Basic Information | |
---|---|
Family ID | F071447 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 38 residues |
Representative Sequence | EADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.72 % |
% of genes from short scaffolds (< 2000 bps) | 91.80 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.803 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.770 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.869 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.639 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.46% β-sheet: 12.70% Coil/Unstructured: 69.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF11731 | Cdd1 | 13.93 |
PF01784 | NIF3 | 7.38 |
PF00551 | Formyl_trans_N | 7.38 |
PF03551 | PadR | 5.74 |
PF13302 | Acetyltransf_3 | 5.74 |
PF14602 | Hexapep_2 | 4.10 |
PF00579 | tRNA-synt_1b | 2.46 |
PF01145 | Band_7 | 2.46 |
PF00586 | AIRS | 1.64 |
PF11949 | DUF3466 | 0.82 |
PF02769 | AIRS_C | 0.82 |
PF01266 | DAO | 0.82 |
PF07282 | OrfB_Zn_ribbon | 0.82 |
PF02574 | S-methyl_trans | 0.82 |
PF12681 | Glyoxalase_2 | 0.82 |
PF14534 | DUF4440 | 0.82 |
PF02517 | Rce1-like | 0.82 |
PF12706 | Lactamase_B_2 | 0.82 |
PF00230 | MIP | 0.82 |
PF07238 | PilZ | 0.82 |
PF04199 | Cyclase | 0.82 |
PF00106 | adh_short | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 7.38 |
COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 7.38 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 5.74 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 5.74 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 5.74 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.46 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.46 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.82 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.82 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.82 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.82 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.80 % |
Unclassified | root | N/A | 8.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_11521582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300001089|JGI12683J13190_1023077 | Not Available | 544 | Open in IMG/M |
3300001545|JGI12630J15595_10045588 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300004479|Ga0062595_102035042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 556 | Open in IMG/M |
3300004635|Ga0062388_101716038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300005553|Ga0066695_10387286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300005586|Ga0066691_10397215 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300005598|Ga0066706_11133285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300005764|Ga0066903_102524134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 995 | Open in IMG/M |
3300006052|Ga0075029_101013829 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300006059|Ga0075017_100286355 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300006176|Ga0070765_100281526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1533 | Open in IMG/M |
3300006755|Ga0079222_10451645 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300006794|Ga0066658_10908822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300006804|Ga0079221_11499125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300006854|Ga0075425_100841196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 1051 | Open in IMG/M |
3300006872|Ga0101947_1104350 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006954|Ga0079219_10645466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300007258|Ga0099793_10051952 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300009012|Ga0066710_102704596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300009038|Ga0099829_11164729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300009088|Ga0099830_11243664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300009089|Ga0099828_10491256 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300009162|Ga0075423_11668654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 686 | Open in IMG/M |
3300009521|Ga0116222_1149070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
3300010043|Ga0126380_10148547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
3300010321|Ga0134067_10001611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5252 | Open in IMG/M |
3300010321|Ga0134067_10066353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
3300010339|Ga0074046_10817187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300010358|Ga0126370_10180383 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300010360|Ga0126372_10281230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
3300010361|Ga0126378_11933823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300010366|Ga0126379_12616560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 602 | Open in IMG/M |
3300010861|Ga0126349_1193951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300011270|Ga0137391_11193366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300011271|Ga0137393_10258389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
3300012096|Ga0137389_11105469 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012189|Ga0137388_10550602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
3300012198|Ga0137364_11249773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300012203|Ga0137399_10337025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
3300012203|Ga0137399_10847014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300012207|Ga0137381_11431686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300012361|Ga0137360_10132238 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300012361|Ga0137360_10515392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300012363|Ga0137390_10991300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300012683|Ga0137398_10716880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 696 | Open in IMG/M |
3300012685|Ga0137397_10759698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300012918|Ga0137396_10619004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300012918|Ga0137396_10656782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300012925|Ga0137419_11764532 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300012925|Ga0137419_11891045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 512 | Open in IMG/M |
3300012930|Ga0137407_12349777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300012957|Ga0164303_10701101 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300013296|Ga0157374_10115528 | Not Available | 2585 | Open in IMG/M |
3300014152|Ga0181533_1027296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3418 | Open in IMG/M |
3300015054|Ga0137420_1430133 | Not Available | 2399 | Open in IMG/M |
3300015264|Ga0137403_10263806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
3300017823|Ga0187818_10504069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300017943|Ga0187819_10802149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300017947|Ga0187785_10541916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 587 | Open in IMG/M |
3300017973|Ga0187780_10223467 | Not Available | 1316 | Open in IMG/M |
3300017975|Ga0187782_11248002 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300017995|Ga0187816_10082485 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300018012|Ga0187810_10102084 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300019890|Ga0193728_1017601 | All Organisms → cellular organisms → Bacteria | 3588 | Open in IMG/M |
3300020579|Ga0210407_10014573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5842 | Open in IMG/M |
3300020581|Ga0210399_10617527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300021046|Ga0215015_10168871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300021088|Ga0210404_10309008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300021168|Ga0210406_10388877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
3300021168|Ga0210406_10425180 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300021170|Ga0210400_10381806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300021170|Ga0210400_10825252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300021420|Ga0210394_10256051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
3300021432|Ga0210384_11177694 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300021433|Ga0210391_10849447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300021559|Ga0210409_10893918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300021560|Ga0126371_12664856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 606 | Open in IMG/M |
3300024251|Ga0247679_1008229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1794 | Open in IMG/M |
3300024330|Ga0137417_1442118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2317 | Open in IMG/M |
3300025625|Ga0208219_1126014 | Not Available | 569 | Open in IMG/M |
3300025910|Ga0207684_10716408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 850 | Open in IMG/M |
3300025910|Ga0207684_11489181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 551 | Open in IMG/M |
3300026474|Ga0247846_1066356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300026529|Ga0209806_1327451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 514 | Open in IMG/M |
3300026557|Ga0179587_10048646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2430 | Open in IMG/M |
3300026557|Ga0179587_10383581 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300026800|Ga0207742_118849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300026872|Ga0207785_1022551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 550 | Open in IMG/M |
3300027330|Ga0207777_1041289 | Not Available | 829 | Open in IMG/M |
3300027535|Ga0209734_1094954 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300027635|Ga0209625_1110951 | Not Available | 615 | Open in IMG/M |
3300027643|Ga0209076_1080932 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300027674|Ga0209118_1200012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300027678|Ga0209011_1138301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300027765|Ga0209073_10220312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300027795|Ga0209139_10077018 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300027812|Ga0209656_10233468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
3300027862|Ga0209701_10147990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
3300028047|Ga0209526_10290867 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300028906|Ga0308309_11673243 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300030707|Ga0310038_10175348 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031545|Ga0318541_10651443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300031719|Ga0306917_10692100 | Not Available | 801 | Open in IMG/M |
3300031744|Ga0306918_10550011 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300031754|Ga0307475_11011448 | Not Available | 653 | Open in IMG/M |
3300031770|Ga0318521_10990391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 515 | Open in IMG/M |
3300031941|Ga0310912_10055752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2794 | Open in IMG/M |
3300031941|Ga0310912_11014387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 636 | Open in IMG/M |
3300031945|Ga0310913_10237727 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300031946|Ga0310910_10576327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300032001|Ga0306922_11533105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300032035|Ga0310911_10489147 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300032051|Ga0318532_10309298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 561 | Open in IMG/M |
3300032091|Ga0318577_10644229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 503 | Open in IMG/M |
3300032174|Ga0307470_10302759 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300032180|Ga0307471_103912217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300032261|Ga0306920_100117293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3952 | Open in IMG/M |
3300032954|Ga0335083_11346437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-12 | 547 | Open in IMG/M |
3300033158|Ga0335077_11685450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300033158|Ga0335077_11968674 | Not Available | 544 | Open in IMG/M |
3300033402|Ga0326728_10890887 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.21% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.28% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.46% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.64% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.82% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_115215821 | 3300000789 | Soil | KEAEADLKRRREKFYRIGRIEKGDTGKARVVYSGSLNL* |
JGI12683J13190_10230771 | 3300001089 | Forest Soil | EADLKKRREKFFRIGRIERSDSGKARVAYSGALNL* |
JGI12630J15595_100455881 | 3300001545 | Forest Soil | EADLKRRREKFFRIGRIERGDTGKARLVYSGALNL* |
Ga0062595_1020350422 | 3300004479 | Soil | VKKVEADLKRRREKFFQIGRIARGDTAKARVVYSGALNLG* |
Ga0062388_1017160382 | 3300004635 | Bog Forest Soil | VKSVEADLKKRREKFFRIGRIERSDSGKARVAYSGALNLG* |
Ga0066695_103872861 | 3300005553 | Soil | DLKKRREKFFRIGRIERGESGKARIFYSGTLQLQ* |
Ga0066691_103972151 | 3300005586 | Soil | ADLKKRREKSFLIGRIERGESGKARVSYAGSLNLA* |
Ga0066706_111332851 | 3300005598 | Soil | VKSVEADLKKHREKFFRIGRIERSESGKARVSYSGSLNL* |
Ga0066903_1025241343 | 3300005764 | Tropical Forest Soil | ADLKRRREKFFQIGRIERGDTAKARVVYSGALNLS* |
Ga0075029_1010138292 | 3300006052 | Watersheds | ATHVKEAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL* |
Ga0075017_1002863551 | 3300006059 | Watersheds | VEADLKKRREKFFLIGRIERSESGKARVTYSGSLQMQ* |
Ga0070765_1002815263 | 3300006176 | Soil | DLKKRREKFFRIGRIERGESGKPRVTYSGSLSLS* |
Ga0079222_104516453 | 3300006755 | Agricultural Soil | ADLKKRREKFFRIGRIERAESGKSRVSFTGSLNL* |
Ga0066658_109088222 | 3300006794 | Soil | KNVKSVEADLKKHREKFFRVGRIERSESGKARIAYSGSLQMP* |
Ga0079221_114991251 | 3300006804 | Agricultural Soil | DLKKHREKFFRIGRIERGESGKARVSYSGSLNLG* |
Ga0075425_1008411961 | 3300006854 | Populus Rhizosphere | KKVEADLKRRREKFFQIGRIERGDTAKARVVYSGALSL* |
Ga0101947_11043502 | 3300006872 | Drinking Water Pipes | LKRRREKFYRIGRIEPLASGSNKPRVAFSGSLQL* |
Ga0079219_106454662 | 3300006954 | Agricultural Soil | VEVDLKRRREKFFRIGRIDRGDSGKARVKFSGSLGL* |
Ga0099793_100519523 | 3300007258 | Vadose Zone Soil | VEADLKKRREKFFLIGRIGRGESGKARVSYAGSLNLA* |
Ga0066710_1027045961 | 3300009012 | Grasslands Soil | PPAYIKQVEADLKRRREKFYRIGRIERGEPGKCRIAYSGALNL |
Ga0099829_111647291 | 3300009038 | Vadose Zone Soil | VEADLKKRREKFFRIGRIERSESGKARVAYTGSLHL* |
Ga0099830_112436641 | 3300009088 | Vadose Zone Soil | KVEAELKHRREKFFRIGRVERAAPNKNRVVYSGSLNL* |
Ga0099828_104912562 | 3300009089 | Vadose Zone Soil | VRSVEADLKKRREKFFLIGRIERGESGKARVSYSGSLNLA* |
Ga0075423_116686542 | 3300009162 | Populus Rhizosphere | QAHVQSVEADLKRRREKFHRIGRIEKGDSGKAKVKFSASLAL* |
Ga0116222_11490703 | 3300009521 | Peatlands Soil | KEVEADLKRRREKFYRIGRIERGDTGKARLVYSGALNL* |
Ga0126380_101485474 | 3300010043 | Tropical Forest Soil | EFVKDAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL* |
Ga0134067_100016117 | 3300010321 | Grasslands Soil | AHLKKRREKFFRIGRIDRSESGKARVAYSGSLQMQ* |
Ga0134067_100663531 | 3300010321 | Grasslands Soil | VKSVEADLKKHREKFFRIGRMERSESGKARVSYSGSLNL* |
Ga0074046_108171872 | 3300010339 | Bog Forest Soil | EADLKRRREKFFRIGRIERADSGKPRVAHSGSLSL* |
Ga0126370_101803834 | 3300010358 | Tropical Forest Soil | KEAEADLKRRREKFFRIGRSERGDTGKARLVYSGARNL* |
Ga0126372_102812303 | 3300010360 | Tropical Forest Soil | FVKSVEADLKKRREKFYRIGRIERAESGKPRVSFSASLNL* |
Ga0126378_119338232 | 3300010361 | Tropical Forest Soil | EADLKKRREKFYRIGRIERAESGKSRVSFSASLNL* |
Ga0126379_126165601 | 3300010366 | Tropical Forest Soil | AKVQSVEADLKRRREKFFRIGRIERGDSGKARVIYTGALHL* |
Ga0126349_11939511 | 3300010861 | Boreal Forest Soil | EADLKKRREKFFRIGRIERSESGKARVTYSGSLNL* |
Ga0137391_111933661 | 3300011270 | Vadose Zone Soil | EADLKKRREKFFRIGRIERGESGKARVSYSGALQMQ* |
Ga0137393_102583891 | 3300011271 | Vadose Zone Soil | NVRSVEADLKKRREKFFLIGRIERGESGKARVTYCGSLNL* |
Ga0137389_111054691 | 3300012096 | Vadose Zone Soil | PVEADLKRRREKFFRIGRIERGDSGKARVKFSGSLNL* |
Ga0137388_105506023 | 3300012189 | Vadose Zone Soil | PADHVKVAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL* |
Ga0137364_112497731 | 3300012198 | Vadose Zone Soil | KNVKSVEAHLKKRREKFFRIGRIDRSESGKARVAYSGSLQMQ* |
Ga0137399_103370251 | 3300012203 | Vadose Zone Soil | KSVEADLKKHREKFFRIGRIERGESGKARVSYSGSLQM* |
Ga0137399_108470141 | 3300012203 | Vadose Zone Soil | RVKSVEADLKKHREKFFRIGRIERGESGKARVSYSGSLQM* |
Ga0137381_114316862 | 3300012207 | Vadose Zone Soil | KSVEADLKKRREKFFRIGRIERAESGKSRVSFTGSLNL* |
Ga0137360_101322381 | 3300012361 | Vadose Zone Soil | DLKRRREKFFRIGRIERGDSGKARVKFSGSLGLQ* |
Ga0137360_105153923 | 3300012361 | Vadose Zone Soil | ADLKKRREKFFRIGRIERSESGKARVAYTGSLQMK* |
Ga0137390_109913002 | 3300012363 | Vadose Zone Soil | VKPVEADLKRRREKFFRIGRIERGDSGKARVKFSGSLNL* |
Ga0137398_107168801 | 3300012683 | Vadose Zone Soil | VETDLKRRREKFFQIGRIERGDTAKARVVYSGALSL* |
Ga0137397_107596982 | 3300012685 | Vadose Zone Soil | ADLKRRREKFFQIGRIERGDTAKARVVYSGALSL* |
Ga0137396_106190043 | 3300012918 | Vadose Zone Soil | VEADLKKRREKFFRIGRIERSESGKARVAYSGSLSL* |
Ga0137396_106567821 | 3300012918 | Vadose Zone Soil | AVEADLKKRREKFFRIGRIERSESGKARVAYSGSLRI* |
Ga0137419_117645321 | 3300012925 | Vadose Zone Soil | ADLKRRREKFFRIGRIERGDSGKARIKFSGSLGL* |
Ga0137419_118910451 | 3300012925 | Vadose Zone Soil | VEADLKRRREKFFNIGRIERGDTAKARVAYSGALNL* |
Ga0137407_123497772 | 3300012930 | Vadose Zone Soil | VEADLKKRREKFFLIGRIERSESGKARVTYSGSLNL* |
Ga0164303_107011011 | 3300012957 | Soil | ADLKRRREKFFNVGRIERGDTAKARVAYSGALNL* |
Ga0157374_101155283 | 3300013296 | Miscanthus Rhizosphere | QAHVQSVEADLKRRREKFHRIGRIETGESGKAKVKFSASLAV* |
Ga0181533_10272963 | 3300014152 | Bog | EADLKRRREKFFRIGRIERGDTGKARLVYSGALSL* |
Ga0137420_14301332 | 3300015054 | Vadose Zone Soil | MCVAVEADLKKRREKFFRIGRMERSESGKAASPTAVSLHL* |
Ga0137403_102638061 | 3300015264 | Vadose Zone Soil | KSVEADLKKHREKFFRIGRIERSESGKARVAYSGSLNL* |
Ga0187818_105040692 | 3300017823 | Freshwater Sediment | EADLKRRREKYYRIGRIERGDTGKARLVYSGALSL |
Ga0187819_108021492 | 3300017943 | Freshwater Sediment | AEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0187785_105419162 | 3300017947 | Tropical Peatland | EAEADLKRRREKFFKIGRIERGDTGKARLIYSGALSL |
Ga0187780_102234674 | 3300017973 | Tropical Peatland | EADLKRRREKFFRIGRIERGDTGKARMIYSGALNLA |
Ga0187782_112480021 | 3300017975 | Tropical Peatland | IQFVESDLKRRREKFFRIGRIERGDSGKACIKFTGSLNL |
Ga0187816_100824854 | 3300017995 | Freshwater Sediment | VKNAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL |
Ga0187810_101020841 | 3300018012 | Freshwater Sediment | EHVKNAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0193728_10176015 | 3300019890 | Soil | PAQVKYVEADLKKRREKFYRIGRIERSDSGKARLAYSGTLSL |
Ga0210407_100145731 | 3300020579 | Soil | SNVKAVEIDLKKRREKFFRIGRIERGDPGKARVVYSGSLNL |
Ga0210399_106175271 | 3300020581 | Soil | SVEADLKRRREKFFRIGRIERADSDKARVSYTGTLNL |
Ga0215015_101688712 | 3300021046 | Soil | MCIRDSVEADLKRRREKFFRIGRVERADSGKARVSYTGALNL |
Ga0210404_103090081 | 3300021088 | Soil | SVEADLKKHREKFFRIGRIERGESGKARVSYSGSLQM |
Ga0210406_103888771 | 3300021168 | Soil | VEADLKRRREKFFRIGRIERGDSGKARVTYTGSLHL |
Ga0210406_104251802 | 3300021168 | Soil | KLVEADLKRRREKFFRIGRIARGDSGKARVKFSGTLGL |
Ga0210400_103818061 | 3300021170 | Soil | EADLKRRREKFFRIGRIERGDSGKARVTYTGSLHL |
Ga0210400_108252522 | 3300021170 | Soil | VEADLKRRREKFFRIGRIERSDSGKARVKFSGSLRL |
Ga0210394_102560512 | 3300021420 | Soil | TVEAALKKHREKFFRIGRIERSESGKARVSYSGSLNL |
Ga0210384_111776943 | 3300021432 | Soil | VKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0210391_108494472 | 3300021433 | Soil | KEAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL |
Ga0210409_108939181 | 3300021559 | Soil | VETDLKRRREKFVRIGRIERGDSGKSKVKFSGSLGL |
Ga0126371_126648561 | 3300021560 | Tropical Forest Soil | VEADLKRRREKFFQIGRIERGDTAKARVVYSGALNLS |
Ga0247679_10082291 | 3300024251 | Soil | VEADLKRRREKFFRIGRIERSDSGKARVAHSGSLNL |
Ga0137417_14421182 | 3300024330 | Vadose Zone Soil | VKSVEADLKKHREKFFRIGRIERGESGKARVSYSGSLQM |
Ga0208219_11260141 | 3300025625 | Arctic Peat Soil | PAQVRFVEGDLKKRREKFFRIGRIERSDSGKARLAYSGALGL |
Ga0207684_107164081 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EADLKRRREKFFQIGRIERGDTAKARVVYSGALNL |
Ga0207684_114891812 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SAYVKKVEADLKRRREKFFQIGRVERGDTAKARVVYSGALSF |
Ga0247846_10663562 | 3300026474 | Soil | AHVKEVEADLKRRREKFFRIGRIERGDTGKARLVYSGALSL |
Ga0209806_13274511 | 3300026529 | Soil | YIKQVEADLKRRREKFYRIGRIERGEPGKCRIAYSGALNL |
Ga0179587_100486461 | 3300026557 | Vadose Zone Soil | KRVKSVEADLKKHREKFFRIGRIERSESGKARVSYSGSLQM |
Ga0179587_103835812 | 3300026557 | Vadose Zone Soil | VKSVEADLKKRREKFFLIGRIGRGESGKARVSYAGSLNLA |
Ga0207742_1188491 | 3300026800 | Tropical Forest Soil | EFVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALSLA |
Ga0207785_10225511 | 3300026872 | Tropical Forest Soil | KEAEADLKRRREKFYRIGRIERGDTGKARLVYSGALNL |
Ga0207777_10412892 | 3300027330 | Tropical Forest Soil | VKEVEADLKRRREKFFRIGRIDKGDTGKARVVYSGALNL |
Ga0209734_10949542 | 3300027535 | Forest Soil | EADLKRRREKFFRIGRIERGDSGKARVKFSGALSL |
Ga0209625_11109511 | 3300027635 | Forest Soil | VEGDLKKRREKFFRIGRIERSDSGKARVAYSGALGL |
Ga0209076_10809322 | 3300027643 | Vadose Zone Soil | EADLKKRREKFFLIGRIERGESGKARVSYSGSLNLA |
Ga0209118_12000121 | 3300027674 | Forest Soil | VEAELKKHREKFFRIGRIERSESGKARVSYSGSLQM |
Ga0209011_11383011 | 3300027678 | Forest Soil | PPQFVKSVEADLKRRREKFFRIGRIERGDSGKACVKFSGALQIH |
Ga0209073_102203121 | 3300027765 | Agricultural Soil | VKSVEADLKKRREKFFRIGRVERAESGKSRVAFTGSLNL |
Ga0209139_100770181 | 3300027795 | Bog Forest Soil | EAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0209656_102334683 | 3300027812 | Bog Forest Soil | YVKEAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL |
Ga0209701_101479901 | 3300027862 | Vadose Zone Soil | VEADLKKHREKFFLIGRIERGESGKARVVYSGSLQMA |
Ga0209526_102908672 | 3300028047 | Forest Soil | EADLKKRREKFFLIGRIGRGESGKARVSYAGSLNLA |
Ga0308309_116732431 | 3300028906 | Soil | VKDAEADLKRRREKFFRIGRIERGDTGKARLIYSGALNL |
Ga0310038_101753481 | 3300030707 | Peatlands Soil | EVEADLKRRREKFYRIGRIERGDTGKARLVYSGALNL |
Ga0318541_106514432 | 3300031545 | Soil | EADLKRRREKFFQIGRIERGDTARARVVYSGALNL |
Ga0306917_106921001 | 3300031719 | Soil | HVKNAEADLKRRREKFYRIGRIERGDTGKARLVYSGALSL |
Ga0306918_105500112 | 3300031744 | Soil | KVEADLKRRREKFFQIGRIERGDTARARVVYSGALNL |
Ga0307475_110114481 | 3300031754 | Hardwood Forest Soil | EGDLKKRREKFLRIGRIERSDSGKARVAYSGALGL |
Ga0318521_109903911 | 3300031770 | Soil | EFVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0310912_100557521 | 3300031941 | Soil | EADLKRRREKFFQIGRIERGDTAKARVVYSGALNLG |
Ga0310912_110143872 | 3300031941 | Soil | EADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0310913_102377274 | 3300031945 | Soil | HVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0310910_105763272 | 3300031946 | Soil | SEFVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0306922_115331052 | 3300032001 | Soil | KSVEADLKKRREKFYLIGRMERSDSGKARVAYSGSLHL |
Ga0310911_104891472 | 3300032035 | Soil | FVKEAEADLKRRREKFYRIGRIERGDTGKARLVYSGALNL |
Ga0318532_103092981 | 3300032051 | Soil | VKEAEADLKRRREKFFKIGRIERGDTGKARLIYSGALNL |
Ga0318577_106442291 | 3300032091 | Soil | AEFVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNS |
Ga0307470_103027592 | 3300032174 | Hardwood Forest Soil | EADLKRRREKFHRIGRIEKGDSGKARVKFSGSMTL |
Ga0307471_1039122172 | 3300032180 | Hardwood Forest Soil | EVALKRRREKFFRIGRIERGDSGKARVKFSGSLGL |
Ga0306920_1001172936 | 3300032261 | Soil | LEFVKEAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0335083_113464371 | 3300032954 | Soil | EADLKRRREKFFKIGRIERGDTGKARLIYSGALSL |
Ga0335077_116854501 | 3300033158 | Soil | EFVKEVEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0335077_119686741 | 3300033158 | Soil | AEHVKNAEADLKRRREKFFRIGRIERGDTGKARLVYSGALNL |
Ga0326728_108908872 | 3300033402 | Peat Soil | EAELKRRREKFFLIGRIELNPRRKPRVVYAGELSL |
⦗Top⦘ |