Metagenome Family F071514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F071514
Family Type	Metagenome
Number of Sequences	122
Average Sequence Length	40 residues
Representative Sequence	MRLDPNTHAYVVATAFMTSVTFAIFAMNLLALVLSHLLN
Number of Associated Samples	90
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	16.67 %
% of genes near scaffold ends (potentially truncated)	21.31 %
% of genes from short scaffolds (< 2000 bps)	79.51 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (63.934 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.492 % of family members)
Environment Ontology (ENVO)	Unclassified (35.246 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF07452	CHRD	9.02
PF13365	Trypsin_2	5.74
PF01523	PmbA_TldD	4.92
PF00682	HMGL-like	4.10
PF03176	MMPL	4.10
PF00486	Trans_reg_C	3.28
PF01613	Flavin_Reduct	1.64
PF08241	Methyltransf_11	1.64
PF03704	BTAD	1.64
PF03706	LPG_synthase_TM	1.64
PF09413	DUF2007	1.64
PF01471	PG_binding_1	1.64
PF02397	Bac_transf	1.64
PF00180	Iso_dh	1.64
PF00583	Acetyltransf_1	1.64
PF00196	GerE	1.64
PF01904	DUF72	0.82
PF01032	FecCD	0.82
PF00574	CLP_protease	0.82
PF13424	TPR_12	0.82
PF01872	RibD_C	0.82
PF01709	Transcrip_reg	0.82
PF09594	GT87	0.82
PF02643	DUF192	0.82
PF13777	Obsolete Pfam Family	0.82
PF04545	Sigma70_r4	0.82
PF04185	Phosphoesterase	0.82
PF13537	GATase_7	0.82
PF00326	Peptidase_S9	0.82
PF04234	CopC	0.82
PF04964	Flp_Fap	0.82
PF13468	Glyoxalase_3	0.82
PF03372	Exo_endo_phos	0.82
PF01174	SNO	0.82
PF00067	p450	0.82
PF04794	YdjC	0.82
PF02350	Epimerase_2	0.82
PF01909	NTP_transf_2	0.82
PF00848	Ring_hydroxyl_A	0.82
PF08502	LeuA_dimer	0.82
PF01494	FAD_binding_3	0.82
PF04199	Cyclase	0.82
PF12229	PG_binding_4	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG0312	Zn-dependent protease PmbA/TldA or its inactivated homolog	General function prediction only [R]	4.92
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	4.10
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	4.10
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.64
COG3947	Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains	Transcription [K]	1.64
COG3629	DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain	Transcription [K]	1.64
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	1.64
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	1.64
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.64
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.64
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.64
COG0392	Predicted membrane flippase AglD2/YbhN, UPF0104 family	Cell wall/membrane/envelope biogenesis [M]	1.64
COG0118	Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH	Amino acid transport and metabolism [E]	0.82
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.82
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	0.82
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.82
COG0217	Transcriptional and/or translational regulatory protein YebC/TACO1	Translation, ribosomal structure and biogenesis [J]	0.82
COG3511	Phospholipase C	Cell wall/membrane/envelope biogenesis [M]	0.82
COG3394	Chitooligosaccharide deacetylase ChbG, YdjC/CelG family	Carbohydrate transport and metabolism [G]	0.82
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.82
COG2372	Copper-binding protein CopC (methionine-rich)	Inorganic ion transport and metabolism [P]	0.82
COG0311	Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)	Coenzyme transport and metabolism [H]	0.82
COG2124	Cytochrome P450	Defense mechanisms [V]	0.82
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.82
COG1878	Kynurenine formamidase	Amino acid transport and metabolism [E]	0.82
COG0381	UDP-N-acetylglucosamine 2-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.82
COG1801	Sugar isomerase-related protein YecE, UPF0759/DUF72 family	General function prediction only [R]	0.82
COG1430	Uncharacterized conserved membrane protein, UPF0127 family	Function unknown [S]	0.82
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.82
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.82
COG0707	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase	Cell wall/membrane/envelope biogenesis [M]	0.82
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.93 %
Unclassified	root	N/A	36.07 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.93 %
Unclassified	root	N/A	36.07 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.93 %
Unclassified	root	N/A	36.07 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	51.64 %
Unclassified	root	N/A	36.07 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	42.62 %
Unclassified	root	N/A	36.07 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.07 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	25.41 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	9.02 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.07 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	23.77 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4.10 %
unclassified Thermoleophilia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia	3.28 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %
Miltoncostaeales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.07 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	23.77 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	4.10 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	3.28 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Miltoncostaeaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.07 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	23.77 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples	4.10 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	3.28 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Miltoncostaea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.07 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	23.77 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	4.10 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	3.28 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Miltoncostaea marina	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina	0.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918008\|ConsensusfromContig315652	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	632	Open in IMG/M
2170459004\|F62QY1Z01DYUOC	Not Available	505	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c1481242	Not Available	659	Open in IMG/M
3300002069\|JGIcombinedJ21912_10185186	All Organisms → cellular organisms → Bacteria → Terrabacteria group	709	Open in IMG/M
3300002568\|C688J35102_119392729	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	686	Open in IMG/M
3300002568\|C688J35102_120446863	Not Available	1076	Open in IMG/M
3300003267\|soilL1_10072832	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1523	Open in IMG/M
3300004081\|Ga0063454_100458364	All Organisms → cellular organisms → Bacteria → Terrabacteria group	879	Open in IMG/M
3300004153\|Ga0063455_100411804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	802	Open in IMG/M
3300004153\|Ga0063455_101464810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	530	Open in IMG/M
3300005445\|Ga0070708_100855604	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300005454\|Ga0066687_10778608	All Organisms → cellular organisms → Bacteria → Terrabacteria group	569	Open in IMG/M
3300005467\|Ga0070706_100233310	All Organisms → cellular organisms → Bacteria	1718	Open in IMG/M
3300005468\|Ga0070707_100992653	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	805	Open in IMG/M
3300005471\|Ga0070698_101271356	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300005529\|Ga0070741_10061936	All Organisms → cellular organisms → Bacteria → Proteobacteria	4338	Open in IMG/M
3300005532\|Ga0070739_10045937	All Organisms → cellular organisms → Bacteria	2908	Open in IMG/M
3300005532\|Ga0070739_10369655	Not Available	672	Open in IMG/M
3300005552\|Ga0066701_10399225	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	851	Open in IMG/M
3300005559\|Ga0066700_10476989	Not Available	873	Open in IMG/M
3300005566\|Ga0066693_10223488	Not Available	740	Open in IMG/M
3300005985\|Ga0081539_10002077	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	29969	Open in IMG/M
3300006031\|Ga0066651_10331449	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300006057\|Ga0075026_100294442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina	884	Open in IMG/M
3300006059\|Ga0075017_100759808	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	748	Open in IMG/M
3300006174\|Ga0075014_100703863	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	588	Open in IMG/M
3300006797\|Ga0066659_10894965	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	741	Open in IMG/M
3300007740\|Ga0104326_113831	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1279	Open in IMG/M
3300007820\|Ga0104324_132293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2823	Open in IMG/M
3300007821\|Ga0104323_116272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1373	Open in IMG/M
3300009012\|Ga0066710_100075690	All Organisms → cellular organisms → Bacteria	4351	Open in IMG/M
3300009038\|Ga0099829_10390508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1149	Open in IMG/M
3300009038\|Ga0099829_11337957	Not Available	592	Open in IMG/M
3300009088\|Ga0099830_10123622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1961	Open in IMG/M
3300009088\|Ga0099830_10483639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1008	Open in IMG/M
3300009088\|Ga0099830_10999268	All Organisms → cellular organisms → Bacteria → Terrabacteria group	693	Open in IMG/M
3300009088\|Ga0099830_11314532	Not Available	601	Open in IMG/M
3300009088\|Ga0099830_11647945	Not Available	535	Open in IMG/M
3300009089\|Ga0099828_10036924	All Organisms → cellular organisms → Bacteria	3980	Open in IMG/M
3300009089\|Ga0099828_11507403	Not Available	593	Open in IMG/M
3300009090\|Ga0099827_10000146	All Organisms → cellular organisms → Bacteria	26123	Open in IMG/M
3300009090\|Ga0099827_10413613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1153	Open in IMG/M
3300009090\|Ga0099827_11273179	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	640	Open in IMG/M
3300009090\|Ga0099827_11296340	Not Available	634	Open in IMG/M
3300009137\|Ga0066709_100972300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1241	Open in IMG/M
3300009137\|Ga0066709_101135962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1149	Open in IMG/M
3300009137\|Ga0066709_102717328	Not Available	659	Open in IMG/M
3300009137\|Ga0066709_102933024	Not Available	628	Open in IMG/M
3300010039\|Ga0126309_11147295	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300010335\|Ga0134063_10764837	Not Available	504	Open in IMG/M
3300010364\|Ga0134066_10244036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	618	Open in IMG/M
3300012011\|Ga0120152_1008987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	4411	Open in IMG/M
3300012096\|Ga0137389_10204436	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1645	Open in IMG/M
3300012189\|Ga0137388_10860520	All Organisms → cellular organisms → Bacteria → Terrabacteria group	839	Open in IMG/M
3300012206\|Ga0137380_10643794	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	924	Open in IMG/M
3300012211\|Ga0137377_10379998	Not Available	1350	Open in IMG/M
3300012212\|Ga0150985_118283106	Not Available	814	Open in IMG/M
3300012354\|Ga0137366_10873748	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	635	Open in IMG/M
3300012355\|Ga0137369_10229644	All Organisms → cellular organisms → Bacteria	1416	Open in IMG/M
3300012360\|Ga0137375_10508553	Not Available	1023	Open in IMG/M
3300012922\|Ga0137394_10900804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	738	Open in IMG/M
3300012929\|Ga0137404_10863864	All Organisms → cellular organisms → Bacteria → Terrabacteria group	824	Open in IMG/M
3300013105\|Ga0157369_12696673	Not Available	500	Open in IMG/M
3300013763\|Ga0120179_1006158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3308	Open in IMG/M
3300013772\|Ga0120158_10127380	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1459	Open in IMG/M
3300014326\|Ga0157380_12328906	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	600	Open in IMG/M
3300014488\|Ga0182001_10471567	Not Available	569	Open in IMG/M
3300015195\|Ga0167658_1051263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1011	Open in IMG/M
3300015195\|Ga0167658_1069503	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	821	Open in IMG/M
3300015371\|Ga0132258_13524092	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1072	Open in IMG/M
3300017656\|Ga0134112_10379016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	581	Open in IMG/M
3300017944\|Ga0187786_10030314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1512	Open in IMG/M
3300017944\|Ga0187786_10067610	Not Available	1124	Open in IMG/M
3300017947\|Ga0187785_10015762	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	2628	Open in IMG/M
3300017947\|Ga0187785_10402210	Not Available	658	Open in IMG/M
3300017959\|Ga0187779_10122622	Not Available	1583	Open in IMG/M
3300017966\|Ga0187776_10447645	Not Available	873	Open in IMG/M
3300017966\|Ga0187776_10615141	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	758	Open in IMG/M
3300017966\|Ga0187776_11550216	Not Available	511	Open in IMG/M
3300018029\|Ga0187787_10105459	Not Available	909	Open in IMG/M
3300018032\|Ga0187788_10555778	Not Available	503	Open in IMG/M
3300018064\|Ga0187773_10021257	Not Available	2784	Open in IMG/M
3300018064\|Ga0187773_10161650	Not Available	1164	Open in IMG/M
3300018064\|Ga0187773_11089929	Not Available	530	Open in IMG/M
3300018089\|Ga0187774_10027972	Not Available	2306	Open in IMG/M
3300018433\|Ga0066667_10123852	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1772	Open in IMG/M
3300018433\|Ga0066667_12301694	Not Available	504	Open in IMG/M
3300025664\|Ga0208849_1000992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	22222	Open in IMG/M
3300025846\|Ga0209538_1088424	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1266	Open in IMG/M
3300025910\|Ga0207684_10123179	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2224	Open in IMG/M
3300025910\|Ga0207684_10201670	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1716	Open in IMG/M
3300025922\|Ga0207646_10361405	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1312	Open in IMG/M
3300025937\|Ga0207669_11485310	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300026331\|Ga0209267_1129452	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1058	Open in IMG/M
3300026550\|Ga0209474_10378182	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	760	Open in IMG/M
3300027773\|Ga0209810_1055502	All Organisms → cellular organisms → Bacteria	2034	Open in IMG/M
3300027773\|Ga0209810_1215730	Not Available	755	Open in IMG/M
3300027862\|Ga0209701_10240558	Not Available	1063	Open in IMG/M
3300027862\|Ga0209701_10333546	Not Available	863	Open in IMG/M
3300027882\|Ga0209590_10000309	All Organisms → cellular organisms → Bacteria	15140	Open in IMG/M
3300028047\|Ga0209526_10712013	Not Available	631	Open in IMG/M
3300028800\|Ga0265338_10393260	All Organisms → cellular organisms → Bacteria → Terrabacteria group	989	Open in IMG/M
3300028881\|Ga0307277_10472385	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	562	Open in IMG/M
3300028884\|Ga0307308_10337957	All Organisms → cellular organisms → Bacteria → Terrabacteria group	721	Open in IMG/M
3300031226\|Ga0307497_10005397	Not Available	3404	Open in IMG/M
3300032160\|Ga0311301_11247178	Not Available	947	Open in IMG/M
3300032180\|Ga0307471_102011070	Not Available	725	Open in IMG/M
3300032770\|Ga0335085_10364157	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1690	Open in IMG/M
3300032782\|Ga0335082_10015470	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	8272	Open in IMG/M
3300032782\|Ga0335082_10139799	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2356	Open in IMG/M
3300032783\|Ga0335079_10555280	Not Available	1217	Open in IMG/M
3300032828\|Ga0335080_10036819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5372	Open in IMG/M
3300032828\|Ga0335080_11826414	Not Available	593	Open in IMG/M
3300032829\|Ga0335070_10009581	All Organisms → cellular organisms → Bacteria	11335	Open in IMG/M
3300032829\|Ga0335070_11247431	Not Available	681	Open in IMG/M
3300032893\|Ga0335069_10009427	Not Available	13898	Open in IMG/M
3300033004\|Ga0335084_10103352	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2959	Open in IMG/M
3300033004\|Ga0335084_10584771	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1143	Open in IMG/M
3300033758\|Ga0314868_005195	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1206	Open in IMG/M
3300033810\|Ga0314872_002901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	990	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	94.26%
Host-Associated	Host-Associated	5.74%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.80%
Plants	Host-Associated → Plants	5.74%
Aquatic	Environmental → Aquatic	2.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.28%
Sediment	Environmental → Aquatic → Sediment	2.46%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.20%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	22.13%
Loam	Environmental → Terrestrial → Soil → Loam	11.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.64%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.64%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	36.07%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	22.13%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.56%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	5.74%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	4.10%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.64%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.49%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	11.48%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	9.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.38%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.92%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	4.10%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	4.10%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.46%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.46%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	2.46%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.46%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.64%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	1.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.82%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.82%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.82%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.82%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.82%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.82%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.82%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.82%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918008	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental	Open in IMG/M
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300002069	Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300007740	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo	Environmental	Open in IMG/M
3300007820	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo	Environmental	Open in IMG/M
3300007821	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300012011	Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013763	Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M	Environmental	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300025664	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025846	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033758	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A	Environmental	Open in IMG/M
3300033810	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Bog_all_C_04284810	2140918008	Soil	MQLDPNTHAFVLATAALTSLAFTIFALNLLALVLQHTLG
E4B_01504410	2170459004	Grass Soil	MQLDPNTHAYVAATAFLTSLTFAIFAMHVIALVLYYTVY
ICChiseqgaiiDRAFT_14812421	3300000033	Soil	MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQQVLG*
JGIcombinedJ21912_101851861	3300002069	Arctic Peat Soil	MRLDPNTHAIVVATAFLTSVSFAIFAMNVLAAVLYWLY*
C688J35102_1193927292	3300002568	Soil	MRIDPNTHAFVVATAFLTSAAFAIAVMNVLAFVLARFVL*
C688J35102_1204468632	3300002568	Soil	KGMRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR*
soilL1_100728323	3300003267	Sugarcane Root And Bulk Soil	MRLDPNTHAFVLATAFMTSLTFAIFACNVIAVALGWLLG*
Ga0063454_1004583642	3300004081	Soil	VYKKGMRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR*
Ga0063455_1004118041	3300004153	Soil	MRLDPNTHAFVAATAFLTSVAFAIAAMNVIAFVLARFWV*
Ga0063455_1014648102	3300004153	Soil	MRLDPTPARRSSTAVMTSISFAVFGMNLIALVLSHVLVTGSRS*
Ga0070708_1008556042	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH*
Ga0066687_107786081	3300005454	Soil	MRLDPNTHAFVLATAFITSVTFAIFACNLLALVLEHIYR*
Ga0070706_1002333102	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALVLSHLLN*
Ga0070707_1009926532	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALILSHLLN*
Ga0070707_1018446631	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	WSRRTASVTLRLMRLDPNTHAFVAATAFFTAGTFAIFVMNLLALVLQRLLGY*
Ga0070698_1012713562	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MRMDPNTHAVVLWTAFLTSVSFAVFAMNLLGLILEHVLH*
Ga0070741_100619364	3300005529	Surface Soil	MRLDPNTHAFVLGTALLTSITFTIFALNLIALILQRVLY*
Ga0070739_100459371	3300005532	Surface Soil	PACGAGDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN*
Ga0070739_103696552	3300005532	Surface Soil	GDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN*
Ga0066701_103992252	3300005552	Soil	MRLDPNTHAFVLATAFLTSVTFAIFAMNLLALLLSHLVG*
Ga0066700_104769891	3300005559	Soil	MRLDPNTHAFVAATAFFTAGAFTIFVLNLLALVLQPVLF*
Ga0066693_102234881	3300005566	Soil	MRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA*
Ga0081539_1000207726	3300005985	Tabebuia Heterophylla Rhizosphere	MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQHVLS*
Ga0066651_103314491	3300006031	Soil	HRMRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA*
Ga0075026_1002944423	3300006057	Watersheds	HCGMRLDQNTHALVLATAFLTSVSFAIFAMNLIALVLSHLLA*
Ga0075017_1007598082	3300006059	Watersheds	MRLDPNTHMYVVTTAFFTSLAFAIFAMNVIALVLYYTVH*
Ga0075014_1007038632	3300006174	Watersheds	MRLDPNTHMYVVTTAFFTSLAFAIFAMNIIALVLYYTVN*
Ga0066659_108949651	3300006797	Soil	RIDPNTHAFVLATAFLTSVTFAIFAMNLLALLLSHLVG*
Ga0104326_1138312	3300007740	Soil	MNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGS*
Ga0104324_1322933	3300007820	Soil	MHMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGS*
Ga0104323_1162723	3300007821	Soil	MRMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYAN*
Ga0066710_1000756905	3300009012	Grasslands Soil	MRLDPNTHTLLLTTAFLASLAFAVLAMNVLALVLSHLLA
Ga0066710_1004268391	3300009012	Grasslands Soil	SVKLRLMRLDPNTHAFVAATAFFTAGAFTIFVLNLLALVLQRVLF
Ga0099829_103905082	3300009038	Vadose Zone Soil	MRMDPNTHAVVLWTAFLTSVSFAVFAMNLLGLVLEHVLH*
Ga0099829_113379572	3300009038	Vadose Zone Soil	MRLDPNTHAFVLATAFLTSVTFAIFAMNLLALVLSSLVG*
Ga0099830_101236223	3300009088	Vadose Zone Soil	MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH*
Ga0099830_104836392	3300009088	Vadose Zone Soil	MDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH*
Ga0099830_109992682	3300009088	Vadose Zone Soil	GRCMGINPNTHAFVLATAFMTSLAFAILAMNVIAVCLYYYAS*
Ga0099830_113145322	3300009088	Vadose Zone Soil	ISIQRRMRLDRNTHTLVLATAFLTSVAFAVLAMNVLALVLSHVLA*
Ga0099830_116479451	3300009088	Vadose Zone Soil	MRLDPNTRAFVLATAFLTSVTFAIFAMNLFALVLNHLVG*
Ga0099828_100369241	3300009089	Vadose Zone Soil	MRLDPNTRAFVLATAFLTSVTFAIFAMNLFALVLSHLVG*
Ga0099828_115074033	3300009089	Vadose Zone Soil	MDPNTHAVVLWTAFLTSVSFAVFAMNLLGLVLEHVLH*
Ga0099827_1000014620	3300009090	Vadose Zone Soil	MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHLLH*
Ga0099827_104136134	3300009090	Vadose Zone Soil	AAMRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVL*
Ga0099827_112731791	3300009090	Vadose Zone Soil	MRLDPNTHAFVAATAFLTAFYFAITVMLVIAFLLSQADA*
Ga0099827_112963402	3300009090	Vadose Zone Soil	MRIDPNTHAFVVATAFLTSVYFAVTVMQLLALVLERMLT*
Ga0066709_1009723001	3300009137	Grasslands Soil	GRFQFHHRMRLDPNTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA*
Ga0066709_1011359622	3300009137	Grasslands Soil	MRLDPNTHAMVLWTAFLTSVAFAIFAMNLIALVLQHLFY*
Ga0066709_1027173282	3300009137	Grasslands Soil	MRLDPNTHGFVVATAFLTSVTFAIFAMNLLALFLSRLPG*
Ga0066709_1029330241	3300009137	Grasslands Soil	MRLDPNTHTLLLTTAFLASLPFAVLAMNVLALVLSHLLA*
Ga0126309_111472952	3300010039	Serpentine Soil	MKLDPNTMGFVYATAFLTSVTFAIFAMNLLALVLERVLG*
Ga0134063_107648371	3300010335	Grasslands Soil	LDPNTHAMVLWTAFLTSASFAIFAMNLLGLVLEHVLH*
Ga0134066_102440362	3300010364	Grasslands Soil	LNLDPNTHALVLGTAFLTSVTFAISVMNILAVVLSHVLR*
Ga0120152_10089873	3300012011	Permafrost	MGLDPNTHTLVMATAFLTSVAFAIFALNVIALVLQRVLA*
Ga0137389_102044361	3300012096	Vadose Zone Soil	QRHLGEGAMGINPHTRAFVLATAFMTSLAFAILAMNVIALCLYYYVS*
Ga0137388_108605202	3300012189	Vadose Zone Soil	MGINPNTRAFVLATAFMTSLAFAILAMNVIALCLYYYVS*
Ga0137380_106437943	3300012206	Vadose Zone Soil	MRLDPNTHAFVVATAFLTSVTFAIFAMNLLALFLSRLAG*
Ga0137377_103799982	3300012211	Vadose Zone Soil	MRLDPNTHTLLLTTAFLTSAAFAVLAMNVLALVLSHLLA*
Ga0150985_1182831062	3300012212	Avena Fatua Rhizosphere	VRIDPNTHAFVLSTAFFTSLAFTVFALNFVALVLE
Ga0137366_108737482	3300012354	Vadose Zone Soil	MRLDPNTHAYVVATAFFTSVAFTIFALNLLALVLQRILA*
Ga0137369_102296442	3300012355	Vadose Zone Soil	MRLDPNTHAYVVATAFFTSVAFAIFALNLLALVLQRILA*
Ga0137375_105085531	3300012360	Vadose Zone Soil	MDPNTHAFVLSTAFMTSLAFAIFAMNVIAVVLQQVLS*
Ga0137394_109008042	3300012922	Vadose Zone Soil	MRMNPNTHSYVVATAFMTSLAFAIFAMNVIALCLYYYGGYGS*
Ga0137404_108638642	3300012929	Vadose Zone Soil	MRLDPNTHALVVATAFLTSVAFAIAAMSVLAFVLSLFFG*
Ga0157369_126966731	3300013105	Corn Rhizosphere	DPNTHAYVAATAFLTSVAFAIAVMNVIAFVLGRFFT*
Ga0120179_10061586	3300013763	Permafrost	MNPNTHSYVAATAFMTSLAFAIFAMNVIALCLYYYAN*
Ga0120158_101273802	3300013772	Permafrost	MGLDPNTHSFVVATAFMTSVSFMILALNVIALLLERVYG*
Ga0157380_123289062	3300014326	Switchgrass Rhizosphere	MRMDPSTHALVVATALLTSVAFAILVLNVIALLLQQIYG*
Ga0182001_104715672	3300014488	Soil	LRLDPNTHALVYGWAFLTSLSFAIFAMHLIALILERVLA*
Ga0167658_10512632	3300015195	Glacier Forefield Soil	MQMNPNTHSYVVATAFMTSLAFAILAMNVIALCLYYYAN*
Ga0167658_10695032	3300015195	Glacier Forefield Soil	MRMNPNTHSYVAATAFMTSLAFAIFAMNVIALCLYYYAN*
Ga0132258_135240921	3300015371	Arabidopsis Rhizosphere	MAVTSAAMRLDPNTHACVLATAFMTSLTFAIFAMNVIAVVLQQVLG*
Ga0134112_103790161	3300017656	Grasslands Soil	MRLDPNTHAYVLATAFLTSVTFAIFAMNLLALALSHLVG
Ga0187786_100303142	3300017944	Tropical Peatland	MRLDPNTHAYVLATALMTSIAFAVFAMNLLALVLQYVLR
Ga0187786_100676102	3300017944	Tropical Peatland	MRIDPNTHAFVMATAFLVSASFAVLAMNVLAIVLSHLLA
Ga0187785_100157623	3300017947	Tropical Peatland	MRLDPNTHAYVLATAMMTSIAFAVFAMNLIALVLQYVLR
Ga0187785_104022101	3300017947	Tropical Peatland	MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALFLYYATN
Ga0187779_101226222	3300017959	Tropical Peatland	MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLH
Ga0187776_104476452	3300017966	Tropical Peatland	MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLR
Ga0187776_106151412	3300017966	Tropical Peatland	MRLDPNTHAYVLATALMTSVAFAIFAMNLLALLLSYVTR
Ga0187776_115502162	3300017966	Tropical Peatland	MRLDPNTHAFVLATAGITSIAFAIFAMNLLAVVLAYTLG
Ga0187787_101054592	3300018029	Tropical Peatland	MRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLQYVLR
Ga0187788_105557782	3300018032	Tropical Peatland	MRIDPNTHAFVMATAFLTSVSFAVLAMNVLALVLSHLLA
Ga0187773_100212572	3300018064	Tropical Peatland	MRLDPNTHAFVLATAFLTSFAFAVLAMNLLAGVLYYTVG
Ga0187773_101616501	3300018064	Tropical Peatland	MRLDPNTHAYVMATALMTSVAFAIFAMNVIALVLYYALN
Ga0187773_110899291	3300018064	Tropical Peatland	AAMRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLPYFLR
Ga0187774_100279723	3300018089	Tropical Peatland	MRLDPNTHAYVMATALMTSIAFAIFAMNVIALVLYYALN
Ga0066667_101238522	3300018433	Grasslands Soil	MRLDPNTHAMVLWTAFLTSVAFAIFAMNLIALVLQHLFY
Ga0066667_123016941	3300018433	Grasslands Soil	MRLDPNTHAYVVATAFMTSVTFAIFAMNLLALVLSHLLN
Ga0208849_100099217	3300025664	Arctic Peat Soil	MQLDPNSNAFVLATAFLVSVTFAIFAMNVLAAILYYTYN
Ga0209538_10884241	3300025846	Arctic Peat Soil	MRLDPNTHAIVVATAFLTSVSFAIFAMNVLAAVLYWLY
Ga0207684_101231792	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRLDPNTHAYVVATAFMTSVTFAIFAMNLIALVLSHLLN
Ga0207684_102016702	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH
Ga0207646_103614052	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MRMDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH
Ga0207669_114853102	3300025937	Miscanthus Rhizosphere	MRMDPSTHALVVATALLTSVAFAILVLNVIALLLQQLYG
Ga0209267_11294521	3300026331	Soil	THSYVVATAFMTSLAFAIFAMNLIALLLYYYGGYAS
Ga0209474_103781821	3300026550	Soil	RLDPHTHTLLLTTAFLTSVSFAVLAMNVLALVLSHLLA
Ga0209810_10555022	3300027773	Surface Soil	MLRPPACGAGDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN
Ga0209810_12157301	3300027773	Surface Soil	GDCGMRLDPNTHAFVLGTALLTSVTFTIFALNLIALVLQHVLN
Ga0209701_102405582	3300027862	Vadose Zone Soil	MRLDPNTHAFVLATAFLTSVTFAIFAMNLFALVLSH
Ga0209701_103335462	3300027862	Vadose Zone Soil	MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHVLH
Ga0209590_100003098	3300027882	Vadose Zone Soil	MRLDPNTHAVVLWTAFLTSVSFAIFAMNLLGLVLEHLLH
Ga0209526_107120131	3300028047	Forest Soil	MRPDPNTHTVVLVTAFLTSVSFAVLAMNVLALVLSHLLA
Ga0265338_103932602	3300028800	Rhizosphere	MRLDPNTHAFVLDTAALTSIALTIFALNLLALVLQRTLG
Ga0307277_104723852	3300028881	Soil	MRGYHPAAMRMNPNTHSYVLATAFMTSAAFAIFAMNVIALCLYYYGGYNS
Ga0307308_103379572	3300028884	Soil	NPNTRAFVLATAFMTSLSFAILAMNIIALCLYYYGS
Ga0307497_100053972	3300031226	Soil	MRLDPNTHYFVLATAFITSVAFAIAAMNVLAFVLSHFVLS
Ga0311301_112471782	3300032160	Peatlands Soil	MRLDPNTHMYVVTTAFFTSLAFAIFAMNVIALVLYYTVH
Ga0307471_1020110702	3300032180	Hardwood Forest Soil	LMRLDPNTHAFVAATAFFTAGAFTIFVLNLLVLVLQRVLGY
Ga0335085_103641572	3300032770	Soil	MRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHLLA
Ga0335082_100154704	3300032782	Soil	MRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHVLA
Ga0335082_101397993	3300032782	Soil	MRIDPNTHAFVMATAFLVSASFAVLAMNVLALVLSHLLA
Ga0335079_105552802	3300032783	Soil	MRLDPNTHAYVMATALMTSIAFAVFAMNLIALVLSYVLR
Ga0335080_100368195	3300032828	Soil	MRIDPNTHAFVMATAFLVSASFAILAMNVLALVLSHMLS
Ga0335080_118264141	3300032828	Soil	MRIDPNTHAFVMATAFLVSASFAILAMNVLALVLSHLLS
Ga0335070_100095812	3300032829	Soil	MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALVLYYATR
Ga0335070_112474312	3300032829	Soil	VRLHQSAAMRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLSYVLR
Ga0335069_1000942716	3300032893	Soil	MRLDPNTHAYVMATALMTSIAFAVFAMNLLALVLSYVLR
Ga0335084_101033524	3300033004	Soil	MRIDPNTHALVMATAFLTSVSFAILAMNVLALVLSHVLA
Ga0335084_105847713	3300033004	Soil	PPSTAAMRIDPNTHAFVMATAFLTSVSFAILAMNVLALVLSHLLA
Ga0314868_005195_987_1106	3300033758	Peatland	MRLDPNTHAYVLATALMTSIAFAVFAMNLIALVVQYVLR
Ga0314872_002901_801_920	3300033810	Peatland	MRLDPNTHAFVLATAFLTSVTFAIFAMNVIALCLYYATN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F071514

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences