| Basic Information | |
|---|---|
| Family ID | F071423 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EPEDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.18 % |
| % of genes from short scaffolds (< 2000 bps) | 91.80 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.230 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.180 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 0.00% Coil/Unstructured: 87.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF12704 | MacB_PCD | 11.48 |
| PF14125 | DUF4292 | 4.10 |
| PF02687 | FtsX | 3.28 |
| PF00005 | ABC_tran | 1.64 |
| PF00891 | Methyltransf_2 | 0.82 |
| PF01128 | IspD | 0.82 |
| PF17131 | LolA_like | 0.82 |
| PF13927 | Ig_3 | 0.82 |
| PF07969 | Amidohydro_3 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.82 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.82 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1186061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3122 | Open in IMG/M |
| 2228664022|INPgaii200_c1186172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101325543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300000955|JGI1027J12803_102611400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300001154|JGI12636J13339_1046679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300001431|F14TB_104809488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300002558|JGI25385J37094_10190003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005177|Ga0066690_10268241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300005440|Ga0070705_100879111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300005526|Ga0073909_10147425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300005586|Ga0066691_10241910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300005610|Ga0070763_10799812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005712|Ga0070764_10341030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300006162|Ga0075030_101386608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006176|Ga0070765_101918887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300006354|Ga0075021_10970986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300006603|Ga0074064_10553251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300006806|Ga0079220_10181347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300006893|Ga0073928_10330750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1134 | Open in IMG/M |
| 3300006904|Ga0075424_100007895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10353 | Open in IMG/M |
| 3300006954|Ga0079219_10951788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300007255|Ga0099791_10128735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300007265|Ga0099794_10292387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300009090|Ga0099827_10056557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2972 | Open in IMG/M |
| 3300009522|Ga0116218_1351298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300009523|Ga0116221_1393788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 603 | Open in IMG/M |
| 3300009665|Ga0116135_1384462 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009792|Ga0126374_10615591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300010046|Ga0126384_10983446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300010303|Ga0134082_10043251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1717 | Open in IMG/M |
| 3300010341|Ga0074045_11066340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300011269|Ga0137392_10903700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300011269|Ga0137392_11258147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300011271|Ga0137393_11533842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012096|Ga0137389_10244177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300012202|Ga0137363_10887024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300012203|Ga0137399_10136971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1942 | Open in IMG/M |
| 3300012205|Ga0137362_10357110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1265 | Open in IMG/M |
| 3300012205|Ga0137362_11691607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012361|Ga0137360_11847464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012363|Ga0137390_10015816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6849 | Open in IMG/M |
| 3300012363|Ga0137390_10852940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300012925|Ga0137419_10341328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300012929|Ga0137404_11077848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012931|Ga0153915_10519737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1362 | Open in IMG/M |
| 3300012944|Ga0137410_11953227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300015053|Ga0137405_1229700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300015054|Ga0137420_1106063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3560 | Open in IMG/M |
| 3300015193|Ga0167668_1019573 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300015241|Ga0137418_10114566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2411 | Open in IMG/M |
| 3300017955|Ga0187817_10471291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300018006|Ga0187804_10097163 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300018006|Ga0187804_10160157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300018086|Ga0187769_11322268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300018088|Ga0187771_10057950 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300018088|Ga0187771_10414846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300019789|Ga0137408_1041127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300020140|Ga0179590_1097317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300020199|Ga0179592_10012989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3629 | Open in IMG/M |
| 3300020579|Ga0210407_11101530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300020580|Ga0210403_10218292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1565 | Open in IMG/M |
| 3300020580|Ga0210403_11360068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300020581|Ga0210399_11346949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021088|Ga0210404_10293683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300021088|Ga0210404_10298375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300021171|Ga0210405_11214836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021180|Ga0210396_10327453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300021180|Ga0210396_10589550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300021403|Ga0210397_10636772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300021406|Ga0210386_11590098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300021433|Ga0210391_11275684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300021433|Ga0210391_11425477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021476|Ga0187846_10191910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300021478|Ga0210402_11538588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021478|Ga0210402_11925952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300021559|Ga0210409_11392818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300021559|Ga0210409_11663338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300022557|Ga0212123_10245612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300024310|Ga0247681_1056389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300024330|Ga0137417_1121097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300025905|Ga0207685_10057545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300026301|Ga0209238_1129214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300026325|Ga0209152_10346328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300026959|Ga0207852_1001003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3427 | Open in IMG/M |
| 3300027023|Ga0207736_104427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300027034|Ga0209730_1044561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027297|Ga0208241_1070449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027576|Ga0209003_1080756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300027643|Ga0209076_1178593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027655|Ga0209388_1067480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300027674|Ga0209118_1182566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027745|Ga0209908_10046364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300028536|Ga0137415_10927278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300028746|Ga0302233_10429765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300028884|Ga0307308_10073648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
| 3300029636|Ga0222749_10123268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300030617|Ga0311356_11584658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300031170|Ga0307498_10321452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031543|Ga0318516_10853709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031708|Ga0310686_102644889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300031708|Ga0310686_109993245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1385 | Open in IMG/M |
| 3300031740|Ga0307468_101084503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031753|Ga0307477_10671487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300031753|Ga0307477_10815118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031770|Ga0318521_10474002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300031820|Ga0307473_11056668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300031823|Ga0307478_10261090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300031879|Ga0306919_10249667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
| 3300031893|Ga0318536_10642484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031912|Ga0306921_12559914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031945|Ga0310913_10203502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
| 3300031945|Ga0310913_11074763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031946|Ga0310910_11017577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031947|Ga0310909_10308933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300031962|Ga0307479_10499279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300031981|Ga0318531_10499653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032180|Ga0307471_100045348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3570 | Open in IMG/M |
| 3300032180|Ga0307471_100361161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
| 3300032180|Ga0307471_101247993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300032180|Ga0307471_101329480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300033158|Ga0335077_10593030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300033289|Ga0310914_10209759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.13% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.46% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_11860615 | 2228664022 | Soil | RYSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFDVHIARPN |
| INPgaii200_11861722 | 2228664022 | Soil | SFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFHVHIARPN |
| INPhiseqgaiiFebDRAFT_1013255432 | 3300000364 | Soil | ICELDDGWVTLLSEALWPSEIVRRLRPAAQSFNVHIARPN* |
| JGI1027J12803_1026114002 | 3300000955 | Soil | YSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFDVHIARPN* |
| JGI12636J13339_10466792 | 3300001154 | Forest Soil | ICEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN* |
| F14TB_1048094882 | 3300001431 | Soil | ADGWVALLSETLWSSEVIRRVRPAAQSFDVYVARPH* |
| JGI25385J37094_101900031 | 3300002558 | Grasslands Soil | ICEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIYIARPN* |
| Ga0066690_102682412 | 3300005177 | Soil | ICEPEDGWVTLLSESLWPSEVIRRVRPAIRPFDIHIARPN* |
| Ga0070705_1008791112 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RYSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFHVHIARPN* |
| Ga0073909_101474251 | 3300005526 | Surface Soil | FEDGWVTLLSESMWSSEVIRRVRPAAQSFDVHINRPQ* |
| Ga0066691_102419102 | 3300005586 | Soil | YTFCAICEPDDGWMTLLSQRLWPSEIIRRARPALQPFDVHIARPQ* |
| Ga0070763_107998122 | 3300005610 | Soil | GRRVVTLLSATLWASEVIRRVRPAVLPFDIYIARPQ* |
| Ga0070764_103410302 | 3300005712 | Soil | DGWVTLLSATLWASEIIRRARPAALPFDIYLARPQ* |
| Ga0075030_1013866081 | 3300006162 | Watersheds | PEDAWVTLLSEGLWPSEVIRRLRPALQPFDVYIARPQ* |
| Ga0070765_1019188872 | 3300006176 | Soil | DGWVTLLSATLWASEVIRRARPAVLPFDIYIARPQ* |
| Ga0075021_109709862 | 3300006354 | Watersheds | CEPDDGWMTLLSKTLWPSEIIRRARPALQPFDVHIARPQ* |
| Ga0074064_105532511 | 3300006603 | Soil | ELEDGWLTILSETLWPSEVIRRVRPAAQPFDVHIARPN* |
| Ga0079220_101813471 | 3300006806 | Agricultural Soil | TFCAVCEPGDGWVTVLSQTLWPSEVIRRARPVVQRFDVHIARPN* |
| Ga0073928_103307501 | 3300006893 | Iron-Sulfur Acid Spring | EDGWVTLLSKTLWPTEIIRRIRPAAQKFDVYIARPH* |
| Ga0075424_10000789510 | 3300006904 | Populus Rhizosphere | CELDDGWVTLLSEGLWPSEVVRRLRPAAQSFDVHIARPN* |
| Ga0079219_109517882 | 3300006954 | Agricultural Soil | VCEPEDGWVTLLSKTLWASEVIRRLRPAVERFDVYLARPQ* |
| Ga0099791_101287351 | 3300007255 | Vadose Zone Soil | EDGWVTLLSEFLWPSEVIRRVRPAVQPFDIHIARPN* |
| Ga0099794_102923872 | 3300007265 | Vadose Zone Soil | AICEPEDGWVTLLSETLWPSEVIRRLRPVVQPFDVHIARPN* |
| Ga0099827_100565574 | 3300009090 | Vadose Zone Soil | CAICEPEDGWVTLLSESLWPSELIRRLRPALLPFDMHIARPN* |
| Ga0116218_13512982 | 3300009522 | Peatlands Soil | PEDAWVTLLSEGPWPSEGIRRVRPALQPFDVYIARPQ* |
| Ga0116221_13937881 | 3300009523 | Peatlands Soil | YTRYTFCSVVQPEDAWGTPLSQGLWPSEVTRRVRPALQPFDVYIARPQ* |
| Ga0116135_13844622 | 3300009665 | Peatland | EPEDGWVTLLSKTLWPTEVIRRVRPAVQRFDVYIARPH* |
| Ga0126374_106155911 | 3300009792 | Tropical Forest Soil | GWVTLLSEGLWPSEVVRRLRPAAKSFDVHIARPN* |
| Ga0126384_109834461 | 3300010046 | Tropical Forest Soil | AICELEDGWMTLLSDTLWPSEVVRRLRPAAQSFDVRISRPR* |
| Ga0134082_100432511 | 3300010303 | Grasslands Soil | GWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN* |
| Ga0074045_110663402 | 3300010341 | Bog Forest Soil | CAVAEPEDGWVTLLSATLWPSEVIRRVRPAVQPFDIHIARPN* |
| Ga0137392_109037002 | 3300011269 | Vadose Zone Soil | EDGWVTLLSETLWPTEIIRRIRPAAQKFDVYIARPQ* |
| Ga0137392_112581471 | 3300011269 | Vadose Zone Soil | EPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN* |
| Ga0137393_115338421 | 3300011271 | Vadose Zone Soil | DGWVTLLSDNIWSSEVIRRVRPAAQSFDVYIARPQ* |
| Ga0137389_102441773 | 3300012096 | Vadose Zone Soil | CEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYIARPH* |
| Ga0137363_108870242 | 3300012202 | Vadose Zone Soil | DGWVTLLSETIWSSEVIRRVRPAAQSFDVYIARPQ* |
| Ga0137399_101369711 | 3300012203 | Vadose Zone Soil | ICEPEDGWVTLLSESLWPSEVIRRLRPAVQPFDIYIARPN* |
| Ga0137362_103571101 | 3300012205 | Vadose Zone Soil | ICEPEDGWVTLLSKSLWPSEIIRRLRPAVQPFDIYIARPN* |
| Ga0137362_116916072 | 3300012205 | Vadose Zone Soil | CEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIYIARPN* |
| Ga0137360_118474642 | 3300012361 | Vadose Zone Soil | EDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN* |
| Ga0137390_100158169 | 3300012363 | Vadose Zone Soil | CAICEPEDGWVTLLSESLWPSEIIRRLRPAVQPFDIHIARPN* |
| Ga0137390_108529402 | 3300012363 | Vadose Zone Soil | EPEDGWVTLLSQTLWSTEVIRRIRPAVQKFDVYLARPY* |
| Ga0137419_103413281 | 3300012925 | Vadose Zone Soil | DAYQPAYGRYTFCGVCEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYLARPH* |
| Ga0137404_110778482 | 3300012929 | Vadose Zone Soil | GGYTFCGVCEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYLARPH* |
| Ga0153915_105197371 | 3300012931 | Freshwater Wetlands | CDLADGWMTMLSETLWPSEILRRVRPALASFEVELARPN* |
| Ga0137410_119532272 | 3300012944 | Vadose Zone Soil | CAICEPEDGWVTLLSETLWPSEIIRRLRPAVQPFDVHIARPN* |
| Ga0137405_12297001 | 3300015053 | Vadose Zone Soil | TRYTFCAICETDDGWVTLLSQTLWPSEIIRRARPALQPFDVHIARPQ* |
| Ga0137420_11060636 | 3300015054 | Vadose Zone Soil | AYTRYTFCAICEPNDGWVTLLSQTLWPSEIIRRARPALQPFDVHIARPQ* |
| Ga0167668_10195733 | 3300015193 | Glacier Forefield Soil | PEDGWVTLLSETLWPTEVIRRIRPAAQKFDVYIARPH* |
| Ga0137418_101145661 | 3300015241 | Vadose Zone Soil | EDGWVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN* |
| Ga0187817_104712912 | 3300017955 | Freshwater Sediment | CEPSNGWVTLLSESLWPTEVIRRVRPALQTLDVNIARPQ |
| Ga0187804_100971631 | 3300018006 | Freshwater Sediment | CEPEDGWITLLSKTLWPTEVIRRIRPAVQRFDVYISRPH |
| Ga0187804_101601572 | 3300018006 | Freshwater Sediment | CAVVEPEDAWVTVLSETLWASEVIRRVRPALQPFDVYIARPQ |
| Ga0187769_113222682 | 3300018086 | Tropical Peatland | DGWVTLLSESLWPSEIIRRVRPALQPFDVYIARPQ |
| Ga0187771_100579504 | 3300018088 | Tropical Peatland | CELSDGWVTLLSESLWPSEIIRRVRPALQPFDVYIACPQ |
| Ga0187771_104148461 | 3300018088 | Tropical Peatland | YPRYTFCAICELSDAWVTLLSESLWASEIIRRVRRALQPFDVYIARPQ |
| Ga0137408_10411272 | 3300019789 | Vadose Zone Soil | EPEDGWVTLLSESLWPSEVIRRVRPAVQSFDIHIARPN |
| Ga0179590_10973171 | 3300020140 | Vadose Zone Soil | CAICEPEDGWVTLLSESLWPSEVIRLVRPAIHPFDIHIARPN |
| Ga0179592_100129895 | 3300020199 | Vadose Zone Soil | DGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN |
| Ga0210407_111015301 | 3300020579 | Soil | EDGWVTLLSQTLWPTEVIRRIRPALQKFDVYIARPH |
| Ga0210403_102182921 | 3300020580 | Soil | EPEDGWVTLLSESLWTSEVIRRVRPAVQPFDIYIARPN |
| Ga0210403_113600681 | 3300020580 | Soil | EPEDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN |
| Ga0210399_113469492 | 3300020581 | Soil | DGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN |
| Ga0210404_102936831 | 3300021088 | Soil | DDGWMTLLSQSLWPSEIIRRARPALQPFDVHIARPQ |
| Ga0210404_102983752 | 3300021088 | Soil | AICEPDDGWMTLLSTSLWPSEIIRRARPALQPFDVHIARPQ |
| Ga0210405_112148361 | 3300021171 | Soil | AVCEPEDGWVTLLSAALWASEVIRRLRPAVLPFDIYIARPQ |
| Ga0210396_103274533 | 3300021180 | Soil | FLAVCEPEDGWVTLLSATLWASEVIRRVRPAALPFDIYIARPQ |
| Ga0210396_105895501 | 3300021180 | Soil | AGCGPEDGWVTLLSATLWASEVIRRVRPAVQPFDIYIARPQ |
| Ga0210397_106367721 | 3300021403 | Soil | VCEPEDGWVTLLSKTLWASEVIRRLRSAVERFDVYLARPQ |
| Ga0210386_115900982 | 3300021406 | Soil | PEDGWVTLLSPTLWPTEVIRLIRGAVQKFDVYIARPH |
| Ga0210391_112756841 | 3300021433 | Soil | ICEPEDGWVTLLSKTLWPSEVIRRIRPAVQRFDVYLARPQ |
| Ga0210391_114254772 | 3300021433 | Soil | ICEPDDGWVTLLSPALWASEVIRRVRPAVLPFDIYIARPQ |
| Ga0187846_101919101 | 3300021476 | Biofilm | AICEPEDGWVTLLSETLWPSELIRRLRPAVQRFDLHIARPN |
| Ga0210402_115385882 | 3300021478 | Soil | RYTFCAICEPEDGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN |
| Ga0210402_119259521 | 3300021478 | Soil | TFCGICEPEDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH |
| Ga0210409_113928182 | 3300021559 | Soil | AYARYTFCAICEPDDGWVTLLSQTLWPSEIIRRARPALQPFDVLIARPQ |
| Ga0210409_116633382 | 3300021559 | Soil | YGGYTFCGICEPEDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH |
| Ga0212123_102456121 | 3300022557 | Iron-Sulfur Acid Spring | DGWFTLLSDSLWSSEVIRRIRPAVEPFDVYLARPQ |
| Ga0247681_10563891 | 3300024310 | Soil | LDDGWVTLLSETLWPSEVVRRLRPAAQSFNVHIARPN |
| Ga0137417_11210971 | 3300024330 | Vadose Zone Soil | TFCAICEPEDGWVTLLSESLWPSEVIIRRVRPAIHSFDIHIARPN |
| Ga0207685_100575453 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | FEDGWVTVLSQTLWSSEVIRRVRPAAQLFDVHISRPH |
| Ga0209238_11292141 | 3300026301 | Grasslands Soil | ELEDGWLTILSETLWPSEAIRRVRPAMQPFDVHIARPH |
| Ga0209152_103463282 | 3300026325 | Soil | EPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN |
| Ga0207852_10010031 | 3300026959 | Tropical Forest Soil | CAICEAAEGWVTVLSETLWPSEIIRRVRPVLQSFDVYIARPQ |
| Ga0207736_1044272 | 3300027023 | Tropical Forest Soil | AAEGWVTVLSETLWPSEIIRRVRPVLQSFDVYIARPQ |
| Ga0209730_10445612 | 3300027034 | Forest Soil | SFCAICEPEDGWVTLLSETLWPSELIRRLRPAVQRFDVHISRPN |
| Ga0208241_10704491 | 3300027297 | Forest Soil | RYKFCAICEPEDGWITLLSESLWPSEIIRLLRPALRPFDVHIARPN |
| Ga0209003_10807561 | 3300027576 | Forest Soil | EFEDGWVTLLSETIWSSEVIRRVRPAAQSFDVYISRPQ |
| Ga0209076_11785931 | 3300027643 | Vadose Zone Soil | CGVCEPEDGWVTLLSETLWATEIIRRIRPAAQKFDVYIARPQ |
| Ga0209388_10674802 | 3300027655 | Vadose Zone Soil | FCAVCEPEDGWVTLLSPILWPTEVIRRIRGAVQKFDIYVARPH |
| Ga0209118_11825661 | 3300027674 | Forest Soil | EDGWVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN |
| Ga0209908_100463641 | 3300027745 | Thawing Permafrost | GICEPEDGWVTLLSKTLWPTEVIRRLRPAVQRFDVYIARPH |
| Ga0137415_109272781 | 3300028536 | Vadose Zone Soil | DGWVTRLSEKIWSSEVIRRVRPAAQSFDVYIARPQ |
| Ga0302233_104297651 | 3300028746 | Palsa | WEAEDGWVTVLSDKLWPTEIIRRVRPAVQRFDVYISRPH |
| Ga0307308_100736481 | 3300028884 | Soil | YQPVYARYTFCAICEPEDGWVTLLSESLWPSEVIRLVRPAIHPFDIHIARPN |
| Ga0222749_101232683 | 3300029636 | Soil | FCAICEPEDGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN |
| Ga0311356_115846582 | 3300030617 | Palsa | ICEPNDGWLTLLSDTLWSSEVIRRVRPALQPFDVYISRPQ |
| Ga0307498_103214522 | 3300031170 | Soil | PEDGWVTLLSDKLWPSEVMRRVRPALQPFDVYLARPQ |
| Ga0318516_108537092 | 3300031543 | Soil | AEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| Ga0310686_1026448892 | 3300031708 | Soil | CEPEDGWVTLLSASLWASEVIRRVRPAVLPFDIYIARPQ |
| Ga0310686_1099932454 | 3300031708 | Soil | VCEPEDGWVTLLSASLWASEVIRRVRPAVLPFEIYIARPQ |
| Ga0307468_1010845031 | 3300031740 | Hardwood Forest Soil | RYTFCAICEPDDGWVTMLSQTLWPSEIIRRARPALQPFDVHIARPQ |
| Ga0307477_106714871 | 3300031753 | Hardwood Forest Soil | MFCAICEPDDGWVTLLSTSLWPTEIIRRARPALQPFDVHIARPQ |
| Ga0307477_108151182 | 3300031753 | Hardwood Forest Soil | EDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN |
| Ga0318521_104740022 | 3300031770 | Soil | CAVCEPEDAWVTLLSESLRPSEIIRRVRPALQQFDVYIARPQ |
| Ga0307473_110566681 | 3300031820 | Hardwood Forest Soil | AYGHYTFCGICQPDDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH |
| Ga0307478_102610901 | 3300031823 | Hardwood Forest Soil | LDDGWVTLLSETLWPSEVVRRLRPAAQEFSIYISRPH |
| Ga0306919_102496671 | 3300031879 | Soil | ICEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| Ga0318536_106424842 | 3300031893 | Soil | EGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| Ga0306921_125599142 | 3300031912 | Soil | PEDGWMTVLSNSLWPSEVIRRIRPALQRFDVYIARPH |
| Ga0310913_102035023 | 3300031945 | Soil | AAEGWVTVLSETLWPSEIIRRVRPVLEPFDVYIARPQ |
| Ga0310913_110747632 | 3300031945 | Soil | AICEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| Ga0310910_110175771 | 3300031946 | Soil | EAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| Ga0310909_103089332 | 3300031947 | Soil | EAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIVRPQ |
| Ga0307479_104992791 | 3300031962 | Hardwood Forest Soil | DAYQPAFARYTLCAICEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYIARPH |
| Ga0318531_104996532 | 3300031981 | Soil | DDGWVTLLSEGLWPSEVVRRLRPAAKSFNVHIARPN |
| Ga0307471_1000453481 | 3300032180 | Hardwood Forest Soil | SDGWVTILSQSLWPSEIIRRVRPALQPFDVYIARPQ |
| Ga0307471_1003611611 | 3300032180 | Hardwood Forest Soil | DAYTRYTFCAICEPDDGWVTLLSRTLWPSEIIRRARPALQPFDVHIARPQ |
| Ga0307471_1012479932 | 3300032180 | Hardwood Forest Soil | ELEDGCVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN |
| Ga0307471_1013294802 | 3300032180 | Hardwood Forest Soil | YTFCAICEPDDGWVTMLSQTLWPSEIIRRARPALQPFDVHIARPQ |
| Ga0335077_105930301 | 3300033158 | Soil | DGWVTVLSESLWPSEIIRRVRPSLQAFAVYIARPQ |
| Ga0310914_102097591 | 3300033289 | Soil | CEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ |
| ⦗Top⦘ |