | MSLVNSPLPTDPQALRSFAADLQAELARKDIEIAANAAEIHAKTLHIEQ |
| Ga0207671_103073651 | 3300025914 | Corn Rhizosphere | VSLANHPLPADPSALRVFAADLQAELARKNIELERKT |
| Ga0207693_103531653 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTL |
| Ga0207711_115873712 | 3300025941 | Switchgrass Rhizosphere | MSLATDPLPASPSALRIFAADLQAELARKDIEIAASAAEIHAKALHIEKLKMQLAV |
| Ga0207661_110680561 | 3300025944 | Corn Rhizosphere | MHPLPADPAELRSFAVSLQAELARKDIELAANAAEIHAKTL |
| Ga0207677_108639111 | 3300026023 | Miscanthus Rhizosphere | MHPLPADPAELRSFAVSLQAELARKDIELAANAAE |
| Ga0207683_107913681 | 3300026121 | Miscanthus Rhizosphere | MSLATEPLPANPSALRIFAAGLQAELARKDIEIAANAA |
| Ga0207698_118213472 | 3300026142 | Corn Rhizosphere | MSLATEPLPANPSALRIFAAGLQAELARKDIEIAANAAEIHAKTL |
| Ga0208861_1010261 | 3300027097 | Forest Soil | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKT |
| Ga0208996_10598321 | 3300027257 | Forest Soil | MSLASAPLPIDLDALRAFAAELQAELARKDIEIAANAAEIYAKFAASHADKDFSAVIETL |
| Ga0255348_10677232 | 3300028268 | Soil | MSLATEPLPVDPAALRAFAADLQAELARKDIELAANAAEIHAKTLHIEKLK |
| Ga0302147_103330371 | 3300028566 | Bog | MSLATNPLPADLPALRAFAAELQAELARKDIELAANAAEIHPRQERV |
| Ga0302153_101246431 | 3300028574 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTL |
| Ga0302160_100458663 | 3300028665 | Fen | MSLVHHPLPTDPQALRAFAADLQAELAHRDIELARKDIELAANAAEIHAK |
| Ga0302219_103213582 | 3300028747 | Palsa | MSLVSEPLPTDLDALRLFAENLQAELARKDREIAANAAEIYAKTLH |
| Ga0302156_101304831 | 3300028748 | Bog | MSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEI |
| Ga0307288_101148401 | 3300028778 | Soil | MSLATEPLPANPSALRIFAAGLQAELARKDIEIAA |
| Ga0302157_101517531 | 3300028813 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIE |
| Ga0222749_103216533 | 3300029636 | Soil | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEI |
| Ga0311361_104475084 | 3300029911 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQLA |
| Ga0311362_104345523 | 3300029913 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKT |
| Ga0311358_103306234 | 3300029915 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAE |
| Ga0302142_11883471 | 3300029920 | Bog | VSLANHPLPTNPRALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQ |
| Ga0311363_111598231 | 3300029922 | Fen | MSLASHPIPNEFEALRSFAANLQSELARKEIEIAANA |
| Ga0311331_116011932 | 3300029954 | Bog | MSLAHHPLPTDPQALHLFAADLQAELARKEIELAANA |
| Ga0302150_100191121 | 3300029956 | Bog | MSLATEPLPVDPAALRAFAADLQAELARKDIELAANAAEIHAKTLHIE |
| Ga0311332_103684851 | 3300029984 | Fen | MSLVHHPLPTDPQALRAFAADLQAELAHRDIELARKDIELAANAAEIH |
| Ga0311336_107863511 | 3300029990 | Fen | MQPLPADPAELRSFAAGLQAELARKDIELAANAAEIHAKTL |
| Ga0302276_101377843 | 3300029992 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEK |
| Ga0311344_103758893 | 3300030020 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQLATLR |
| Ga0311344_103906961 | 3300030020 | Bog | MSLAHHPLPTDPQALQLFAAALQAELARKEIELAANAAEIHAKTLH |
| Ga0311345_103311264 | 3300030688 | Bog | VSLANHPLPTNPRALRSFAADLQAELARKDTELARKDIELERKDIEIAANAAEIY |
| Ga0265460_109414611 | 3300030740 | Soil | MSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAA |
| Ga0265461_132025281 | 3300030743 | Soil | MSLATLPLPDDPTALRNFAVDLQAELARRDIEIAANAAEIHAKT |
| Ga0170834_1087754844 | 3300031057 | Forest Soil | MSLAILPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLK |
| Ga0308204_103650542 | 3300031092 | Soil | MSLATLPLPDDPTALRNLAEGLQAELARKDIEIAANAAEIHAK |
| Ga0170824_1232230281 | 3300031231 | Forest Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLK |
| Ga0302140_111340171 | 3300031261 | Bog | VSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQ |
| Ga0170819_136988461 | 3300031469 | Forest Soil | MSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTL |
| Ga0272437_10249052 | 3300031472 | Rock | MSLASAPLSIGLDALRAFAADLQAELARKDVEIAANAAEILPRRCTSRS |
| Ga0272437_13069502 | 3300031472 | Rock | MSLASVPLPIDLDALRAFAADLQSELARKDIEITANAAEIYAKTLHIRS |
| Ga0170818_1149916831 | 3300031474 | Forest Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIH |
| Ga0272428_11592831 | 3300031520 | Rock | MSLAHDPLPSDPEVLRAFAAGLQAELARKDVQIAANAAEIHAKTLHIEKLRMQL |
| Ga0302320_106134114 | 3300031524 | Bog | MSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLKMQ |
| Ga0310686_1041015663 | 3300031708 | Soil | MSLATLPLPDDPIALRNLAVDLQAELARKDIEIAVNAAEIHAKTLYIEKLKMQLA |
| Ga0310686_1166984741 | 3300031708 | Soil | MSLMTLPLPEDPDALRSFAADLQAELARKDIEILARDAEIHAKTLRIEKLKR |
| Ga0318544_104162952 | 3300031880 | Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKT |
| Ga0308175_1024996201 | 3300031938 | Soil | LAGWAMSLASMPLPSDPAALRALAAGLQAELARKELQIAANAAEIHAKTLHIE |
| Ga0308176_120744331 | 3300031996 | Soil | MSLASTPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLKVEL |
| Ga0318562_104608891 | 3300032008 | Soil | MSLATDPLPANLSALRIFAADLQAELARKDIEIAANAAEIHA |
| Ga0318562_106870221 | 3300032008 | Soil | MSLAIQPLPEDPDALRRFAADLQAELARKTIEITARDAEIHAKTLHIE |
| Ga0318533_113505811 | 3300032059 | Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAA |
| Ga0318504_101310373 | 3300032063 | Soil | MSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLKMQ |
| Ga0308173_122342791 | 3300032074 | Soil | MSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHI |
| Ga0335070_116559502 | 3300032829 | Soil | MSLANQPLPADPEALRAFAADLQAELARKDIELAANAAE |
| Ga0272423_11628683 | 3300033168 | Rock | MFLAIQPLPEDPDALRGFAAELQAELARKEIEITAR |
| Ga0272423_11651923 | 3300033168 | Rock | MSLAIQPLPADPDALRGFAAELQAELARKDIEITARDAEIHAKT |
| Ga0326728_102341731 | 3300033402 | Peat Soil | LAHHPLPTDPQALQLFAAALQAELARKEIEIAANAAEIHAKTLHIEKLKMQLA |
| Ga0370489_0091149_1_177 | 3300034127 | Untreated Peat Soil | VSLANHPLPTDPSALRIFAADLQAELARKNIELERKTIEIAANAAEIHAKTVHIEKLKI |
| Ga0370493_0107197_747_896 | 3300034129 | Untreated Peat Soil | MSLVHQPLPADPQALRAFAADLQAELAHRDTELAHRDTELAHRDIELAHR |
| Ga0370509_0324384_1_120 | 3300034159 | Untreated Peat Soil | MSLATRPLPDDAPALRALAAELQAELARKEIELAANAAEI |
| Ga0370515_0127883_1_111 | 3300034163 | Untreated Peat Soil | VSLANSPLPSDPLALRIFAAGLQTELARKDIELAANA |
| Ga0370503_0089140_1_135 | 3300034196 | Untreated Peat Soil | PTDPQALRAFAADLQAELARKDIELAANAAEIHAKTLHHCCPVR |
| Ga0370488_189626_2_148 | 3300034691 | Untreated Peat Soil | MSLATSPLPTDPQALRSFAADLQAEIVRKNDELARKDIEIAANAAEIHA |
| ⦗Top⦘ |