NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071483

Metagenome / Metatranscriptome Family F071483

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071483
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 47 residues
Representative Sequence MSDDQKDVLIAAYLFEDLAKRDFDAVVKLAEDKTITVEGVVLVQKD
Number of Associated Samples 115
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.18 %
% of genes near scaffold ends (potentially truncated) 98.36 %
% of genes from short scaffolds (< 2000 bps) 95.08 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.721 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.016 % of family members)
Environment Ontology (ENVO) Unclassified
(23.770 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.262 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.19%    β-sheet: 0.00%    Coil/Unstructured: 60.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00884Sulfatase 9.02
PF06897DUF1269 1.64
PF00285Citrate_synt 0.82
PF10009DUF2252 0.82
PF00749tRNA-synt_1c 0.82
PF07732Cu-oxidase_3 0.82
PF13471Transglut_core3 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG4803Uncharacterized membrane proteinFunction unknown [S] 1.64
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.82
COG0372Citrate synthaseEnergy production and conversion [C] 0.82
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.72 %
UnclassifiedrootN/A3.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004479|Ga0062595_101567923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300004617|Ga0068955_1322708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300005175|Ga0066673_10350423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300005435|Ga0070714_100676772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia994Open in IMG/M
3300005441|Ga0070700_100277514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1214Open in IMG/M
3300005444|Ga0070694_101338898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia603Open in IMG/M
3300005456|Ga0070678_101892528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005546|Ga0070696_100273201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1286Open in IMG/M
3300005547|Ga0070693_101648068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300005554|Ga0066661_10545422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300005555|Ga0066692_10246002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1128Open in IMG/M
3300005598|Ga0066706_10996510Not Available646Open in IMG/M
3300005615|Ga0070702_100059055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2224Open in IMG/M
3300005618|Ga0068864_100128266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2275Open in IMG/M
3300005718|Ga0068866_10473227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
3300005719|Ga0068861_102625003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300005952|Ga0080026_10104862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300006046|Ga0066652_101041463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia776Open in IMG/M
3300006175|Ga0070712_100843506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300006791|Ga0066653_10626819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300006797|Ga0066659_10442620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1031Open in IMG/M
3300006800|Ga0066660_11683111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300006804|Ga0079221_11305324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300006844|Ga0075428_100633473All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300006847|Ga0075431_101705787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300006853|Ga0075420_101517136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300006880|Ga0075429_101033901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300006904|Ga0075424_101191175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300009093|Ga0105240_11309155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300009094|Ga0111539_11502781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300009101|Ga0105247_11127322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300009137|Ga0066709_102999013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300009147|Ga0114129_12703876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300009148|Ga0105243_12728832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300009148|Ga0105243_12915110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300009156|Ga0111538_13726652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300009162|Ga0075423_11223093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300009162|Ga0075423_12383868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300009177|Ga0105248_11302472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300009551|Ga0105238_10322209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1532Open in IMG/M
3300009553|Ga0105249_12153839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300009812|Ga0105067_1069161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300009837|Ga0105058_1098260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300010041|Ga0126312_11127935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300010303|Ga0134082_10357007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300010320|Ga0134109_10174408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300010320|Ga0134109_10365694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300010371|Ga0134125_12518163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300010400|Ga0134122_12555966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300010403|Ga0134123_11087211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300011073|Ga0138584_1071933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300012200|Ga0137382_11122808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300012210|Ga0137378_11225846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012210|Ga0137378_11523339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300012212|Ga0150985_106118248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300012373|Ga0134042_1091468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300012378|Ga0134025_1183149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300012403|Ga0134049_1109669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012469|Ga0150984_107089918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300012897|Ga0157285_10068017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300012915|Ga0157302_10122295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300012924|Ga0137413_10307629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1110Open in IMG/M
3300012957|Ga0164303_11511245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012958|Ga0164299_10089870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1567Open in IMG/M
3300012985|Ga0164308_12180612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300012989|Ga0164305_10076336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2068Open in IMG/M
3300014325|Ga0163163_10507013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1268Open in IMG/M
3300014969|Ga0157376_10934001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300014969|Ga0157376_12671818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300015242|Ga0137412_10355785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300015371|Ga0132258_13036688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300015371|Ga0132258_13602664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1059Open in IMG/M
3300015373|Ga0132257_102588832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300016750|Ga0181505_11163259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300017654|Ga0134069_1111741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300017937|Ga0187809_10406744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300018043|Ga0187887_10921061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300018468|Ga0066662_10038400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2932Open in IMG/M
3300021078|Ga0210381_10061720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1150Open in IMG/M
3300021315|Ga0179958_1219061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300024288|Ga0179589_10561292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300025509|Ga0208848_1109894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300025898|Ga0207692_10744560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300025928|Ga0207700_11886847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300025929|Ga0207664_11154416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300025929|Ga0207664_11273785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300025935|Ga0207709_10306340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300025937|Ga0207669_11044724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300025944|Ga0207661_10368749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1298Open in IMG/M
3300025972|Ga0207668_10511403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300026023|Ga0207677_10909084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300026035|Ga0207703_10338502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1382Open in IMG/M
3300026078|Ga0207702_12422379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300026217|Ga0209871_1055855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300026295|Ga0209234_1082278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1221Open in IMG/M
3300026308|Ga0209265_1226952All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300026310|Ga0209239_1260803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300026899|Ga0209326_1012106Not Available660Open in IMG/M
3300027496|Ga0208987_1032064Not Available923Open in IMG/M
3300027530|Ga0209216_1018527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300027577|Ga0209874_1075545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300027696|Ga0208696_1037966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1724Open in IMG/M
3300027821|Ga0209811_10294346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300027952|Ga0209889_1014522All Organisms → cellular organisms → Bacteria1864Open in IMG/M
3300027961|Ga0209853_1014282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis2443Open in IMG/M
3300028596|Ga0247821_10672114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300028597|Ga0247820_10868903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300028608|Ga0247819_10175851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300028720|Ga0307317_10283012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300028778|Ga0307288_10070555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300028799|Ga0307284_10366945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300028889|Ga0247827_10563663Not Available723Open in IMG/M
3300029943|Ga0311340_10913367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300030000|Ga0311337_11184984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella668Open in IMG/M
3300031199|Ga0307495_10016834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1176Open in IMG/M
3300031708|Ga0310686_105928048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300031720|Ga0307469_11605468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300031740|Ga0307468_102353150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300032000|Ga0310903_10690492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300032126|Ga0307415_101913303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300032177|Ga0315276_11036651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300033550|Ga0247829_10083570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2358Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.92%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.46%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.46%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.64%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.82%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.82%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004617Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011073Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021315Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062595_10156792313300004479SoilMSDEHKDVLIAAYLFEDLAKKDFDAVLKLAEDKSITVEGVVLVQKD
Ga0068955_132270813300004617Peatlands SoilMSEDQKDVLITAYLFEDLAKRDFDAVLKLAEGKTITVEGVVLVQ
Ga0066673_1035042323300005175SoilMSDEQKDVVIAAYLFEDLAKKDFEAVLKLAEDKAITVERVVLVQKDAKGE
Ga0070714_10067677223300005435Agricultural SoilMSDDQKDVVIAAYLFEDLAKKDFEAVRKLAEDKAITVEGVVLVQKD
Ga0070700_10027751423300005441Corn, Switchgrass And Miscanthus RhizosphereMSDNPKDVLIAAYLIEDLAKKDFDALVKLAENKTIAVEGVVLV
Ga0070694_10133889823300005444Corn, Switchgrass And Miscanthus RhizosphereMSDDQKDVLIAAYLFEDLAKKDFDAVLKLVKDKAITVEGVVLVQKD
Ga0070678_10189252813300005456Miscanthus RhizosphereMSDDHKDVLIAAYLYEDLAKQDFDAVLKLAEDKAVTVEGV
Ga0070696_10027320123300005546Corn, Switchgrass And Miscanthus RhizosphereMSDDPKDVLIAAYLFEDLARQDFDAVVKLAEERTITVEGVVLVQKDADG
Ga0070693_10164806813300005547Corn, Switchgrass And Miscanthus RhizosphereMSKDEKDVLIAAYLIEDLAKRDFDAVVKLAEDNAISIEGIVLVQKDSDGEVH
Ga0066661_1054542213300005554SoilMSDKHKDVLIAAYLFEDLAKQDFDAVLKLAEQKTITVEGVVLVQKDDDGEVH
Ga0066692_1024600223300005555SoilMSDEHKDVVIAAYLFEDLAKKDFDAVLKLAEEKTITVEGVVLVQKDEEG
Ga0066706_1099651023300005598SoilMSDDQKDVLIAAYLFEDLAKQDFDAVLKLAEEKTI
Ga0070702_10005905523300005615Corn, Switchgrass And Miscanthus RhizosphereMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGV
Ga0068864_10012826623300005618Switchgrass RhizosphereMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLVQKDADGKVHVTETG
Ga0068866_1047322713300005718Miscanthus RhizosphereMSNDQKDVLIAAYLIEDLAKRDFDAVVQLAEENTITIEGIAVVQKDSDGEVHVTETG
Ga0068861_10262500323300005719Switchgrass RhizosphereMSDQKDVLIAAYLFEDLARKDFDAILKLAEGKAIT
Ga0080026_1010486223300005952Permafrost SoilMSDDTKDVLIAAYLFEDLAKRDFDAVLKLAEDKAITVEGVVLVQKDTDGE
Ga0066652_10104146323300006046SoilMSDDHKDVLIAVYLFEDLAKQDFDAVLKLAEDKTITVEGVVLVQKD
Ga0070712_10084350623300006175Corn, Switchgrass And Miscanthus RhizosphereMSDEHKDVLIAAYLFEDLAKKDFEAVLKLAEDKSITVEGVVLVQ
Ga0066653_1062681913300006791SoilMSDKQKDVVIAAYLFEDLAKQDFDAVVKLAEDKAITVEGVVLVQKD
Ga0066659_1044262023300006797SoilMTDNHKDVLIAAYLFEDLARKDFDAIVDLAEQKTITVEGVVLVQKDTDGEV
Ga0066660_1168311123300006800SoilMSDDQKDVLIAAYLFEDLAKRDYDAVVKLAEDKSITVEGVVLVQKDTDGKVHV
Ga0079221_1130532413300006804Agricultural SoilMSDDHKDVVIAAYLLEDLAKRDFDAVLKLAEDKTITVEG
Ga0075428_10063347313300006844Populus RhizosphereVLIAAYLIEDLAKRDFDAVVKLAEDDAITIEGIVLVQKDSDGEVHVTE
Ga0075431_10170578713300006847Populus RhizosphereMSNDQKDVLIAAYLIEDLAKRDFDAVVKLAEDNAITIEGIVLVQKDSDGEVHVTQTG
Ga0075420_10151713623300006853Populus RhizosphereMSDSQKDVLIAAYLFEDLAKKDFDAVLQLAENKTI
Ga0075429_10103390113300006880Populus RhizosphereMSDDNKDVLIAAYLIEDLAKRDFDAAVKLAEDKIVSLEGIVLVQKDSDGE
Ga0075424_10119117523300006904Populus RhizosphereMSDKQKDVMIAAYLVEDLAKRDFDAVLKLAEAKTITVEGVVVV
Ga0105240_1130915523300009093Corn RhizosphereMSDNPKDVLIAAYLIEDLAKKDFDALVKLAENKTIAV
Ga0111539_1150278123300009094Populus RhizosphereMSDDHKDVLIAAYLFEDLAKKDFDAVLKLAEDKTITVEGVVLVQKN
Ga0105247_1112732213300009101Switchgrass RhizosphereMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEG
Ga0066709_10299901313300009137Grasslands SoilMSDDRKDVLIAAYLFEDLAKRDFDAVLKLAEEGTITV
Ga0114129_1270387613300009147Populus RhizosphereMSDDQKDVLIAAYLIEDLAKRDFEAVVKLAEDKTVTLEGIV
Ga0105243_1272883223300009148Miscanthus RhizosphereMSDDHKDVLIAAYLYEDLAKQDFDAVLKLAEDKAITVEGVVLVQKDEAGEVNVK
Ga0105243_1291511013300009148Miscanthus RhizosphereMSDNPKDVLIAAYLIEDLAKKDFDALVKLAENKTIAVEGVVLVRKDSD
Ga0111538_1372665223300009156Populus RhizosphereMSDDKKDVLIAAYLIEDLAKKDFDAVVKLAEDKTVSLEGIV
Ga0075423_1122309323300009162Populus RhizosphereMSKDQKDVLIAAYLIEDLAKRDFDAVVRLAEDNAIAIEGIVLVQ
Ga0075423_1238386813300009162Populus RhizosphereMTSDQKDVLIAAYLIEDLARRDFDAVVKLAEDGAITLEGIVLVQKDSD
Ga0105248_1130247223300009177Switchgrass RhizosphereVRKEAQMSDDPKDVLIAAYLFEDLAKQDFDAVVKLAEERTITV
Ga0105238_1032220913300009551Corn RhizosphereMSDNPKDVLIAAYLIEDLAKKDFDALVKLAENKTIA
Ga0105249_1215383913300009553Switchgrass RhizosphereMSKDQKDVLIAAYLIEDLAKRDFDAVVKLAGDKTIAVEGIVLVQKDGDGEVHVT
Ga0105067_106916123300009812Groundwater SandMSDKKDVVIAAYLFEDLAKKDFDAVLKLAEDKTITVEG
Ga0105058_109826013300009837Groundwater SandMSDDQKDVVIAAYLFEDLAQQDFDAVLKLVEDKTITAEGVVLVQKDDKG
Ga0126312_1112793523300010041Serpentine SoilMSDDHKDVLIAAYLFEDLAKRDFEAILKLAEDETITVEGVAVVQKDPH
Ga0134082_1035700713300010303Grasslands SoilMSDDQKDVVIAAYLFEDLAKKDFDAVLKLAKDKAITVEG
Ga0134109_1017440813300010320Grasslands SoilMSDDQKDVLIAVYLFEDLAEQDFDAVLKLAEDETITVEG
Ga0134109_1036569413300010320Grasslands SoilMSDEHKDVLIAAYLFEDLAKKDFEAVLKLAADKEITVEGVVLVQKDA
Ga0134125_1251816323300010371Terrestrial SoilMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLVQKD
Ga0134122_1255596613300010400Terrestrial SoilMSDDQKDVLIAAYLFEDLAKRDFDAVVKLAGDKTIAVEGVVLVQKDGDGEVHVT
Ga0134123_1108721113300010403Terrestrial SoilMSDDQKDVLIAAYLIEDLAKRDFDAVVRLAEDSAIAIEGIVVVQKDSDGQVHIAETGDH
Ga0138584_107193323300011073Peatlands SoilMSEDQKDVLITAYLFEDLAKRDFDAVLKLAEGKTITVEGVVLVQK
Ga0137382_1112280813300012200Vadose Zone SoilMSDEKKDVLIAVYMFEDLAKKDFDAVVGLAENKAITVEGVVLVQKDAKG
Ga0137378_1122584623300012210Vadose Zone SoilMSDKHKDVLIAAYLFEDLAKQDFEAVLKLAEQKTITA
Ga0137378_1152333923300012210Vadose Zone SoilMSDEQKDVVIAAYLFDDLAKKDFEAVLKLAEDKVI
Ga0150985_10611824813300012212Avena Fatua RhizosphereMSNEHKDVLIAAYLFEYLAKRDFDAVLKLAEDKTI
Ga0134042_109146823300012373Grasslands SoilMSEDQKDVVIAAYLFEDLAKKDFDAVLKLAEDKAITVEGVVLV
Ga0134025_118314913300012378Grasslands SoilVSDEKKDVLIAVYMFEDLAKQDFDEVLRLAEHKAITVE
Ga0134049_110966913300012403Grasslands SoilMTDSQKDVVIAAYLFEDLAKRDFDAVLKLAEDKTITVEGVVVVQKDADGEV
Ga0150984_10708991823300012469Avena Fatua RhizosphereMSNEHKDVLIAAYLFEDLAKRDFDAVLKLAEDKTITVDGVVVVQKDADGEVHVIE
Ga0157285_1006801723300012897SoilMSDDQKDVLIAAYLFEDLAKRDFDAVVKLAEDKTITVEGVVLVQKD
Ga0157302_1012229513300012915SoilMSKDQKDVLIAAYLIEDLAKRDFDAVAKLAEDNTITIEGIVLVQKDSDGEAHVTE
Ga0137413_1030762913300012924Vadose Zone SoilMSDEHKDVLIAVYLFEDLAEKDFDAVLKLAEDKTITVEGVVLVQKDADGE
Ga0164303_1151124523300012957SoilMSDDQKDVLIAAYLFEDLAKQDFDAVLQLAEDKTITVEGVVLVQK
Ga0164299_1008987013300012958SoilMSNDQKDVLIAAYLIEDLAKRDFDAVVKLAEDNAIAIEGIVLVQKDSDG
Ga0164308_1218061223300012985SoilMSEDTKDVLIAAYLIEDLAKQDFDALLGLAEDGTITVEGVVLVQKDSDGEV
Ga0164305_1007633623300012989SoilMSDEQKDVVIAAYLFEGLAQKDFDAGRKLAEDKTITVEGVV
Ga0163163_1050701323300014325Switchgrass RhizosphereMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLVQKDADGKVH*
Ga0157376_1093400113300014969Miscanthus RhizosphereMSDNPKDVLIAAYLFEDLARQDFEAVVKLAEERTITVEGVVLVQKDSEGEVH
Ga0157376_1267181823300014969Miscanthus RhizosphereMTSDQKDVLIAAYLIEDLARRDFDAVVKLAEDGAITLEGIVLVQKDSDGDVHV
Ga0137412_1035578523300015242Vadose Zone SoilLSDNQQKDVLIAVYMFEDLAKQDFDAVMKLAESKTITVEGVVVVQKDSDGEVHV
Ga0132258_1303668813300015371Arabidopsis RhizosphereMSDKHKDVLIAAYLFEDLAKQDFDTVLGLAEDKTITVEGVV
Ga0132258_1360266423300015371Arabidopsis RhizosphereMSDSQKDVLIAAYLFEDLAQKDFETVLALAEQKEIIVEGVVLVQKDSDGEVHVTETGD
Ga0132257_10258883223300015373Arabidopsis RhizosphereMSDDPKDVLIAAYLFEDLAKKDFDAVMKLAEDKTITVEGVVLVQKDA
Ga0181505_1116325923300016750PeatlandMSDDQKDVLIAAYLFEDLAKRDYDAVVKLAEDKSITVDGVVLVQKDSDGEVHVTETG
Ga0134069_111174113300017654Grasslands SoilVSDDQKDVLIAAYLFEDLAKRDYDAVVKLAEDKSITVEGVVLVQKDSDG
Ga0187809_1040674423300017937Freshwater SedimentMSDKHKDVLIAAYLFEDLAKQDFDALLKLAEQKTITVEGVVLVQKDAG
Ga0187887_1092106123300018043PeatlandMSEEHKDVLIAAYLFEDLAKRDFDAVLKLAEEKTITVEGVVLVQKDAGGEVHV
Ga0066662_1003840033300018468Grasslands SoilMSDKHKDVLIAAYLFEDLAKQDFEAVLKLAGQKTITAEGVLLVQKDDDGEVHVTET
Ga0210381_1006172023300021078Groundwater SedimentVSDKQKDVLIAAYLFEDLAKKDFDTVLKLAEDKTITVEGV
Ga0179958_121906123300021315Vadose Zone SoilVSDEHKDVLIAVYLFEDLAEKDFNAVLKLAEDKTI
Ga0179589_1056129213300024288Vadose Zone SoilMSDDHKDVLIAAYLFEDLAKRDYDSVLKLAEQKAIKIEGVAVV
Ga0208848_110989413300025509Arctic Peat SoilMSDDKKDVLIAAYLFEDLAKRDFDAVLKLAEDKTI
Ga0207692_1074456013300025898Corn, Switchgrass And Miscanthus RhizosphereMSDDQKDVLIAAYLFEDLAKKDFDAVLKLAKDKAITVEGVVLVQKDAE
Ga0207700_1188684723300025928Corn, Switchgrass And Miscanthus RhizosphereMSDEHKDVLIAVYLFEDLAEKDFNAVLKLAEDKTITVEGVVLVQKDADGDVHVK
Ga0207664_1115441613300025929Agricultural SoilMSDDQKDVLIAAYLIEDLARRDFDAVVQLAEDHTITIEGIVLVQKDSDG
Ga0207664_1127378523300025929Agricultural SoilMSDDQKDVVIAAYLFEDLAKKDFEAVRKLAEDKAITVEGVVLVQKDAEGDVQVTE
Ga0207709_1030634023300025935Miscanthus RhizosphereMSDDQKDVLIAAYLYEDLAKEDFDAVLKLAEDKAITVEGVVLVQRTRRAR
Ga0207669_1104472413300025937Miscanthus RhizosphereMSNDQKDVLIAAYLIEDLAKRDFDAVVKLAEDNTITIEGIVLVQKDSDGEVHVSETG
Ga0207661_1036874923300025944Corn RhizosphereMRDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLV
Ga0207668_1051140313300025972Switchgrass RhizosphereMSDEQKDVLIAAYLYEDLAKEDFDAVLKLAEDKAITVEGVVLVQKDEAGEVNVKETG
Ga0207677_1090908413300026023Miscanthus RhizosphereMTSDQKDVLIAAYLIEDLAKRDFDAVVKLAEDGAITLEGIVLVQKDSDG
Ga0207703_1033850213300026035Switchgrass RhizosphereMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLVQKDADGKVH
Ga0207702_1242237923300026078Corn RhizosphereMSDEHKDVLIAAYLFEDLAKKDFEAVLKLAEDKSITVEGVVLVQKDADG
Ga0209871_105585513300026217Permafrost SoilMSDDKKDVLIAAYLFEDLAKRDFDAVMKLAEDKAITVEGVVLVQKDTDGEV
Ga0209234_108227823300026295Grasslands SoilMSDEQKDVVIAAYLFDDLAKKDFEAVLKLAEEKRITVEGVVLVQKDEKGEV
Ga0209265_122695213300026308SoilMSDEQKDVVIAAYLFEDLAKKDFEAVLQLAEDKAITVEGVVLVQKDAKGEV
Ga0209239_126080323300026310Grasslands SoilMSDEQKDVVIAAYLFDDLAKKDFEAVLKLAEDKVITVEGVVLVQKDAEGEVQVNETG
Ga0209326_101210613300026899Forest SoilMSDDPKDVLIAAYLFEDLAKQDFDAVLKLAEQKTI
Ga0208987_103206423300027496Forest SoilMSDDHKNVLIAAYLFEDLAERDFNAILKLAEEKTITVEGVALVQKDP
Ga0209216_101852723300027530Forest SoilMSKDQKDVLIAAYLIEDLARRDFDAVVALAENDAITIEGIVLVQKDGDGEV
Ga0209874_107554523300027577Groundwater SandMSDDHKDVLIAVYLIEELAKQDFDAVLKLAEDKTITVEGVVLVQKDADGKV
Ga0208696_103796613300027696Peatlands SoilMSEDQKDVLITAYLFEDLAKRDFDAVLKLAEGKTITVEGVVLVQKDTDGEVHVTETGDH
Ga0209811_1029434623300027821Surface SoilMSDKHKDVLIAAYLFEDLAKQDFDTVLELAEDKTITVEGVVLVQKDHEGEVSVTE
Ga0209889_101452233300027952Groundwater SandMSDDQKDVLIAVYLFEDLAKRDFDAVLKLAEDKTITVEGVVLVQKDAEGEVHVTETGDH
Ga0209853_101428223300027961Groundwater SandMTDSQKDVVIAAYLFEDLAKRDFDAVLKLAEDKTITVEGVVVVQKDAG
Ga0247821_1067211423300028596SoilMSDNPKDVLIAAYLIEDLAKQDFDAVVKLAEDKAITVEGVVLVQK
Ga0247820_1086890313300028597SoilMSDQKDVLIAAYLFEDLARKDFDAILKLAEGKAITIEGVVLVQKDADGEVHVTETG
Ga0247819_1017585113300028608SoilMSDQKDVLIAAYLFEDLARKDFDAILKLAEGKAITIEGVVLVQKDADGEVH
Ga0307317_1028301223300028720SoilMSDKHKDVLIAAYLFEDLAKKDFDSVLKLAEEKTINVEGV
Ga0307288_1007055523300028778SoilMSDKHKDVLIAAYLFEDLAKKDFDSVLKLAEEKTINVEGVVLVQKDDDGEVHVT
Ga0307284_1036694523300028799SoilVSDKQKDVLIAAYLFEDLAKKDFDTVLKLAEDKTITVEGVV
Ga0247827_1056366323300028889SoilMSKDQKDVLIAAYLIEDLAKRDFDAVVKLAEDDAITIEGIVLVQKDSDGEV
Ga0311340_1091336713300029943PalsaMSDDKKDVLIAAYLFEDLAQRDFDAVLQLAEDKAITVE
Ga0311337_1118498423300030000FenVSDDTKDVLIAVYLFEDLAKRDFDAVLALAEDLTITVEGVVLVQKD
Ga0307495_1001683413300031199SoilMSNDQKDVLIAAYLFEDLAKQDFDAVLKLAEDKTITVEGVVVVQKDSDGEVHVIEAGDHL
Ga0310686_10592804813300031708SoilMSDKHKDVLIAAYLFEDLAKQDFEAVLKLAEQKTITVEGVVLVQKDA
Ga0307469_1160546813300031720Hardwood Forest SoilMSDDQKDVLIAAYLYEDLAKQDFDAVLKLAEDKAITAEGVVL
Ga0307468_10235315013300031740Hardwood Forest SoilMSNGQKDVLIAAYLIEDLARRDFDSVVKLAEDNAITI
Ga0310903_1069049213300032000SoilMSKDQKDVLIAAYLIEDLAKRDFDAVVKLAEDNTITVEGIVLVQKDSDGEVHVSET
Ga0307415_10191330313300032126RhizosphereMSDDQKDVVIAAYLFEDLAKRDFDAVLKLAEDKTITVEGVV
Ga0315276_1103665113300032177SedimentMSDNHRDVLIAVYLFEDLAEKDFNAVLKLAEEKEIKVEGVVLVQKDANG
Ga0247829_1008357013300033550SoilMSKDQKDVLIAAYLIEDLAKRDFDAVVKLAEDDAITVEGIVLVQK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.