| Basic Information | |
|---|---|
| Family ID | F071491 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.82 % |
| % of genes near scaffold ends (potentially truncated) | 96.72 % |
| % of genes from short scaffolds (< 2000 bps) | 85.25 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.082 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.361 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (45.082 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 0.00% Coil/Unstructured: 90.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 4.10 |
| PF00486 | Trans_reg_C | 4.10 |
| PF13238 | AAA_18 | 4.10 |
| PF03706 | LPG_synthase_TM | 3.28 |
| PF00196 | GerE | 2.46 |
| PF00583 | Acetyltransf_1 | 2.46 |
| PF12680 | SnoaL_2 | 2.46 |
| PF01243 | Putative_PNPOx | 2.46 |
| PF09339 | HTH_IclR | 1.64 |
| PF01244 | Peptidase_M19 | 1.64 |
| PF07690 | MFS_1 | 1.64 |
| PF02417 | Chromate_transp | 1.64 |
| PF01850 | PIN | 1.64 |
| PF13847 | Methyltransf_31 | 1.64 |
| PF04964 | Flp_Fap | 0.82 |
| PF00990 | GGDEF | 0.82 |
| PF13424 | TPR_12 | 0.82 |
| PF02896 | PEP-utilizers_C | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF02687 | FtsX | 0.82 |
| PF01548 | DEDD_Tnp_IS110 | 0.82 |
| PF03537 | Glyco_hydro_114 | 0.82 |
| PF12006 | DUF3500 | 0.82 |
| PF01433 | Peptidase_M1 | 0.82 |
| PF02894 | GFO_IDH_MocA_C | 0.82 |
| PF01425 | Amidase | 0.82 |
| PF02733 | Dak1 | 0.82 |
| PF00381 | PTS-HPr | 0.82 |
| PF01791 | DeoC | 0.82 |
| PF05988 | DUF899 | 0.82 |
| PF00664 | ABC_membrane | 0.82 |
| PF13522 | GATase_6 | 0.82 |
| PF01571 | GCV_T | 0.82 |
| PF13420 | Acetyltransf_4 | 0.82 |
| PF04264 | YceI | 0.82 |
| PF03176 | MMPL | 0.82 |
| PF11838 | ERAP1_C | 0.82 |
| PF08327 | AHSA1 | 0.82 |
| PF13302 | Acetyltransf_3 | 0.82 |
| PF02720 | DUF222 | 0.82 |
| PF03729 | DUF308 | 0.82 |
| PF01636 | APH | 0.82 |
| PF00440 | TetR_N | 0.82 |
| PF13561 | adh_short_C2 | 0.82 |
| PF01152 | Bac_globin | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 3.28 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.64 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.82 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.82 |
| COG3868 | Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114 | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.82 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.82 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.82 |
| COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.82 |
| COG2342 | Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) | Carbohydrate transport and metabolism [G] | 0.82 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.82 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.82 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.82 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.52 % |
| Unclassified | root | N/A | 11.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF01BCJBN | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea | 504 | Open in IMG/M |
| 3300005332|Ga0066388_106209943 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005445|Ga0070708_101197040 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005445|Ga0070708_101267673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300005467|Ga0070706_100813169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300005586|Ga0066691_10317118 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005764|Ga0066903_100153233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3318 | Open in IMG/M |
| 3300005764|Ga0066903_100542036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1991 | Open in IMG/M |
| 3300005764|Ga0066903_101212243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1402 | Open in IMG/M |
| 3300005764|Ga0066903_102024895 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300006028|Ga0070717_10359518 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300006028|Ga0070717_11519095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. SolWspMP-SS2h | 607 | Open in IMG/M |
| 3300006175|Ga0070712_100564203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 960 | Open in IMG/M |
| 3300006794|Ga0066658_10335365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300006804|Ga0079221_10228912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1040 | Open in IMG/M |
| 3300006854|Ga0075425_100069682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3959 | Open in IMG/M |
| 3300006903|Ga0075426_10017480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5122 | Open in IMG/M |
| 3300009090|Ga0099827_10521273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1022 | Open in IMG/M |
| 3300009792|Ga0126374_10839748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300010046|Ga0126384_10643940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
| 3300010046|Ga0126384_10829352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 830 | Open in IMG/M |
| 3300010046|Ga0126384_11214846 | Not Available | 696 | Open in IMG/M |
| 3300010048|Ga0126373_10070681 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300010048|Ga0126373_10198992 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300010048|Ga0126373_11503991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300010048|Ga0126373_12510633 | Not Available | 574 | Open in IMG/M |
| 3300010048|Ga0126373_12951509 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010358|Ga0126370_11570934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 628 | Open in IMG/M |
| 3300010358|Ga0126370_12030483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300010359|Ga0126376_10038215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3313 | Open in IMG/M |
| 3300010360|Ga0126372_10386880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1271 | Open in IMG/M |
| 3300010360|Ga0126372_11247368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300010361|Ga0126378_10219741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1983 | Open in IMG/M |
| 3300010361|Ga0126378_10835225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300010361|Ga0126378_10961883 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300010361|Ga0126378_12392923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300010366|Ga0126379_12482701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300010376|Ga0126381_100102346 | Not Available | 3660 | Open in IMG/M |
| 3300010376|Ga0126381_101469128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300010376|Ga0126381_104826374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010398|Ga0126383_11023472 | Not Available | 915 | Open in IMG/M |
| 3300010398|Ga0126383_11535036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300011270|Ga0137391_10484930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300012096|Ga0137389_10048953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3183 | Open in IMG/M |
| 3300012201|Ga0137365_11010380 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012357|Ga0137384_10387347 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012929|Ga0137404_11877207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012971|Ga0126369_13013846 | Not Available | 551 | Open in IMG/M |
| 3300016404|Ga0182037_10391888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300017822|Ga0187802_10337625 | Not Available | 591 | Open in IMG/M |
| 3300021478|Ga0210402_11086968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300021560|Ga0126371_10548848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1305 | Open in IMG/M |
| 3300021560|Ga0126371_10926164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1015 | Open in IMG/M |
| 3300021560|Ga0126371_12254995 | Not Available | 657 | Open in IMG/M |
| 3300021560|Ga0126371_13591603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300025898|Ga0207692_10195529 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300025910|Ga0207684_10589948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300025928|Ga0207700_10388203 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300025929|Ga0207664_10911973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300026490|Ga0257153_1118675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300027725|Ga0209178_1196975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300027862|Ga0209701_10554710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300031549|Ga0318571_10374823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300031561|Ga0318528_10509463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300031561|Ga0318528_10552793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031564|Ga0318573_10102760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1468 | Open in IMG/M |
| 3300031564|Ga0318573_10285195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300031640|Ga0318555_10532859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300031668|Ga0318542_10452554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300031682|Ga0318560_10646969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300031719|Ga0306917_10013955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 4734 | Open in IMG/M |
| 3300031723|Ga0318493_10039818 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300031723|Ga0318493_10290716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 880 | Open in IMG/M |
| 3300031724|Ga0318500_10001128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6984 | Open in IMG/M |
| 3300031736|Ga0318501_10002578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora | 5800 | Open in IMG/M |
| 3300031736|Ga0318501_10736921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300031748|Ga0318492_10564066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 606 | Open in IMG/M |
| 3300031764|Ga0318535_10032217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2108 | Open in IMG/M |
| 3300031764|Ga0318535_10292857 | Not Available | 728 | Open in IMG/M |
| 3300031764|Ga0318535_10402951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300031765|Ga0318554_10100925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1622 | Open in IMG/M |
| 3300031765|Ga0318554_10695412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia africana | 571 | Open in IMG/M |
| 3300031768|Ga0318509_10318772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300031770|Ga0318521_10102866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1575 | Open in IMG/M |
| 3300031770|Ga0318521_10645832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031779|Ga0318566_10301992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300031780|Ga0318508_1025791 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300031782|Ga0318552_10031465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2435 | Open in IMG/M |
| 3300031795|Ga0318557_10046775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1808 | Open in IMG/M |
| 3300031795|Ga0318557_10472553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300031797|Ga0318550_10039033 | Not Available | 2086 | Open in IMG/M |
| 3300031798|Ga0318523_10122570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
| 3300031821|Ga0318567_10162501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1238 | Open in IMG/M |
| 3300031831|Ga0318564_10270040 | Not Available | 753 | Open in IMG/M |
| 3300031832|Ga0318499_10299628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300031835|Ga0318517_10519361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031880|Ga0318544_10322721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300031890|Ga0306925_10470441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| 3300031897|Ga0318520_10433637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CME 23 | 806 | Open in IMG/M |
| 3300031910|Ga0306923_12366717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300031945|Ga0310913_11148676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300031947|Ga0310909_10223566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1569 | Open in IMG/M |
| 3300032009|Ga0318563_10489100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300032009|Ga0318563_10667044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300032025|Ga0318507_10012401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2836 | Open in IMG/M |
| 3300032041|Ga0318549_10244731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300032043|Ga0318556_10107072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
| 3300032055|Ga0318575_10004228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 4931 | Open in IMG/M |
| 3300032055|Ga0318575_10157564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
| 3300032064|Ga0318510_10554675 | Not Available | 502 | Open in IMG/M |
| 3300032066|Ga0318514_10462690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300032066|Ga0318514_10541125 | Not Available | 620 | Open in IMG/M |
| 3300032067|Ga0318524_10610550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300032067|Ga0318524_10654928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032076|Ga0306924_12300110 | Not Available | 547 | Open in IMG/M |
| 3300032089|Ga0318525_10236372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300032089|Ga0318525_10639654 | Not Available | 542 | Open in IMG/M |
| 3300032091|Ga0318577_10587395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300032180|Ga0307471_100020130 | All Organisms → cellular organisms → Bacteria | 4860 | Open in IMG/M |
| 3300032180|Ga0307471_103482436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300032261|Ga0306920_100016330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10221 | Open in IMG/M |
| 3300033289|Ga0310914_11383350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 23.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_06589920 | 2189573002 | Grass Soil | YYHFSVLRTLEDGFGLPSYLGSANDVTPIAVWRTLTS |
| Ga0066388_1062099433 | 3300005332 | Tropical Forest Soil | AVPGSYGAKHYAYSLLRTFEDGFGLGSYLGDANAVTPVNEIWR* |
| Ga0070708_1011970402 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PQVVPGSYDTQWFHYSLLRTLEDGFGLPAYLGDANEVAPINTIWQSP* |
| Ga0070708_1012676732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GSYDQKYFHYSVLRTIEDGFALPGYLGNANDVTPIASIWRAPAG* |
| Ga0070706_1008131692 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SYDTQWFHYSLLRTLEDGFALPEYLGDANAVTPIDSIWQSP* |
| Ga0066691_103171181 | 3300005586 | Soil | YDTQWFHYSLLRTLEDGFALPEYLGDANAVTPIDAIWRSP* |
| Ga0066903_1001532334 | 3300005764 | Tropical Forest Soil | PGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVTPIASIWRPPAS* |
| Ga0066903_1005420362 | 3300005764 | Tropical Forest Soil | MFQFVHYSLLRTIEDGFRLDEYLGNSDAVTPIASVWSAPAG* |
| Ga0066903_1012122432 | 3300005764 | Tropical Forest Soil | AIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAISPIASIWRAPSR* |
| Ga0066903_1020248951 | 3300005764 | Tropical Forest Soil | CAILSPLATPGSYGQKYYHYSLLRTIEDGFRLRGYLGNASAVAPIASIWRTPTG* |
| Ga0070717_103595182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YSLLRTLEDGFGLRAYLGNANAVTPIASIWRTPAG* |
| Ga0070717_115190951 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPIASIWRPPPG* |
| Ga0070712_1005642031 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AGTYGQTYYHYSLLRTLEDGFGLRAYLGNANAVTPIATIWRTPTG* |
| Ga0066658_103353651 | 3300006794 | Soil | RAHYSLLRTLEDGFRLDGYVGYANDVKPITGMWR* |
| Ga0079221_102289122 | 3300006804 | Agricultural Soil | AAAGSYAHKYYHYSLLRTLEDGFRLGGYLGNAAAVGPIASIWRTPAG* |
| Ga0075425_1000696821 | 3300006854 | Populus Rhizosphere | HYSLLRTLEDGFGLAPYLGNANAVTPIASIWRPPPG* |
| Ga0075426_100174801 | 3300006903 | Populus Rhizosphere | DQKYYHYSVLRTIEDGFRLNSYLGNANAVTPVNDIWR* |
| Ga0099827_105212732 | 3300009090 | Vadose Zone Soil | AILSPLAIPGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ* |
| Ga0126374_108397482 | 3300009792 | Tropical Forest Soil | SYAHKYYHYSVLRTLEDGFRLGGHLGNANAVPPIAGTWRTPAR* |
| Ga0126384_106439402 | 3300010046 | Tropical Forest Soil | GRKYYHYSVLRTLEDGFRLGSYLGDANAVKPVNNIWR* |
| Ga0126384_108293521 | 3300010046 | Tropical Forest Soil | GSYGQKYYHYSVLRTVEDGFRLGGHLGAANAVPPIAGIWRAPAG* |
| Ga0126384_112148461 | 3300010046 | Tropical Forest Soil | QKYYHYSVLRTVEDGFRLGGHLGAANAVTPIAGIWRAPAG* |
| Ga0126373_100706811 | 3300010048 | Tropical Forest Soil | AIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVSPIASIWRAPSG* |
| Ga0126373_101989922 | 3300010048 | Tropical Forest Soil | VCAIISPLATAGSYDQQYYHDSLLRTIEDGFRLDGYLGNADAVTPIASIWHAPAS* |
| Ga0126373_115039912 | 3300010048 | Tropical Forest Soil | AIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVTPIASIWRPPAS* |
| Ga0126373_125106331 | 3300010048 | Tropical Forest Soil | SLLRTIEDGFRLDGYLGNADAVTPIASVWSATAG* |
| Ga0126373_129515091 | 3300010048 | Tropical Forest Soil | IISPLAIPGRYPQAYYHYSVLRTVEDGFRLAGYLGNANDVTPIASVWR* |
| Ga0126370_115709342 | 3300010358 | Tropical Forest Soil | CAIISPLAVAGSYGQKYYHYSLLRTIEDGFGLSSYLGNANAVTPINAVWQTRG* |
| Ga0126370_120304832 | 3300010358 | Tropical Forest Soil | PGSYDTKWYHYSLLRTLEDGFGISTYLGDANEVTPLSSIWRQT* |
| Ga0126376_100382151 | 3300010359 | Tropical Forest Soil | PGSYGQKYYHYSLLRTLEDGFSLGGYLGNANAVTPIARIWRTPAG* |
| Ga0126372_103868801 | 3300010360 | Tropical Forest Soil | SLLRTLEDGFRLGGYLGNANAVAPIASIWRPPAS* |
| Ga0126372_112473681 | 3300010360 | Tropical Forest Soil | PLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVSPIASIWRAPSG* |
| Ga0126378_102197414 | 3300010361 | Tropical Forest Soil | PGSYGQKYYHYSLLRTLEDGFRLRGYLGNASAVAPIASIWHAPTG* |
| Ga0126378_108352253 | 3300010361 | Tropical Forest Soil | CAIISPLAVPGSYGHKYYHYSLLRTLEDGFRLGGYLGNANNVTPIASIWRTPAN* |
| Ga0126378_109618831 | 3300010361 | Tropical Forest Soil | YHYSLLRTLEDGFRLGGYLGNAAAVGPIASIWRTPAG* |
| Ga0126378_123929231 | 3300010361 | Tropical Forest Soil | GQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIARIWRTRAG* |
| Ga0126379_124827011 | 3300010366 | Tropical Forest Soil | YYHYSLLRTLEDGFRLRGYLGNASAVAPIASIWHTPAG* |
| Ga0126381_1001023461 | 3300010376 | Tropical Forest Soil | YGQQYYHYCLPRTIEDGFRLGGYLGNADAVTPIASVWRAPAS* |
| Ga0126381_1014691281 | 3300010376 | Tropical Forest Soil | PLAVPGSYGHKYYHYSLLRTLEDGFGLRQYLGNANAVTPIASIWRTPAN* |
| Ga0126381_1048263742 | 3300010376 | Tropical Forest Soil | GSYGHKYYHYSLLRTLEDGFQLGRYLGNANAVTPIASIWQTPAN* |
| Ga0126383_110234721 | 3300010398 | Tropical Forest Soil | SLLRTLEDGFGLGAYLGNANAVTPIARIWRTPAG* |
| Ga0126383_115350362 | 3300010398 | Tropical Forest Soil | LAAAGSYGHTYYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRRPAN* |
| Ga0137391_104849301 | 3300011270 | Vadose Zone Soil | HYSLLRTIEDGLGLTGHVGNANDVTAINTIWRTPSS* |
| Ga0137389_100489536 | 3300012096 | Vadose Zone Soil | LSPLAIAGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ* |
| Ga0137365_110103802 | 3300012201 | Vadose Zone Soil | LTHYSVLRTLEDGFGISEYVGNANAVTAISEIWR* |
| Ga0137384_103873471 | 3300012357 | Vadose Zone Soil | LAVPGSYGQKYYHYSVLRTLEDGFGITSYLGDANEVSPISSIWRR* |
| Ga0137404_118772072 | 3300012929 | Vadose Zone Soil | QRLTHYSLLRTIEDGFGLGPYLGNANAVTPIASIWRAPVG* |
| Ga0126369_130138461 | 3300012971 | Tropical Forest Soil | GSYGQKYYHYSLLRTLEDGFDLGAYLGNANAVTPLARIWRTPTG* |
| Ga0182037_103918881 | 3300016404 | Soil | YYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG |
| Ga0187802_103376252 | 3300017822 | Freshwater Sediment | MFHVSSLLRTLEDGFGLPGYVGNANDVTPINGIWY |
| Ga0210402_110869681 | 3300021478 | Soil | ATAGSYGQQYFHYSLLRTLEDGFGLGPYLGSANAVTPIASIWRAPVH |
| Ga0126371_105488483 | 3300021560 | Tropical Forest Soil | SYGQKYYHYSLLRTLEDGFSLGGYLGNANAVTPIARIWRTPAG |
| Ga0126371_109261643 | 3300021560 | Tropical Forest Soil | SYGQKYYHYSLLRTLEDGFRLGGYLGNANNVTPIASIWRTPAN |
| Ga0126371_122549952 | 3300021560 | Tropical Forest Soil | VCAIISPLATAGSYDQQYYHDSLLRTIEDGFRLDGYLGNADAVTPIASIWHAPAS |
| Ga0126371_135916031 | 3300021560 | Tropical Forest Soil | GQKYYHYSLLRTLEDGFSLGAYLGNANAVTPIAGIWRTPAG |
| Ga0207692_101955292 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LATTATYGQTYYHYSLLRTLEDGFGLTPYLGNANAVTPIASIWRPPAS |
| Ga0207684_105899481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QTYYHYSVLRTIEDGFALPGYLGNANDVTPIASIWRAPAG |
| Ga0207700_103882031 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAVGSYRQKYYHYSLLRTLEDGFGLRGYLGHASAVTPIASIWRTPAGRR |
| Ga0207664_109119732 | 3300025929 | Agricultural Soil | AYAQKYFHYSLLRTLEDGFRLSGYLGNAGAVTPIASIWRTPAG |
| Ga0257153_11186751 | 3300026490 | Soil | HYSLLRTLEDGFRLGGYLGNANAVTPIASIWRTPAG |
| Ga0209178_11969751 | 3300027725 | Agricultural Soil | ISPLAFAGSYGQKYYHYSLLRTLEDGFRLDGYLGNANAVTAIGGIWRAPAG |
| Ga0209701_105547102 | 3300027862 | Vadose Zone Soil | ILSPLAISGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ |
| Ga0318571_103748231 | 3300031549 | Soil | KYYHYSLLRTVEDGFRLRGYLGDANRVAPIASVWRAPAG |
| Ga0318528_105094631 | 3300031561 | Soil | AVVIVLLAVPGSHGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS |
| Ga0318528_105527931 | 3300031561 | Soil | KYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG |
| Ga0318573_101027601 | 3300031564 | Soil | HYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN |
| Ga0318573_102851951 | 3300031564 | Soil | YYHYSLLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318555_105328591 | 3300031640 | Soil | CAIISPLAVAGSYGRQYYHYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318542_104525541 | 3300031668 | Soil | ILSPLATPGSYGQKYYHYSLLRTLEDGFRLHGYLGNANAVAPIASIWHTPTG |
| Ga0318560_106469691 | 3300031682 | Soil | YGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG |
| Ga0306917_100139557 | 3300031719 | Soil | LATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG |
| Ga0318493_100398184 | 3300031723 | Soil | YSLLRTVEDGFRLRGYLGKARAVAPIASIWRTPAG |
| Ga0318493_102907161 | 3300031723 | Soil | HYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG |
| Ga0318500_1000112810 | 3300031724 | Soil | RTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET |
| Ga0318501_100025781 | 3300031736 | Soil | GTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG |
| Ga0318501_107369211 | 3300031736 | Soil | HKYYHYSLLRTIQDGFGLRPYLGNASAVPPIARIWRPPAN |
| Ga0318492_105640662 | 3300031748 | Soil | SYGQTYYHYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG |
| Ga0318535_100322171 | 3300031764 | Soil | HYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318535_102928572 | 3300031764 | Soil | SYSHKYYHYSLLRTIQDGFGLRPYLGNASAVPPIARIWRPPAN |
| Ga0318535_104029511 | 3300031764 | Soil | TYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG |
| Ga0318554_101009251 | 3300031765 | Soil | KYYHYSLLRTLEDGFGLGAYLGNANAVTPIASIWHPPAG |
| Ga0318554_106954121 | 3300031765 | Soil | LATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG |
| Ga0318509_103187721 | 3300031768 | Soil | YYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG |
| Ga0318521_101028661 | 3300031770 | Soil | YSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG |
| Ga0318521_106458321 | 3300031770 | Soil | YYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAG |
| Ga0318566_103019922 | 3300031779 | Soil | IISRLAVPGSHGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS |
| Ga0318508_10257911 | 3300031780 | Soil | SPLAIAGAYGQTYYHYSLLRTLEDGFNLGGYLGNANAVTPIASIWRPPAN |
| Ga0318552_100314651 | 3300031782 | Soil | TYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG |
| Ga0318557_100467751 | 3300031795 | Soil | TYYHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET |
| Ga0318557_104725531 | 3300031795 | Soil | HYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS |
| Ga0318550_100390333 | 3300031797 | Soil | YHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN |
| Ga0318523_101225701 | 3300031798 | Soil | YSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN |
| Ga0318567_101625011 | 3300031821 | Soil | AQKYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG |
| Ga0318564_102700402 | 3300031831 | Soil | YSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318499_102996281 | 3300031832 | Soil | VCAIISPLAVAGSYGRKYYHYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318517_105193611 | 3300031835 | Soil | KYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318544_103227212 | 3300031880 | Soil | GQKYYHYSLLRTIEDGFSLRPYLGNANAVTPITGIWRPPAG |
| Ga0306925_104704412 | 3300031890 | Soil | SYARKYYHYSLLHTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318520_104336372 | 3300031897 | Soil | GSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0306923_123667171 | 3300031910 | Soil | YHYSLLRTLEDGFGLGAYLGNANAVTPIASIWHPPAG |
| Ga0310913_111486761 | 3300031945 | Soil | IISPLAVAGSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0310909_102235661 | 3300031947 | Soil | PLAVAGSYGHKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318563_104891001 | 3300032009 | Soil | AGSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318563_106670442 | 3300032009 | Soil | YSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318507_100124015 | 3300032025 | Soil | YHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET |
| Ga0318549_102447312 | 3300032041 | Soil | YGQTYYHYSLLRTLEDGFGLGGYLGNANAVTPINSIWQTPPG |
| Ga0318556_101070722 | 3300032043 | Soil | HYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG |
| Ga0318575_100042287 | 3300032055 | Soil | ATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG |
| Ga0318575_101575642 | 3300032055 | Soil | YYSYSLLRTLEDGFRLGGYLGNANTVAPIATIWRPPGG |
| Ga0318510_105546752 | 3300032064 | Soil | TAGSYAQKYYHYSLLRTLEDGFRLGGYLGNANKVAPIAGIWGAPGG |
| Ga0318514_104626901 | 3300032066 | Soil | ISPLAIAGAYGQTYYHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET |
| Ga0318514_105411252 | 3300032066 | Soil | SPLATAGSYAQKYYHYSLLRTLEDGFRLGGYLGNANKVAPIAGIWGAPGG |
| Ga0318524_106105501 | 3300032067 | Soil | YHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG |
| Ga0318524_106549281 | 3300032067 | Soil | AVGAGDGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS |
| Ga0306924_123001102 | 3300032076 | Soil | GSYGQKYYHYSLLRTIEDGFSLRPYLGSANAVTPITGIWRPPAG |
| Ga0318525_102363723 | 3300032089 | Soil | QKYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG |
| Ga0318525_106396542 | 3300032089 | Soil | YSLLRTLEDGFGLGGYLGNANAVTPINSIWQTPPG |
| Ga0318577_105873952 | 3300032091 | Soil | TYYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAG |
| Ga0307471_1000201306 | 3300032180 | Hardwood Forest Soil | PGSYGQKYYHYSLLRTLEDGFGLRPYLGNANAVTPIASIWRTPAG |
| Ga0307471_1034824362 | 3300032180 | Hardwood Forest Soil | PGSYGQKYYHYSLLRTFEDGYRLGTYLGDANAVTPVSDIWR |
| Ga0306920_1000163301 | 3300032261 | Soil | PLAIAGSYGQTYYHYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG |
| Ga0310914_113833502 | 3300033289 | Soil | HYSLLRTLEDGFRLGGYLGNANTVAPIATIWRPPGG |
| ⦗Top⦘ |