NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071419

Metagenome Family F071419

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071419
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 54 residues
Representative Sequence MSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Number of Associated Samples 104
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.97 %
% of genes near scaffold ends (potentially truncated) 31.15 %
% of genes from short scaffolds (< 2000 bps) 92.62 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.689 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.197 % of family members)
Environment Ontology (ENVO) Unclassified
(37.705 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.361 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.24%    β-sheet: 0.00%    Coil/Unstructured: 39.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF01925TauE 38.52
PF05683Fumerase_C 32.79
PF03729DUF308 1.64
PF12710HAD 0.82
PF14534DUF4440 0.82
PF02797Chal_sti_synt_C 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 38.52
COG1838Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domainEnergy production and conversion [C] 32.79
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 1.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.69 %
UnclassifiedrootN/A21.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig90755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860628Open in IMG/M
3300002568|C688J35102_120363056All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300004081|Ga0063454_100286082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1019Open in IMG/M
3300004081|Ga0063454_101502091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense576Open in IMG/M
3300004114|Ga0062593_101501527Not Available726Open in IMG/M
3300004114|Ga0062593_103557969Not Available500Open in IMG/M
3300004156|Ga0062589_101118452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860747Open in IMG/M
3300004157|Ga0062590_100622338Not Available954Open in IMG/M
3300004479|Ga0062595_101112048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense692Open in IMG/M
3300005093|Ga0062594_100709066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales910Open in IMG/M
3300005093|Ga0062594_101018607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860798Open in IMG/M
3300005173|Ga0066822_1006326Not Available692Open in IMG/M
3300005330|Ga0070690_100367356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601049Open in IMG/M
3300005331|Ga0070670_101964880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense539Open in IMG/M
3300005333|Ga0070677_10637764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860594Open in IMG/M
3300005338|Ga0068868_101508836Not Available629Open in IMG/M
3300005338|Ga0068868_102196886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860526Open in IMG/M
3300005341|Ga0070691_10704191Not Available607Open in IMG/M
3300005353|Ga0070669_101353827Not Available617Open in IMG/M
3300005367|Ga0070667_102116089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860530Open in IMG/M
3300005406|Ga0070703_10269150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860698Open in IMG/M
3300005441|Ga0070700_100482572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860950Open in IMG/M
3300005458|Ga0070681_11935738Not Available517Open in IMG/M
3300005459|Ga0068867_100799632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860841Open in IMG/M
3300005529|Ga0070741_10121612All Organisms → cellular organisms → Bacteria → Proteobacteria2695Open in IMG/M
3300005529|Ga0070741_11565259Not Available541Open in IMG/M
3300005544|Ga0070686_100957531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860700Open in IMG/M
3300005548|Ga0070665_100387562All Organisms → cellular organisms → Bacteria → Proteobacteria1405Open in IMG/M
3300005618|Ga0068864_101682810All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300005842|Ga0068858_100495042All Organisms → cellular organisms → Bacteria → Proteobacteria1181Open in IMG/M
3300005843|Ga0068860_100636816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601073Open in IMG/M
3300005844|Ga0068862_101545586Not Available670Open in IMG/M
3300005995|Ga0066790_10533843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860501Open in IMG/M
3300006028|Ga0070717_11058657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860739Open in IMG/M
3300006046|Ga0066652_101224068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860710Open in IMG/M
3300006047|Ga0075024_100508751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860633Open in IMG/M
3300006047|Ga0075024_100761039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860538Open in IMG/M
3300006050|Ga0075028_100393552All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300006051|Ga0075364_11177240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense520Open in IMG/M
3300006177|Ga0075362_10463442All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006178|Ga0075367_10217260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601196Open in IMG/M
3300006638|Ga0075522_10009480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6562Open in IMG/M
3300006854|Ga0075425_102080142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860634Open in IMG/M
3300006881|Ga0068865_100195056All Organisms → cellular organisms → Bacteria → Proteobacteria1569Open in IMG/M
3300006881|Ga0068865_100719217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales855Open in IMG/M
3300006954|Ga0079219_11087316Not Available676Open in IMG/M
3300006954|Ga0079219_11839484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860568Open in IMG/M
3300007788|Ga0099795_10089358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1192Open in IMG/M
3300009012|Ga0066710_101738096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales946Open in IMG/M
3300009098|Ga0105245_12324452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860590Open in IMG/M
3300009137|Ga0066709_103409355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense577Open in IMG/M
3300009148|Ga0105243_11983258Not Available616Open in IMG/M
3300009148|Ga0105243_12471237Not Available558Open in IMG/M
3300009176|Ga0105242_13149451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense512Open in IMG/M
3300009610|Ga0105340_1448100Not Available576Open in IMG/M
3300009661|Ga0105858_1188389Not Available601Open in IMG/M
3300009662|Ga0105856_1235801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense590Open in IMG/M
3300010036|Ga0126305_10186835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601308Open in IMG/M
3300010037|Ga0126304_10953386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860584Open in IMG/M
3300010044|Ga0126310_10525711Not Available869Open in IMG/M
3300010397|Ga0134124_13224573Not Available500Open in IMG/M
3300010400|Ga0134122_10198140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601664Open in IMG/M
3300010403|Ga0134123_10052277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3082Open in IMG/M
3300010938|Ga0137716_10490918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860557Open in IMG/M
3300011119|Ga0105246_11141401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860714Open in IMG/M
3300011423|Ga0137436_1065347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales940Open in IMG/M
3300012203|Ga0137399_11271999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860619Open in IMG/M
3300012206|Ga0137380_10753859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860842Open in IMG/M
3300012207|Ga0137381_10911348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860760Open in IMG/M
3300012212|Ga0150985_110818291Not Available968Open in IMG/M
3300012212|Ga0150985_114936871Not Available1171Open in IMG/M
3300012683|Ga0137398_10443425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales887Open in IMG/M
3300012905|Ga0157296_10042904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1027Open in IMG/M
3300012913|Ga0157298_10315961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense560Open in IMG/M
3300012923|Ga0137359_10530577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1037Open in IMG/M
3300012929|Ga0137404_10037811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae3619Open in IMG/M
3300012930|Ga0137407_10455725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601190Open in IMG/M
3300012944|Ga0137410_10601763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.908Open in IMG/M
3300012987|Ga0164307_11854718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense511Open in IMG/M
3300013306|Ga0163162_10160153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2372Open in IMG/M
3300013306|Ga0163162_10709529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1127Open in IMG/M
3300014326|Ga0157380_11384672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860753Open in IMG/M
3300014326|Ga0157380_13261309Not Available518Open in IMG/M
3300014968|Ga0157379_11020915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860789Open in IMG/M
3300015209|Ga0167629_1084790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria989Open in IMG/M
3300017944|Ga0187786_10096090Not Available989Open in IMG/M
3300018029|Ga0187787_10190152Not Available719Open in IMG/M
3300018060|Ga0187765_10141494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601350Open in IMG/M
3300018067|Ga0184611_1011760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2517Open in IMG/M
3300018476|Ga0190274_10790781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1005Open in IMG/M
3300018476|Ga0190274_11723623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860721Open in IMG/M
3300018482|Ga0066669_10923775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860783Open in IMG/M
3300019356|Ga0173481_10054113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601393Open in IMG/M
3300021082|Ga0210380_10015345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3223Open in IMG/M
3300025923|Ga0207681_10893539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860744Open in IMG/M
3300025927|Ga0207687_10260617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudolysobacter → Pseudolysobacter antarcticus1382Open in IMG/M
3300025930|Ga0207701_11159495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860638Open in IMG/M
3300025930|Ga0207701_11249443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860611Open in IMG/M
3300025930|Ga0207701_11318428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860591Open in IMG/M
3300026075|Ga0207708_10806680Not Available808Open in IMG/M
3300026089|Ga0207648_12066082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense531Open in IMG/M
3300026089|Ga0207648_12193580Not Available513Open in IMG/M
3300027866|Ga0209813_10303783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium SO-S41620Open in IMG/M
3300027903|Ga0209488_10054060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2958Open in IMG/M
3300027915|Ga0209069_10488526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense691Open in IMG/M
3300028379|Ga0268266_10302135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601493Open in IMG/M
3300028790|Ga0307283_10012862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601637Open in IMG/M
3300031231|Ga0170824_102803692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860737Open in IMG/M
3300031241|Ga0265325_10001048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC686019923Open in IMG/M
3300031241|Ga0265325_10322406Not Available686Open in IMG/M
3300031249|Ga0265339_10461623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860589Open in IMG/M
3300031250|Ga0265331_10263140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860773Open in IMG/M
3300031344|Ga0265316_11047104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales567Open in IMG/M
3300031474|Ga0170818_107649609Not Available701Open in IMG/M
3300031595|Ga0265313_10190743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860857Open in IMG/M
3300031716|Ga0310813_10183515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601705Open in IMG/M
3300031716|Ga0310813_12209140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860521Open in IMG/M
3300031726|Ga0302321_101696041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860731Open in IMG/M
3300031858|Ga0310892_11270616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860526Open in IMG/M
3300032002|Ga0307416_102270792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860643Open in IMG/M
3300033233|Ga0334722_10160262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1682Open in IMG/M
3300034820|Ga0373959_0110746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860662Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.10%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.28%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.46%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.46%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.64%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.64%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.82%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005173Soil and rhizosphere microbial communities from Laval, Canada - mgHMAEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0755.000053402166559005SimulatedMSFLKQKLAMPVVKYSVLGLASGLWVFGLVEQFYSSASMMKYLLLSLLMAAVAFI
C688J35102_12036305623300002568SoilMSFLKQKLAMPVVKYSVFGLASVLWVFGLVDQLYSSAEMMKYLLLSLLMAAVAFI*
Ga0063454_10028608223300004081SoilMSYLKAKLSLPVVKYSVLTAGSVLWTFGLVDQLYSSAAVMKYLLMSLLIAAIAML*
Ga0063454_10150209123300004081SoilMSFLKQKLTMPVVKYSVLGLASCLWVFGLVDQFYSSASMMKYILLSLLMAAVAFI*
Ga0062593_10150152723300004114SoilMSYLKRKLSLPLVKYSLFGIASGLWVFGLVDQLYDSPATMKYLLLSLLMAAVAFI*
Ga0062593_10355796923300004114SoilVLRPVPLESFAMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLDSSAAMMKYLLLSLLIAALAFM*
Ga0062589_10111845223300004156SoilMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0062590_10062233813300004157SoilMSYLKQKLSLPLVKYSALGIASGLWVFGLADQFYESAAMMKYLLLSLLMAAVVFI*
Ga0062595_10111204823300004479SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSAEMMKYLLLSLLMAAVAFI*
Ga0062594_10070906613300005093SoilMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLDSSAAMMKYLLLSLLIAALAFI*
Ga0062594_10101860723300005093SoilMSYLKQKLSLPLVRYSAFAIASSLWVFGLVDQFYESAAVMKYLLLSLLMAAISFL*
Ga0066822_100632623300005173SoilMSYLKQKLSLPLVKYSALGIASGLWVFGVADQFYEFAAMMKYLLLSLLMAAVVFI*
Ga0070690_10036735613300005330Switchgrass RhizosphereMSFLKQKLAIPVVKYSVLGLASVLWVFGLVDQLYSSASMMKYLLLSLLMAA
Ga0070670_10196488023300005331Switchgrass RhizosphereMSFLKQKLAIPVVKYSVLGLASVLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0070677_1063776423300005333Miscanthus RhizosphereMSYLKQKLSLPLVKYSALGIASGLWVFGLADQFYESAAMMKYLLLSLLMAAITLL*
Ga0068868_10150883613300005338Miscanthus RhizosphereMSYLKRKLTIPLVKYSVLTIAACLWVFGLIEQIYSSAAVMKYVLMSLLMAALAFLI*
Ga0068868_10219688623300005338Miscanthus RhizosphereMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLQSSASMMKYLLLSLLMAAVAFI
Ga0070691_1070419123300005341Corn, Switchgrass And Miscanthus RhizosphereIFEMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0070669_10135382713300005353Switchgrass RhizosphereMSYLKQKLSLPLVRYSAFAIASSLWVFGLVDQFYESAAVMKYLLLSLLMAAIAFL*
Ga0070667_10211608913300005367Switchgrass RhizosphereMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLHSSAATMKYLLLSLLIAALAF
Ga0070703_1026915023300005406Corn, Switchgrass And Miscanthus RhizosphereMSYLKQKLSLPLVRYSALGIASCLWVFGLVDQLYESAAMMKYLLLSLLMAAVAFI*
Ga0070700_10048257213300005441Corn, Switchgrass And Miscanthus RhizosphereMSFPKQKLAIPVVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLM
Ga0070681_1193573813300005458Corn RhizosphereASRPCLEQFAMSYLKQKLSLPLVKYSALAIGASLWTFGLLDQLYSSAATMKYLLLSMLMAALAFI*
Ga0068867_10079963223300005459Miscanthus RhizosphereMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSAAMMKYVLLSLLMAAVAFI*
Ga0070741_1012161233300005529Surface SoilLQVPPVKYSLIALGMTLWGLGLVDQLSSTAATAKYLMMSLLIAAVAVI*
Ga0070741_1156525913300005529Surface SoilMSYLKSKLSLPAVKYGVLGLCSVLWTFGLVDQLYSSAATMKYLLMSLLIAAVAVL*
Ga0070686_10095753113300005544Switchgrass RhizosphereMSYLKRKLTIPLVKYSVLTVAACLWVFGLIEQIYSSAAVMKYVLMSLLMAALAFLI*
Ga0070665_10038756223300005548Switchgrass RhizosphereMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLQSSASMMKYLLLSLLMAAVAFI*
Ga0068864_10168281023300005618Switchgrass RhizosphereMSYLKQKLATPLVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0068858_10049504223300005842Switchgrass RhizospherePVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0068860_10063681623300005843Switchgrass RhizosphereMSYLKQKLSLPLVKYCALGIASGLWVFGLADQFYESAAMMKYLLLSLLIAVFI*
Ga0068862_10154558623300005844Switchgrass RhizosphereMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLHSSAAMMKYLLLSLLIAALAFI*
Ga0066790_1053384313300005995SoilMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAALAFL*
Ga0070717_1105865723300006028Corn, Switchgrass And Miscanthus RhizosphereMSFLKQKLTMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLM
Ga0066652_10122406813300006046SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0075024_10050875123300006047WatershedsMSFLKQKLTIPVVKYSVLGLASVLWVFGLVDQLYSSAAMMKYLLLSLLMAAVAFI*
Ga0075024_10076103913300006047WatershedsMSFLKQKLSLPLVKYSALAVASSLWVFGLVEQLYSSAEMMKYLLLSILMAAVAFI*
Ga0075028_10039355223300006050WatershedsMSFLKQKLTIPVVKYSVLGLASVLWVFGLVDQLYSSAAMMKYILLSLLMAAVAFI*
Ga0075364_1117724013300006051Populus EndosphereMPVVKYSVLGLASGLWVFGLIDQLYSSASMMKYILLSLLMAAVAFI*
Ga0075362_1046344213300006177Populus EndosphereMSFLKQKLATPMVKYGVLGLASALWVFGLVDQLYSSASMMKYILLSLLMAAVAFI*
Ga0075367_1021726023300006178Populus EndosphereMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0075522_1000948093300006638Arctic Peat SoilMSFLKQKLSLPLVKSGVLGLAGCLWAFGLVDQLYSSAAVMKYLLLSLLMAAVALL*
Ga0075425_10208014213300006854Populus RhizosphereMSFLKQKLTMPVVKYSVLGLASCLWVFGLVDQFYSSAAMMKYILLSLLMAAVAFI
Ga0068865_10019505613300006881Miscanthus RhizosphereMSYLKQQLSLPLVKYSVITIASTLWVFGLVDQLHSSAAMMKYLLLSLLIAALAFI*
Ga0068865_10071921713300006881Miscanthus RhizosphereMSYLRRKLTIPLVKYSVLTIAACLWVFGLIEQIYSSAAVMKYVLMSLLMAALAFLI*
Ga0079219_1108731623300006954Agricultural SoilMSYLKAKLSLPVVKYCAFAIALTLWGFGLVDQLYSSAAVMKYILLSLLIAAVALF*
Ga0079219_1183948423300006954Agricultural SoilMSFLKQKLAMPVVKYSVLALASVLWGFGLAGQFYSSASMMNYIL
Ga0099795_1008935823300007788Vadose Zone SoilMSFLKQKLAMPVVKYSMLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0066710_10173809623300009012Grasslands SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYILLSLLMAAVAFI
Ga0105245_1232445223300009098Miscanthus RhizosphereMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAF
Ga0066709_10340935513300009137Grasslands SoilMSFLKQKLTIPVVKYSVLGLASCLWVFGLVDQLYSSASMMKYILLSLLMAAVAFI*
Ga0105243_1198325823300009148Miscanthus RhizosphereLGMSYLKQKLSLPLVRYSALGIASCLWVFGLVDQLYESAAMMKYLLLSLLMAAVAFI*
Ga0105243_1247123713300009148Miscanthus RhizosphereMSYLKQKLSLPLVKYSVISIASTLWVFGLVDQLDSSAAMMKYLLLSLLIAALAFI*
Ga0105242_1314945123300009176Miscanthus RhizosphereMSFPKQKLAIPVVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0105340_144810023300009610SoilAIPAVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0105858_118838923300009661Permafrost SoilSFLKQKLTMPLVKYSVLGLASGLWVFGLVDQIYSSASMMKYLLLSLLMAAVAFI*
Ga0105856_123580113300009662Permafrost SoilTMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0126305_1018683523300010036Serpentine SoilMSYLKRKLSLPLVKYSLLGIASGLWVFGLVDQLYDSPATMKYLLLSLLMAAVAFI*
Ga0126304_1095338623300010037Serpentine SoilMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLDSSAAMMKYLLLSLLIAALA
Ga0126310_1052571123300010044Serpentine SoilMSFLKQKLTMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0134124_1322457323300010397Terrestrial SoilMSYLKQKLSLPLVRYSALGIASCLWVFGLVDQFYESAAMMKYLLLSLLMAAVAFI*
Ga0134122_1019814033300010400Terrestrial SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDPLYSSAEMMKYLL
Ga0134123_1005227723300010403Terrestrial SoilMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAAAFI*
Ga0137716_1049091813300010938Hot Spring Fe-Si SedimentMSYLKRKLSIPAVKYSLLVVGSGLWIFGLIDQFDSSAATMKYLLMSLLIAVLALL*
Ga0105246_1114140113300011119Miscanthus RhizosphereMSYLKQKLSLPLVKYSVFGIASLLWVFGLVDQLYESAAMMKYLLLSLLMAAVAFI*
Ga0137436_106534723300011423SoilMSFLKQKLAIPAVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0137399_1127199913300012203Vadose Zone SoilVTRARHLENFEMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0137380_1075385913300012206Vadose Zone SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAALAFI*
Ga0137381_1091134823300012207Vadose Zone SoilVTRARHLENFEMSFLKQKLTMPMVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0150985_11081829123300012212Avena Fatua RhizosphereSFLKQKLAMPVVKYSVFGLASVLWVFGLVDQLYSSAEMMKYLLLSLLMAAVAFI*
Ga0150985_11493687123300012212Avena Fatua RhizosphereVVKYSVLGLASCLWVFGLVDQLYSSASMMKYILLSLLMAAVAFI*
Ga0137398_1044342523300012683Vadose Zone SoilMSFLKQKLTMPVIKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0157296_1004290433300012905SoilMSYLKQKLSLPLVKYSLFGIASGLWVFGLVDQLYDSPATMKYLLLSLLMAAVAFI*
Ga0157298_1031596123300012913SoilMSYLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0137359_1053057723300012923Vadose Zone SoilMSFLKQKLTMPVVKYSVLGLASALWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0137404_1003781143300012929Vadose Zone SoilVTRARHLENFEMSFLKQKLTMPVVKYSVLGLASALWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0137407_1045572513300012930Vadose Zone SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVA
Ga0137410_1060176323300012944Vadose Zone SoilVTRARHLENFEMSFLKQKLAMPVVKYSMLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI*
Ga0164307_1185471823300012987SoilFLKQKLAMPVVKYSVFGLASVLWVFGLVDQLYSSAEMMKYLLLSLLMAAVAFI*
Ga0163162_1016015333300013306Switchgrass RhizosphereMSFLKQKLAIPVVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLMAAVAFI*
Ga0163162_1070952933300013306Switchgrass RhizosphereMSYLKQKLSLPLVKYSVITIASPLWVFGLVDQLHSSAAMMKYLLLSLLIATLAFI*
Ga0157380_1138467223300014326Switchgrass RhizosphereMSFLKQKLAIPVVKYSVLGLASVLWVFGLVDQLYSSASMMKYLL
Ga0157380_1326130913300014326Switchgrass RhizosphereMSYLKRKLSLPHVKYSLFGIASGLWVFGLVDQLYDSPATMKYLLLSLLMAAVAFI*
Ga0157379_1102091513300014968Switchgrass RhizosphereMSYLKQKLSLPQVKYSVFAIASSLWVFGLVDQFYESAAVMKYLL
Ga0167629_108479023300015209Glacier Forefield SoilMSYLKQKLSLPLVKYGVLGIASLLWMFGLVDQLYESAATMKYLLLSLLMVAIAFI*
Ga0187786_1009609033300017944Tropical PeatlandMSYLKAKLALPVVKYSVLGLCSVLWTFGLVDQLYSSAATMKYLLMSLLIAAVAVL
Ga0187787_1019015223300018029Tropical PeatlandMSYLKAKLSLPVVKYSVLALCSVLWTFGLVDQLYSSAATMKYLLMSLLIAAIAVL
Ga0187765_1014149433300018060Tropical PeatlandMSYLKAKLSLPVVKYSAVAIALTLWGFGLADQLHSSAAVVKYVLLSLLIAAVALF
Ga0184611_101176043300018067Groundwater SedimentMSYLKQKLSLPLVKYSALGIASGLWVFGLADQFYESAAMMKYLLLSL
Ga0190274_1079078133300018476SoilMSYLKQKLSLPLVKYSALGIASGLWVFGLADQFYESAAMMKYLLLSLLMAAVVFS
Ga0190274_1172362323300018476SoilMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Ga0066669_1092377513300018482Grasslands SoilMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLL
Ga0173481_1005411323300019356SoilMSYLKRKLSLPLVKYSLFGIASGLWVFGLVDQLYDSPATMKYLLLSLLMAAVAFI
Ga0210380_1001534553300021082Groundwater SedimentMSYLKQKLSLPLVKYSALGIASGLWVFGLADQFYESAAMMKYLLLSLLMAAVVFI
Ga0207681_1089353923300025923Switchgrass RhizosphereMSYLKQKLSLPLVRYSAFAIASSLWVFGLVDQFYESAAVMKYLLLSLLMAAIAFL
Ga0207687_1026061733300025927Miscanthus RhizosphereVKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSL
Ga0207701_1115949513300025930Corn, Switchgrass And Miscanthus RhizosphereMSFLKQKLATPLVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLMAAVAFI
Ga0207701_1124944323300025930Corn, Switchgrass And Miscanthus RhizosphereMSYLKRKLSLPLVKYSLFGIASGLWVFGLVDQLYDSPATMKYLLLSLLMA
Ga0207701_1131842823300025930Corn, Switchgrass And Miscanthus RhizosphereMSYLKQKLSLPLVKYSVITIASTLWVFGLVDQLDSSAAMMKYLLLSLLIAALAFI
Ga0207708_1080668023300026075Corn, Switchgrass And Miscanthus RhizosphereFEMSFLKQKLAIPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Ga0207648_1206608213300026089Miscanthus RhizosphereMPVVKYSVLGLASGLWVFGLVDQLYSSAAMMKYVLLSLLMAAVAFI
Ga0207648_1219358023300026089Miscanthus RhizosphereMSYLKQKLSLPLVKYSAFAIASSLWVFGLVDQFYESAAVMKYLLLSLLMAAVVFI
Ga0209813_1030378333300027866Populus EndosphereMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Ga0209488_1005406023300027903Vadose Zone SoilMSFLKQKLAMPVVKYSMLGLASGLWVFGLVDQFYSSASMMKYLLLSLLMAAVAFI
Ga0209069_1048852613300027915WatershedsMSFLKQKLSLPLVKYSALAVASSLWVFGLVEQLYSSAEMMKYLLLSILMAAVAFI
Ga0268266_1030213513300028379Switchgrass RhizosphereMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSAAMMKYVLLSLLMAAVAFI
Ga0307283_1001286233300028790SoilMSYLKQKLSQPLVKYSVFGLASGLWVFGLVDQLYESAAMMKYLLLSLLMAAVAFI
Ga0170824_10280369213300031231Forest SoilMSFLKQKLSLPLVKFGVLGVAGCLWLFGLVDQFYSSAAMMKYLLLSLLMAAVAFL
Ga0265325_10001048103300031241RhizosphereMMSGLKAKLSLPVVKYSVLAVATALWGFGLVDQLYSSAATMKYLAMSLLIAAVALI
Ga0265325_1032240623300031241RhizosphereKQKLSLPLVKYSVLSVALVLWTFGLIDQLYSSAAMMKYLLLSILMAAVAFI
Ga0265339_1046162313300031249RhizosphereMSFLKQKLSLPVVKYSVLSIALVLWTFGLVDQLYSSAAMMKYLLLSLLMAAVAFI
Ga0265331_1026314013300031250RhizosphereMSFLKQKLSLPLVKYSVLSVALVLWTFGLIDQLYSSAAMMKYLLLSILMAAVAFI
Ga0265316_1104710413300031344RhizosphereSLPVVKYSVLSIALVLWTFGLVDQLYSSAAMMKYLLLSLLMAAVAFI
Ga0170818_10764960923300031474Forest SoilQKLTMPVVKYSVLGLASCLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Ga0265313_1019074313300031595RhizosphereMTYLKAKLSLPIVKYGILGLCSVLWAFGLVDQLYSSAATMKYLLMSILMA
Ga0310813_1018351523300031716SoilMSFLRQKLAIPVVKYSVLGLGSGLWVLGLVEQFYSSAAMMKYVLLSLLMAAVAFI
Ga0310813_1220914023300031716SoilMSYLKAKLSLPVVKYCAFAIALTLWGFGLVDQLYSSAAVMKYILLSLL
Ga0302321_10169604113300031726FenMPVVKYSVLGLASGLWVFGLVDQLYSSASMMKYLLLSLLMAAVAFI
Ga0310892_1127061613300031858SoilMSFPKQKLAIPVVKYSVLGLASGLWVFGLIDQLYSSASMMKYLLLSLLMAAV
Ga0307416_10227079223300032002RhizosphereMSYLKQKLSLPIVKYSVLAIASGLWVFGLIGQFYESAALMKYLLLSLL
Ga0334722_1016026233300033233SedimentMSYLKAKLSLPVVKYSVAAVAFTLWGFGLIEQLYSSAAVMKYILLSLLIAAVALF
Ga0373959_0110746_529_6603300034820Rhizosphere SoilMSFLKQKLAMPVVKYSVLGLASGLWVFGLVDQLYSSAEMMKYLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.