NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071464

Metagenome / Metatranscriptome Family F071464

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071464
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 52 residues
Representative Sequence SVKRFLLAQQTPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Number of Associated Samples 108
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 87.70 %
% of genes from short scaffolds (< 2000 bps) 80.33 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.213 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.410 % of family members)
Environment Ontology (ENVO) Unclassified
(27.049 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.984 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.00%    β-sheet: 18.67%    Coil/Unstructured: 65.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF14344DUF4397 74.59
PF04203Sortase 6.56
PF12681Glyoxalase_2 1.64
PF01184Gpr1_Fun34_YaaH 0.82
PF08386Abhydrolase_4 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 6.56
COG1584Succinate-acetate transporter SatPEnergy production and conversion [C] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.21 %
UnclassifiedrootN/A32.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig97424Not Available598Open in IMG/M
3300004156|Ga0062589_101019469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii775Open in IMG/M
3300005345|Ga0070692_10134242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1394Open in IMG/M
3300005354|Ga0070675_100272090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1487Open in IMG/M
3300005436|Ga0070713_102157499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium540Open in IMG/M
3300005437|Ga0070710_10103383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1700Open in IMG/M
3300005437|Ga0070710_11220381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300005439|Ga0070711_101180400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii661Open in IMG/M
3300005439|Ga0070711_101853921Not Available529Open in IMG/M
3300005445|Ga0070708_101099345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii745Open in IMG/M
3300005467|Ga0070706_100147285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2199Open in IMG/M
3300005545|Ga0070695_100087021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2078Open in IMG/M
3300005546|Ga0070696_100591145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii894Open in IMG/M
3300005618|Ga0068864_102296806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii546Open in IMG/M
3300005764|Ga0066903_105884869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii643Open in IMG/M
3300006175|Ga0070712_101905021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300006755|Ga0079222_11795497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii593Open in IMG/M
3300006806|Ga0079220_11336980Not Available603Open in IMG/M
3300006954|Ga0079219_10118225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1344Open in IMG/M
3300006954|Ga0079219_11708477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium583Open in IMG/M
3300009011|Ga0105251_10133779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1123Open in IMG/M
3300009545|Ga0105237_10025605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces6030Open in IMG/M
3300009792|Ga0126374_10434793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii928Open in IMG/M
3300009792|Ga0126374_11211027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii605Open in IMG/M
3300010043|Ga0126380_12063829Not Available523Open in IMG/M
3300010152|Ga0126318_10799263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1205Open in IMG/M
3300010333|Ga0134080_10110537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1138Open in IMG/M
3300010361|Ga0126378_10959467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii960Open in IMG/M
3300010362|Ga0126377_12756400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300010366|Ga0126379_11445560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii793Open in IMG/M
3300010376|Ga0126381_101492343Not Available977Open in IMG/M
3300010376|Ga0126381_104668817Not Available528Open in IMG/M
3300010398|Ga0126383_10381812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1440Open in IMG/M
3300010399|Ga0134127_10057141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3253Open in IMG/M
3300010403|Ga0134123_12254002Not Available607Open in IMG/M
3300012930|Ga0137407_11373223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300012948|Ga0126375_10475697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii925Open in IMG/M
3300012971|Ga0126369_11134657Not Available871Open in IMG/M
3300012971|Ga0126369_11717101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii717Open in IMG/M
3300013296|Ga0157374_11547425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii687Open in IMG/M
3300013307|Ga0157372_12552263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300014157|Ga0134078_10581109Not Available533Open in IMG/M
3300014166|Ga0134079_10188911Not Available857Open in IMG/M
3300016371|Ga0182034_11107836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii687Open in IMG/M
3300019361|Ga0173482_10113126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1004Open in IMG/M
3300019879|Ga0193723_1131041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii688Open in IMG/M
3300020075|Ga0206349_1428690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii878Open in IMG/M
3300020080|Ga0206350_11125807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii933Open in IMG/M
3300021171|Ga0210405_10926812Not Available661Open in IMG/M
3300021384|Ga0213876_10439621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii694Open in IMG/M
3300021560|Ga0126371_12858214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii585Open in IMG/M
3300024232|Ga0247664_1064285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii847Open in IMG/M
3300024283|Ga0247670_1021248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1163Open in IMG/M
3300024323|Ga0247666_1099881Not Available577Open in IMG/M
3300025898|Ga0207692_10044153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2222Open in IMG/M
3300025906|Ga0207699_10816673Not Available686Open in IMG/M
3300025909|Ga0207705_10239478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1382Open in IMG/M
3300025916|Ga0207663_10022674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3593Open in IMG/M
3300025916|Ga0207663_11242925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300025932|Ga0207690_10486859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii996Open in IMG/M
3300026089|Ga0207648_10224161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1671Open in IMG/M
3300026095|Ga0207676_10662460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1008Open in IMG/M
3300026319|Ga0209647_1316300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300027050|Ga0209325_1041948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
3300027775|Ga0209177_10183750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii733Open in IMG/M
3300027874|Ga0209465_10192811Not Available1016Open in IMG/M
3300027874|Ga0209465_10643173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300028784|Ga0307282_10210087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii931Open in IMG/M
3300028799|Ga0307284_10203937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii778Open in IMG/M
3300028811|Ga0307292_10248691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii738Open in IMG/M
3300031094|Ga0308199_1076009Not Available703Open in IMG/M
3300031546|Ga0318538_10306871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii855Open in IMG/M
3300031564|Ga0318573_10130654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1307Open in IMG/M
3300031564|Ga0318573_10463421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300031668|Ga0318542_10411656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii699Open in IMG/M
3300031681|Ga0318572_10846311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii544Open in IMG/M
3300031723|Ga0318493_10161797Not Available1164Open in IMG/M
3300031744|Ga0306918_11437274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii528Open in IMG/M
3300031751|Ga0318494_10892759Not Available521Open in IMG/M
3300031769|Ga0318526_10448760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii527Open in IMG/M
3300031770|Ga0318521_10851306Not Available556Open in IMG/M
3300031770|Ga0318521_11016886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii508Open in IMG/M
3300031781|Ga0318547_10540434Not Available721Open in IMG/M
3300031793|Ga0318548_10133925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1203Open in IMG/M
3300031798|Ga0318523_10451654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii637Open in IMG/M
3300031799|Ga0318565_10617449Not Available521Open in IMG/M
3300031819|Ga0318568_10820050Not Available577Open in IMG/M
3300031833|Ga0310917_10362040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii985Open in IMG/M
3300031846|Ga0318512_10415000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300031879|Ga0306919_10544206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii896Open in IMG/M
3300031879|Ga0306919_11240668Not Available566Open in IMG/M
3300031896|Ga0318551_10806707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii546Open in IMG/M
3300031897|Ga0318520_10771450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii603Open in IMG/M
3300031912|Ga0306921_12353289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii557Open in IMG/M
3300031939|Ga0308174_11688094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii544Open in IMG/M
3300031941|Ga0310912_10407205Not Available1059Open in IMG/M
3300032008|Ga0318562_10185066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1205Open in IMG/M
3300032008|Ga0318562_10339581Not Available873Open in IMG/M
3300032044|Ga0318558_10625269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300032066|Ga0318514_10053255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1963Open in IMG/M
3300032068|Ga0318553_10514395Not Available627Open in IMG/M
3300032180|Ga0307471_100858648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1075Open in IMG/M
3300032261|Ga0306920_100390597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2069Open in IMG/M
3300032770|Ga0335085_10190428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2523Open in IMG/M
3300032892|Ga0335081_10177750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2987Open in IMG/M
3300033134|Ga0335073_10617955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1206Open in IMG/M
3300033158|Ga0335077_11234630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii730Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.64%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0423.000059202166559005SimulatedDAATLNSVERSCSPSSPPSGLQIVTPVRLASGQAVLHVEYTAPNPLGLLGAPN
deepsgr_030548402199352025SoilSRPPFRPADVTTVRLASGQAVLHVEFTAPSPLGLLGAP
Ga0062589_10101946923300004156SoilLLAQQAPFRPADVTPVRLASGQAVLHVEYNAPSPLGLLGAPN*
Ga0070692_1013424213300005345Corn, Switchgrass And Miscanthus RhizosphereDAATLNSVKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPSPLGLLGAPN*
Ga0070675_10027209033300005354Miscanthus RhizosphereTLNSVKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN*
Ga0070713_10215749913300005436Corn, Switchgrass And Miscanthus RhizosphereAATLNAAKTFLLAQQSPYRPAVVTTVQLAGGRAALHVEFTAPSPLGLLGPPN*
Ga0070710_1010338313300005437Corn, Switchgrass And Miscanthus RhizosphereSLGALAAFLRAQLPPYRPARVTTLRLASGQTVLRVQFGAPEPLGLLGKS*
Ga0070710_1122038113300005437Corn, Switchgrass And Miscanthus RhizosphereRGRDAATLNSVKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN*
Ga0070711_10118040013300005439Corn, Switchgrass And Miscanthus RhizosphereLGALAAFLRAQLPPYRPARVTTLRLASGQTVLRVQFGAPEPLGLLGKS*
Ga0070711_10185392123300005439Corn, Switchgrass And Miscanthus RhizosphereDAATLDSVKRFLLAQQAPFRPADVTTVRLASGQTVLDVEFTAPSPLGLLGAP*
Ga0070708_10109934523300005445Corn, Switchgrass And Miscanthus RhizospherePLRSADISPAPAGPGGDAATLDSVKRFLLAQQAPFRPSDVTTVRLASGQTVLRVEFTAPSPLGLLGAPN*
Ga0070706_10014728543300005467Corn, Switchgrass And Miscanthus RhizosphereSVKRFLLAQQAPFRPSDVTTVRLASGQTVLRVEFTVPSPLGLLGAPN*
Ga0070695_10008702113300005545Corn, Switchgrass And Miscanthus RhizosphereDAATLNSMRRFLLAQQAPFRPADVTIVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0070696_10059114513300005546Corn, Switchgrass And Miscanthus RhizosphereDAATLNSVKRFLLAQQDPFRPADVTPLRLASGQAVLHVEYTAPSQLGLLGAPN*
Ga0068864_10229680623300005618Switchgrass RhizosphereKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0066905_10004991843300005713Tropical Forest SoilPFRPADVTTVRLASGQAVLHVECTAPSALGLLGALN*
Ga0066903_10416092523300005764Tropical Forest SoilPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0066903_10588486913300005764Tropical Forest SoilPAPAGGGRDAAALNSVKRFLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD*
Ga0070712_10190502113300006175Corn, Switchgrass And Miscanthus RhizosphereAPAGRGRDAATLNAVKRFLLAQQIAFRPADVTIVRLASGQTVLHVEFTAPSPLGLLAAPH
Ga0079222_1179549723300006755Agricultural SoilADISPIPAGRARDAATLDSVRRFLLAQQAPFRPADVTTVRLASGQTVLHIEFTAPSPLGLLGAPN*
Ga0079220_1133698023300006806Agricultural SoilADISSVPAGRGRDAATLDSVKRFLLAQQDPFRPADVTPLRLASGQAVLHVEYTAPNPLGLLGAPN*
Ga0075426_1023161713300006903Populus RhizosphereAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0079219_1011822533300006954Agricultural SoilPAPARRGRAAATLNAVKKFLLGQQAPFRPTQVTTVRLASGQTVLHVEFAAPSPLGLLGAPN*
Ga0079219_1170847713300006954Agricultural SoilLNAAKTFLLAQQSPYRPAVVTTVQLAGGRAALHVEFTAPSPLGLLGPPN*
Ga0105251_1013377913300009011Switchgrass RhizosphereISPVPAGRGRDAATLNSLKRFLLAQQAPFRPADVTPLRLASGQAVLHVEYTAPNPLGLLGAPN*
Ga0105247_1177673223300009101Switchgrass RhizospherePPYRPARMTTVRLASGQTVLRVQFGAPEPLGLLGKS*
Ga0105237_1002560593300009545Corn RhizospherePAGRGRDAASLNSVKRFLLAQQGPFRPADVTPLRLASGQAVLHVEYTAPSPLGLLGAPN*
Ga0126374_1043479323300009792Tropical Forest SoilFLLAQQAPFRPADVTTVRLASGQTVLRIEFTAPSPLGLLGAPS*
Ga0126374_1121102713300009792Tropical Forest SoilAATLNAVKRFLLAQQTAFRPADVTTVRLASGQTVVHVEFTAPSPLGLLGAPN*
Ga0126380_1206382913300010043Tropical Forest SoilGRDAATLNSVKRFLLAQQAPFRPADVTTVRLASGQTVLRVEFTAPTPLGLLGAPN*
Ga0126318_1079926323300010152SoilSANILPAPAGRGRDAATLNAVKRFLLAQQIAFRPADVTIVRLASGQTVLHVEFTAPSPLGLLGAPH*
Ga0134080_1011053713300010333Grasslands SoilLNSVKGFLLAQRAPFRPADVTIVRLASGQAVLHVEFTAPSPLGLLGAPN*
Ga0126370_1217813013300010358Tropical Forest SoilPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPN*
Ga0126372_1206687913300010360Tropical Forest SoilFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0126378_1095946723300010361Tropical Forest SoilDAVKRFLLAQQTAFRPADVTTVRLARGQAVLHVAFTAPSPLGLLGAPS*
Ga0126377_1275640023300010362Tropical Forest SoilADISPAPPRRGRAAATLNSVKRFLLAQQAPFRPAQVTTVRLTSGQTMLHVEFTAPSPLGLLGAPN*
Ga0126379_1144556013300010366Tropical Forest SoilLLAQQTAFRPADVTTVRLASGQTVVHVEFTAPSPLGLLGAPY*
Ga0105239_1039361113300010375Corn RhizospherePFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN*
Ga0126381_10149234323300010376Tropical Forest SoilFLLAQQSTFRPADVTTVRLASGRTVLRVGFTAPSPLGLLGAPMK*
Ga0126381_10466881723300010376Tropical Forest SoilHSVKSFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGGP*
Ga0126383_1038181213300010398Tropical Forest SoilSVKRFLLAQQTPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN*
Ga0134127_1005714113300010399Terrestrial SoilNSLKRFLLAQQAPFRPADVTPVRLASGQAVLHVEYTAPNPLGLLGAPN*
Ga0134123_1225400213300010403Terrestrial SoilEAVTLNSLKRFLLAQQAPFRPADVTPVRLASGQAVLHVEYTAPNPLGLLGAPN*
Ga0137382_1037051823300012200Vadose Zone SoilRPADVTTVRLASGQAVLHVEFTAPSPLGLLGTPH*
Ga0137407_1137322323300012930Vadose Zone SoilRDAATLNCVKRFLLAQQAPFRPADVTTVRLASGQAVLHVEFTAPSPLGLLGTPH*
Ga0126375_1047569713300012948Tropical Forest SoilPLRSADISPTLRRRGRDAATLNSVKRFLLAEQAPFRPADVTTVRLASGQAVPHVEFTAPSPLGLLGALN*
Ga0126369_1113465713300012971Tropical Forest SoilRGAATLDSVKRFLLAQQSTFRPADVTTVRLASGRTVLRVGFTAPSPLGLLGAPMK*
Ga0126369_1171710123300012971Tropical Forest SoilAPARRGRAAARLNSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGGPN
Ga0157374_1154742523300013296Miscanthus RhizosphereDAATLDSVKRFLLAQQAPFRPAAVTTVRLASGQTVLHVEFTAPSPLGLLGAPH*
Ga0163162_1100645413300013306Switchgrass RhizosphereQAPFRPADVTTVRLTSGQAVLHVEFTGPSPLGLLVALN*
Ga0157372_1255226323300013307Corn RhizosphereLRAQLPPYRPARVTTLRLASGQTVLRVQFGAPEPLGLLGKS*
Ga0134078_1058110923300014157Grasslands SoilFLLALQAPFRPADVTTVRLASGQAVLHVEFTAPSPLGLLGAPN*
Ga0134079_1018891113300014166Grasslands SoilDISLTLPRRGRDAATLNSVKRFLLAQQAPFRAADVTTVRLASGQAVLHVEFTGPSPLGLLVALN*
Ga0182034_1110783623300016371SoilAMLDSVKRFLLAQQAPFRPADLTIVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0173482_1011312613300019361SoilAATLNSVKRFLLAQQPPFRPANVTPVRLASGQAVLHVEYNAPNPLGLLGAPN
Ga0193723_113104123300019879SoilGVPLRWADISPVPAGRGRDAATLNSVKRFLLAQQDPFRPADVTPVRLASGQAVLHVEYTAPSPLGLLGAPN
Ga0206349_142869013300020075Corn, Switchgrass And Miscanthus RhizosphereFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN
Ga0206350_1112580723300020080Corn, Switchgrass And Miscanthus RhizosphereVKRFLLAQQDPFRPADVTPLRLASGQAVLHVEYTAPSPLGLLGAPN
Ga0210405_1092681213300021171SoilSVKGFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPN
Ga0213876_1043962113300021384Plant RootsRGRHAATLDSVRRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0126371_1074989113300021560Tropical Forest SoilAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0126371_1285821423300021560Tropical Forest SoilSATLNSVKRFLLAQQAPFRPADVTIVRLASGQTVLHVEFTAPSPLGLLGGP
Ga0247664_106428513300024232SoilNSVTRFLLAQQGPFRPADVTPLRLASGQAVLHVEFTAPSPLGLLGAPN
Ga0247670_102124823300024283SoilRSADISPAPAGRGRDAATLNSVKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN
Ga0247666_109988113300024323SoilASLNSVKRFLLAQQGPFRPADVTPLRLASGQAVLHVEYTAPNPLGLLGAPN
Ga0207692_1004415333300025898Corn, Switchgrass And Miscanthus RhizosphereIPAGRARDAATLDSVKRFLLAQQAPFRPADVTTVRLASGQTALHVEFTAPSPLGLLGAPN
Ga0207699_1081667313300025906Corn, Switchgrass And Miscanthus RhizosphereARRGRTAATLNSVKRFLLAQQAPFRPADVTTVRLANGQTVLHVGFTAPSPLGLLGAPN
Ga0207705_1023947833300025909Corn RhizosphereKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPNPLGLLGAPN
Ga0207654_1014836033300025911Corn RhizosphereAQQAPFRPADVTPVRLASGQAVLHVEYTAPNPLGLLGAPN
Ga0207663_1002267453300025916Corn, Switchgrass And Miscanthus RhizosphereIPAGRARDAATLDSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0207663_1124292513300025916Corn, Switchgrass And Miscanthus RhizosphereADISPGPAGRGRDAATLDSVKRFLLAQQAPFRPADVTTVQLASGQTVLHVEFTAPSPLGLLGAPN
Ga0207690_1048685913300025932Corn RhizosphereRFLLAQQGPFRPADVTPLRLASGQAVLHVEYTAPSPLGLLGAPN
Ga0207648_1022416133300026089Miscanthus RhizosphereSVKRFLLAQQPPFRPADVTPLRLASGHAVLHVEYTAPSQLGLLGAPN
Ga0207676_1066246013300026095Switchgrass RhizosphereAGRGRDAATLDSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0209647_131630013300026319Grasslands SoilGPGGDAATLDSVKRFLLAQQAPFRPSDVTTVRLASGQTVLRVEFTAPSPLGLLGAPN
Ga0209325_104194813300027050Forest SoilISSVPAGRGRDAATLNSVKRFLLAQQDPFRPADVTPLRLVSGQAVLHVEYTAPNPLGLLGAPN
Ga0209177_1018375013300027775Agricultural SoilTRFLLAQQGPFRPADVTPLRLASGQAVLHVEFTAPSPLGLLGAPN
Ga0209465_1019281123300027874Tropical Forest SoilDSVKRFLLAQQSTFRPADVTTVRLASGRTVLRVGFTAPSPLGLLGAPMK
Ga0209465_1064317323300027874Tropical Forest SoilPAPAGRGRDAATLNSVKRFLLAQQAPFRPADITTVRLASGQTVLRVEFTAPSPLGLLGAP
Ga0307282_1021008723300028784SoilDISLTLPCRGRDAATLNCVKRFLLAQQAPFRPADVTTVRLAGGQAVPHVEFTAPSPFGLLGALN
Ga0307284_1020393713300028799SoilGRDAATLNSVKRFLLAQQDPFRPADVTPVRLASGQAVLHVEFTAPSPLGCSGLSTEIRRP
Ga0307292_1024869113300028811SoilRDAATLNSVKRFLLAQQAPFRPADVTTVRLAGGQAVPHVEFTAPSPFGLLGALN
Ga0308192_102275223300031082SoilPQQAPFRPADVTTVRLASGQAVLHVEFTEPSPLGLLGALN
Ga0308199_107600913300031094SoilVRSAGISPTLPRRGRDAATLNSVKRFLLAQQAPFRPADVTTVRLARGQPCRMSKFPVPSPLGLLGALN
Ga0318538_1030687113300031546SoilAGAGDTSAPAGREAGAATLTSVKRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318573_1013065433300031564SoilAATLTSVKRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318573_1046342133300031564SoilVPLRSADISAAPAGGGRDAAALNSVKRFLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0318555_1006174413300031640SoilFRPADVTIVRLASVQTVLHVEFTAPSPLGLLRAPS
Ga0318542_1041165623300031668SoilVKSFLLAQQAPFRPADVTTVRLAGGQTVLHVEFTAPSPLGLLGGP
Ga0318572_1084631123300031681SoilLDSVKRFLLAQQAPFRPADLTIVRLASGQTVLHVEFTAPSPLGLLGALD
Ga0318493_1016179713300031723SoilVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0306918_1143727423300031744SoilDISPAPAGHGQDAGLTSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0318494_1089275913300031751SoilLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0318526_1044876013300031769SoilEAGAATLTSVQRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318521_1085130623300031770SoilAALNSVKRFLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0318521_1101688613300031770SoilSVKRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318547_1054043423300031781SoilRPGAVTLDAVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0318552_1053003023300031782SoilFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0318548_1013392523300031793SoilAAVDTITSLPSGPAFPAPAGGGRGAATLDSVKKFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318523_1045165423300031798SoilLLAQQAPVRPADLTIVRLASGQTVLHVEFTAPSPLGLLGALD
Ga0318565_1061744913300031799SoilGDAATLESLKRFLLAQQAPFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0318568_1082005023300031819SoilAPAPAGPRPGAVTLDAVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0310917_1036204023300031833SoilLRSADVSPAPAGREAGAATLTSVKRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0318512_1041500013300031846SoilPLRSADVSPAPAGREAGAATLTSVQRFLLAQQAPFRPAAVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0306919_1054420613300031879SoilAGDGRDAAMLDSVKRFLLAQQAPFRPADLTIVRLASGQTVLHVEFTAPSPLGLLGAPD
Ga0306919_1124066823300031879SoilLLAQQATFRPADVTTVRLASGETVLRVEFTAPSPLGLLGAPS
Ga0318551_1080670723300031896SoilDSVKRFLLAQQAPFRPADLTIVRLASGQTVLHVEFTAPSPLGLLGGP
Ga0318520_1077145023300031897SoilREAGAATLTSVKRFLLAQQAPFRPADVTIVRLAGGQAVLHVEFTAPSPLGLLAAPN
Ga0306921_1235328923300031912SoilDARLTSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0308174_1168809423300031939SoilAGRGRDVATLDSVKRFLLAQQAPFRPADVTTVRLASGQTVLHVEFTAPSPLGLLGAPN
Ga0310912_1040720513300031941SoilPAPAGPRPGAVTLDAVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAP
Ga0318562_1018506623300032008SoilPLRSADISAAPAGGGRDAAALNSVKRFLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0318562_1033958113300032008SoilPSGLGAVTLDAVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0318558_1062526913300032044SoilSIKRILLAQEGPFRPADVTIVRLASGQTVLHVEFTAPSPLGLLRAPS
Ga0318514_1005325513300032066SoilPRPGAVTLDAVKRFLLAQQATFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0318553_1051439523300032068SoilFLLAQQAPFRPADVTTVRLASGQAVLRVEFTAPSPLGLLGAPD
Ga0307471_10085864813300032180Hardwood Forest SoilASLNSVTRFLLAQQGPFRPADVTPLRLASGQAVLHVEYTAPSPLGLLGAPN
Ga0306920_10039059713300032261SoilTLESLKRFLLAQQAPFRPADVTTVRLASGQTVLRVEFTAPSPLGLLGAPS
Ga0335085_1019042843300032770SoilATLNSVTRFLLAQQALFRPADVTTMRLASGQTVLHIEFAAPSPLGLLGTPN
Ga0335081_1017775013300032892SoilGRGRDAATLNSVKRFLLAQQDPFRPADVTPLRLASGHAALHVEYTAPNPLGLLGPPN
Ga0335073_1061795543300033134SoilADGGGAAATLNAAKRFLLAQQPPYRAAEVTTVRLADGRTALRVEFTAPSPLGLLGP
Ga0335077_1123463023300033158SoilLAAFLRAQQPPYRPARVTTVRLPSGQTVLRVVYGAPEPLGLLGKS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.