| Basic Information | |
|---|---|
| Family ID | F071416 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATIATIGN |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 31.15 % |
| % of genes from short scaffolds (< 2000 bps) | 86.89 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.869 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (10.656 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.377 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (81.148 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.20% β-sheet: 0.00% Coil/Unstructured: 37.80% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00582 | Usp | 60.66 |
| PF07690 | MFS_1 | 3.28 |
| PF01266 | DAO | 3.28 |
| PF00300 | His_Phos_1 | 3.28 |
| PF00196 | GerE | 1.64 |
| PF06568 | DUF1127 | 1.64 |
| PF12833 | HTH_18 | 0.82 |
| PF00753 | Lactamase_B | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 1.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.87 % |
| Unclassified | root | N/A | 22.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004480|Ga0062592_101223919 | Not Available | 703 | Open in IMG/M |
| 3300005295|Ga0065707_10277836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1055 | Open in IMG/M |
| 3300005331|Ga0070670_100320047 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300005334|Ga0068869_100123570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1982 | Open in IMG/M |
| 3300005335|Ga0070666_10244326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300005338|Ga0068868_100814134 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005340|Ga0070689_101241804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 670 | Open in IMG/M |
| 3300005343|Ga0070687_101124330 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005347|Ga0070668_100151709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1874 | Open in IMG/M |
| 3300005347|Ga0070668_100230939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1529 | Open in IMG/M |
| 3300005347|Ga0070668_100246561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1481 | Open in IMG/M |
| 3300005354|Ga0070675_100478445 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300005355|Ga0070671_100895922 | Not Available | 775 | Open in IMG/M |
| 3300005356|Ga0070674_100267047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1351 | Open in IMG/M |
| 3300005438|Ga0070701_10124902 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300005441|Ga0070700_100215008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1359 | Open in IMG/M |
| 3300005455|Ga0070663_100007102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 6794 | Open in IMG/M |
| 3300005456|Ga0070678_100774050 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005459|Ga0068867_101057349 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005518|Ga0070699_101008073 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005539|Ga0068853_100155593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2060 | Open in IMG/M |
| 3300005543|Ga0070672_100911783 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005543|Ga0070672_101942713 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005545|Ga0070695_101352324 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005578|Ga0068854_101087627 | Not Available | 712 | Open in IMG/M |
| 3300005718|Ga0068866_10096615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
| 3300005718|Ga0068866_10942861 | Not Available | 610 | Open in IMG/M |
| 3300005719|Ga0068861_102693358 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005842|Ga0068858_101904241 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005844|Ga0068862_100538332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
| 3300005844|Ga0068862_102178200 | Not Available | 566 | Open in IMG/M |
| 3300006038|Ga0075365_10420342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 944 | Open in IMG/M |
| 3300006178|Ga0075367_10199359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1250 | Open in IMG/M |
| 3300006178|Ga0075367_10308943 | Not Available | 996 | Open in IMG/M |
| 3300006186|Ga0075369_10559166 | Not Available | 546 | Open in IMG/M |
| 3300006195|Ga0075366_10322423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300006195|Ga0075366_10539319 | Not Available | 722 | Open in IMG/M |
| 3300006353|Ga0075370_10025177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3289 | Open in IMG/M |
| 3300006846|Ga0075430_101019558 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006853|Ga0075420_100900401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300006881|Ga0068865_100814019 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006881|Ga0068865_100854208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 789 | Open in IMG/M |
| 3300009093|Ga0105240_12646074 | Not Available | 518 | Open in IMG/M |
| 3300009100|Ga0075418_12661297 | Not Available | 546 | Open in IMG/M |
| 3300009101|Ga0105247_10072004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2163 | Open in IMG/M |
| 3300009148|Ga0105243_10462495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300009156|Ga0111538_10382360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1783 | Open in IMG/M |
| 3300009162|Ga0075423_11821712 | Not Available | 657 | Open in IMG/M |
| 3300009176|Ga0105242_12712536 | Not Available | 545 | Open in IMG/M |
| 3300009177|Ga0105248_11112845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300009553|Ga0105249_10223665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1853 | Open in IMG/M |
| 3300009789|Ga0126307_10730221 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009797|Ga0105080_1039681 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010036|Ga0126305_10240936 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300010038|Ga0126315_10873626 | Not Available | 596 | Open in IMG/M |
| 3300010040|Ga0126308_10279760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1092 | Open in IMG/M |
| 3300010040|Ga0126308_10656495 | Not Available | 718 | Open in IMG/M |
| 3300010042|Ga0126314_10462869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 918 | Open in IMG/M |
| 3300010045|Ga0126311_11494077 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010371|Ga0134125_11304292 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300010375|Ga0105239_11086234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 921 | Open in IMG/M |
| 3300010375|Ga0105239_13337918 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011000|Ga0138513_100058341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 590 | Open in IMG/M |
| 3300011119|Ga0105246_10644079 | Not Available | 922 | Open in IMG/M |
| 3300012203|Ga0137399_10198130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
| 3300012355|Ga0137369_10053754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3508 | Open in IMG/M |
| 3300012899|Ga0157299_10347783 | Not Available | 508 | Open in IMG/M |
| 3300012912|Ga0157306_10267959 | Not Available | 611 | Open in IMG/M |
| 3300012918|Ga0137396_10163934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300012930|Ga0137407_10125597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2235 | Open in IMG/M |
| 3300012955|Ga0164298_11006468 | Not Available | 616 | Open in IMG/M |
| 3300013297|Ga0157378_11638636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 690 | Open in IMG/M |
| 3300014325|Ga0163163_10667125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1103 | Open in IMG/M |
| 3300014968|Ga0157379_11746718 | Not Available | 610 | Open in IMG/M |
| 3300014969|Ga0157376_10752561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300015245|Ga0137409_11331157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 561 | Open in IMG/M |
| 3300017792|Ga0163161_11782478 | Not Available | 547 | Open in IMG/M |
| 3300017965|Ga0190266_10051055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1462 | Open in IMG/M |
| 3300018028|Ga0184608_10313311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300018076|Ga0184609_10111391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1237 | Open in IMG/M |
| 3300018429|Ga0190272_10013571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4066 | Open in IMG/M |
| 3300018469|Ga0190270_10020524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4066 | Open in IMG/M |
| 3300018469|Ga0190270_10641484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1043 | Open in IMG/M |
| 3300018469|Ga0190270_11377481 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300018476|Ga0190274_13800086 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300019377|Ga0190264_10037015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1838 | Open in IMG/M |
| 3300025899|Ga0207642_10388581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 832 | Open in IMG/M |
| 3300025901|Ga0207688_10095546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1711 | Open in IMG/M |
| 3300025901|Ga0207688_10127248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300025901|Ga0207688_10227772 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300025903|Ga0207680_10213409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300025910|Ga0207684_10412557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1160 | Open in IMG/M |
| 3300025918|Ga0207662_11366499 | Not Available | 503 | Open in IMG/M |
| 3300025923|Ga0207681_10113174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1978 | Open in IMG/M |
| 3300025923|Ga0207681_10171672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1644 | Open in IMG/M |
| 3300025923|Ga0207681_10946866 | Not Available | 722 | Open in IMG/M |
| 3300025926|Ga0207659_10685986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 877 | Open in IMG/M |
| 3300025931|Ga0207644_10117155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2023 | Open in IMG/M |
| 3300025933|Ga0207706_10080979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2854 | Open in IMG/M |
| 3300025938|Ga0207704_10530752 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300025972|Ga0207668_11218484 | Not Available | 676 | Open in IMG/M |
| 3300026035|Ga0207703_11971182 | Not Available | 560 | Open in IMG/M |
| 3300026041|Ga0207639_11174844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 720 | Open in IMG/M |
| 3300026067|Ga0207678_10053126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3492 | Open in IMG/M |
| 3300026075|Ga0207708_10110941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2129 | Open in IMG/M |
| 3300026089|Ga0207648_10492912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 1120 | Open in IMG/M |
| 3300026118|Ga0207675_100280445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1619 | Open in IMG/M |
| 3300026121|Ga0207683_10413608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
| 3300026285|Ga0209438_1189366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 545 | Open in IMG/M |
| 3300028379|Ga0268266_10034897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4278 | Open in IMG/M |
| 3300028380|Ga0268265_11235823 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300028380|Ga0268265_11453091 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300028381|Ga0268264_10718634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 993 | Open in IMG/M |
| 3300028381|Ga0268264_11421544 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300028786|Ga0307517_10207577 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300028802|Ga0307503_10727169 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028814|Ga0307302_10365038 | Not Available | 713 | Open in IMG/M |
| 3300031184|Ga0307499_10000585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12232 | Open in IMG/M |
| 3300031911|Ga0307412_10278565 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300032205|Ga0307472_100881102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 827 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 8.20% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.56% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.10% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.82% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062592_1012239192 | 3300004480 | Soil | MHDRRIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIATIGN* |
| Ga0065707_102778361 | 3300005295 | Switchgrass Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0070670_1003200473 | 3300005331 | Switchgrass Rhizosphere | MHDRRIRRHAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0068869_1001235703 | 3300005334 | Miscanthus Rhizosphere | MHDRRIEPRPGVERIVIAALIVGFALALGYAFNELDAALTDACASLATIATIGN* |
| Ga0070666_102443263 | 3300005335 | Switchgrass Rhizosphere | SFRISDRSNFPAVGWIPKTMHDRRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN* |
| Ga0068868_1008141342 | 3300005338 | Miscanthus Rhizosphere | MHDRRIRLRGRIEQILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0070689_1012418042 | 3300005340 | Switchgrass Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN* |
| Ga0070687_1011243302 | 3300005343 | Switchgrass Rhizosphere | MHDRRIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN* |
| Ga0070668_1001517092 | 3300005347 | Switchgrass Rhizosphere | MHDRRIGLRGRIGRIFTAALIVGFALALGFALNELDAAVKDACSSLATIATIGN* |
| Ga0070668_1002309392 | 3300005347 | Switchgrass Rhizosphere | MHDRRIGRRAGIEHILIAALIAGLASGLGFALNELDAALKDAGSSLATIATIGN* |
| Ga0070668_1002465613 | 3300005347 | Switchgrass Rhizosphere | MHNEKIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIATIGN* |
| Ga0070675_1004784451 | 3300005354 | Miscanthus Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0070671_1008959221 | 3300005355 | Switchgrass Rhizosphere | MHDRRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIG |
| Ga0070674_1002670473 | 3300005356 | Miscanthus Rhizosphere | GPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN* |
| Ga0070701_101249023 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RSNFPAVGWIPKTMHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN* |
| Ga0070700_1002150083 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MHNERIGPRVGIEHMVIAALIVGFALSLGYALNELDAALRDACSSLATIAAIGN* |
| Ga0070663_1000071026 | 3300005455 | Corn Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLAIGLGFAFNELDAALKDAGSSLATMATIGN* |
| Ga0070678_1007740502 | 3300005456 | Miscanthus Rhizosphere | FPAVGWIPKTMHDRRIGRRAGIEHIHIAALIAGLALGLGFALNELDAALKDAGSSLATIATIGN* |
| Ga0068867_1010573491 | 3300005459 | Miscanthus Rhizosphere | IGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0070699_1010080731 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FRIFKLSNFPVVGWSKNPMHDRRIGLRGRIEHIFIAVLIVGFALALGFALNELDAAVKGACSSLAAIATIGN* |
| Ga0068853_1001555931 | 3300005539 | Corn Rhizosphere | MHDRRIRLRGRIEHILIAALIVGLALALGFALNEFDAAVSDACSSLATIATIGN* |
| Ga0070672_1009117831 | 3300005543 | Miscanthus Rhizosphere | MHNERIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIATIGN* |
| Ga0070672_1019427132 | 3300005543 | Miscanthus Rhizosphere | MHDRRIRRRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN* |
| Ga0070695_1013523241 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RIEHILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0068854_1010876271 | 3300005578 | Corn Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVNDACSSLATIATIGN* |
| Ga0068866_100966152 | 3300005718 | Miscanthus Rhizosphere | MHDRRIRLRGRIEHILIAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0068866_109428612 | 3300005718 | Miscanthus Rhizosphere | MHNEKIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIAAIGN* |
| Ga0068861_1026933581 | 3300005719 | Switchgrass Rhizosphere | WIQKTMHDRRIGLRGRIGRIFTAALIVGFALALGFALNELDAAVKDACSSLATIATIGN* |
| Ga0068863_1014738502 | 3300005841 | Switchgrass Rhizosphere | MHEQRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDA |
| Ga0068858_1019042412 | 3300005842 | Switchgrass Rhizosphere | KTMHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0068862_1005383322 | 3300005844 | Switchgrass Rhizosphere | MHDRRIRLLGRIEHIAIAALIVGFALALGFALNELDAAVNDACSSLATIATIGN* |
| Ga0068862_1021782002 | 3300005844 | Switchgrass Rhizosphere | MHDRRIGLRGRIEHIFIAVLIVGFALALGFALNELDAAVKGACSSLAAIATIGN* |
| Ga0075365_104203422 | 3300006038 | Populus Endosphere | MHNERTGPRAGMEHIVIAALIVGFALALGFAFNELDAAVKDACSSLATIATIGN* |
| Ga0075367_101993592 | 3300006178 | Populus Endosphere | MHDRRIGLRGRIERIFIAVLIVGFALTFGFALNELDAAVSDACSSLATIATIGN* |
| Ga0075367_103089432 | 3300006178 | Populus Endosphere | MGWIQKTMHDRRIGPRGRIEHILIAALTVGFALVLGFALNELDTAVSDTCSSLATIATIGN* |
| Ga0075369_105591662 | 3300006186 | Populus Endosphere | GWIQKTMHDRRIGPRGRIEHILIAALTVGFALVLGFALNELDTAVSDTCSSLATIATIGN |
| Ga0075366_103224232 | 3300006195 | Populus Endosphere | MHNERTGPRAGMEHIVIAALIVGFALALGFAFTELDAAVKDACSSLATIATIGN* |
| Ga0075366_105393193 | 3300006195 | Populus Endosphere | MRDRRIGLRGRIEQIFIAALIVGFALALGFALNALDAAGKDACSSLATIATIGN* |
| Ga0075370_100251772 | 3300006353 | Populus Endosphere | MHDRRIGLRGRIERIFIAVLMVGFALTFGFALNELDAAVSDACSSLATIATIGN* |
| Ga0075430_1010195582 | 3300006846 | Populus Rhizosphere | VRGSTEHIFIAALIMSFALALGVALNELDAAVTGVGSSLATIATIGD* |
| Ga0075420_1009004012 | 3300006853 | Populus Rhizosphere | MGVRGSTEHIFIAALIMSFALALGVALNELDAAVTGVGSSLATIATIGD* |
| Ga0068865_1008140192 | 3300006881 | Miscanthus Rhizosphere | AGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0068865_1008542081 | 3300006881 | Miscanthus Rhizosphere | MHDRRIEPRPGVERIVIAALIVGFALALGYAFNELDAALTDACASLATI |
| Ga0105240_126460742 | 3300009093 | Corn Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVKGACSSLAAIATIGN* |
| Ga0075418_126612972 | 3300009100 | Populus Rhizosphere | MHDRRIGLRGRIGRNFTAALIVGFALALGFALNELDAAVKDACSSLATIATIGN* |
| Ga0105247_100720043 | 3300009101 | Switchgrass Rhizosphere | MHDRRIGRRAGIEHILIAALIVGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0105243_104624952 | 3300009148 | Miscanthus Rhizosphere | MHNEKIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN* |
| Ga0111538_103823601 | 3300009156 | Populus Rhizosphere | AGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIAAIGN* |
| Ga0075423_118217123 | 3300009162 | Populus Rhizosphere | MHDRRIGLRGRIGRIFTAALIVGFALALGFALNELDAAVKDACSSL |
| Ga0105242_127125362 | 3300009176 | Miscanthus Rhizosphere | MHDRRIEPRPGVERIVIAALIVGFALALGYAFNELDAALTDASASLATIATIGN* |
| Ga0105248_111128452 | 3300009177 | Switchgrass Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACS |
| Ga0105249_102236651 | 3300009553 | Switchgrass Rhizosphere | RIRLRGRIEHILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0126307_107302212 | 3300009789 | Serpentine Soil | MHNERIGPRVGIEHIVIAALIVGFALSLGYALNELDAALKDACSSLATIAAIGN* |
| Ga0105080_10396811 | 3300009797 | Groundwater Sand | RRIGPRPGIEHIVIAALIVGFALAFGYALNELDAALKDACSSLATIATIGN* |
| Ga0126305_102409362 | 3300010036 | Serpentine Soil | MHNERIGPRVGIEHLVIAALIVGFALALGYALNELDAALKDACSGLATIAAIGN* |
| Ga0126315_108736261 | 3300010038 | Serpentine Soil | MHNERIGPRVGIEHIVIAALIVGFALSLGYALNELDAALKDACSGLATIAAIGN* |
| Ga0126308_102797601 | 3300010040 | Serpentine Soil | RSNFRVVGWIPKPMHDRRIETRGRIEHLVIAVLIVGFALALGYAFNEVDAAVKDACASLATIATIGN* |
| Ga0126308_106564953 | 3300010040 | Serpentine Soil | MHNERIGPRVGIEHIVIAALIVGFALSLGYALNELDAALKDTCWGLATIAAIGN* |
| Ga0126314_104628691 | 3300010042 | Serpentine Soil | RKPMHNERIGPRVGIEHIVIAALIVGFALALGYALNELDAALKDACSSLATIAAIGN* |
| Ga0126310_101850693 | 3300010044 | Serpentine Soil | AGWIPKPMHERIGPRVGVEHIVIAALIVGFALALGYAVNELDAALKDAC* |
| Ga0126311_114940772 | 3300010045 | Serpentine Soil | MHDEGIGPRVGIEHLVIAALIVGFALALGFALNELDAALKDACSGLATIAAIGN* |
| Ga0134125_113042922 | 3300010371 | Terrestrial Soil | MHDRRIRLRGRIEDILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN* |
| Ga0105239_110862343 | 3300010375 | Corn Rhizosphere | SDRSNFPAVGWIPKTMHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN* |
| Ga0105239_133379182 | 3300010375 | Corn Rhizosphere | MHNERIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIAAIGN* |
| Ga0138513_1000583412 | 3300011000 | Soil | MDDGRMGLRGMTEHILIAALIAGFALALGFLLNSSTPQLRDVCSSLATTSTIGN* |
| Ga0105246_106440792 | 3300011119 | Miscanthus Rhizosphere | MHEQRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0137399_101981303 | 3300012203 | Vadose Zone Soil | MHDRRSGRRDTIEHIFIAALIIGFALALGFALNELDAALNGACSSLATIATIGG* |
| Ga0137369_100537542 | 3300012355 | Vadose Zone Soil | MHDRRIGLRGRIEQIFIAALIVGFALALGFALNELDAAVKDACSSLATIATIGN* |
| Ga0157299_103477832 | 3300012899 | Soil | MHDERIGLRAGVEHIVIAALIVGFALALGFAFNELDAALTDACASLATIATIGN* |
| Ga0157306_102679591 | 3300012912 | Soil | MHDRRIESRPGVERIVIAALIVGFALALGYAFNELDAALTDACASLATIATIGN* |
| Ga0137396_101639342 | 3300012918 | Vadose Zone Soil | MHDRRSGRRDTIEHIFIAALIIGFALALGFALNELDAALNGACSSLATIVTIGG* |
| Ga0137407_101255971 | 3300012930 | Vadose Zone Soil | GLRAGIEHVVIAALIVGFALALGFALNELDAALKDACSSLATIATIGN* |
| Ga0164298_110064681 | 3300012955 | Soil | MHDRRIGLRAGIEHILIAALIIGLALGLGFAFNELDAAFKDAGSSLATMATIGN* |
| Ga0157378_116386363 | 3300013297 | Miscanthus Rhizosphere | MHDRRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0163163_106671253 | 3300014325 | Switchgrass Rhizosphere | RIGLRAGIEHILIAALIVGLALGLGFALNELDAALKDAGSSLATIATIGN* |
| Ga0157379_117467183 | 3300014968 | Switchgrass Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVSDACSSLSTIA |
| Ga0157376_107525612 | 3300014969 | Miscanthus Rhizosphere | MHDRRIGRRAGIEHILIAALIAGLALGLGFALNELDAALKDAGSSLATMATIGN* |
| Ga0137409_113311572 | 3300015245 | Vadose Zone Soil | MHDRRSGRRDTIEHIFIAALIIGFALALGFALNELDAALNGACSSLGTIATIGG* |
| Ga0163161_117824781 | 3300017792 | Switchgrass Rhizosphere | MHDRRIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN |
| Ga0190266_100510552 | 3300017965 | Soil | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0184608_103133111 | 3300018028 | Groundwater Sediment | LRAGIEHILIAALIIGFALALGFALNELDAALKDACSSLATIATIGN |
| Ga0184609_101113912 | 3300018076 | Groundwater Sediment | MHDRRIRLRDTIERILIAALIVGFALAHGFALNELDAAVKGTSSSLATLATIGD |
| Ga0190272_100135712 | 3300018429 | Soil | MRLRGMIEQVAMAVLIASFALAFGFAVHELDAAVKDACSSLATIATIGG |
| Ga0190270_100205243 | 3300018469 | Soil | MRLRGTIEQVAMAVLIAGFALAFGFAVYELDAAVKDACSSLATIATIGG |
| Ga0190270_106414842 | 3300018469 | Soil | MDDGHGVAPTEHIIIAALIMGFALALGVGLNELEAAVTAVGSSLATIATIGN |
| Ga0190270_113774812 | 3300018469 | Soil | MPERRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATIATIGN |
| Ga0190274_138000862 | 3300018476 | Soil | GIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0190264_100370152 | 3300019377 | Soil | MRLRGTIEQVAMAVLIAGFALAFGFAVHELDAAVKDACSSLATIATIGG |
| Ga0207642_103885812 | 3300025899 | Miscanthus Rhizosphere | MHNEKIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIAAIGN |
| Ga0207688_100955461 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHNEKIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATI |
| Ga0207688_101272482 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDRRIEPRPGVERIVIAALIVGFALALGYAFNELDAALTDACASLATIATIGN |
| Ga0207688_102277722 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHEQRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN |
| Ga0207680_102134093 | 3300025903 | Switchgrass Rhizosphere | MHNEKIGPRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN |
| Ga0207684_104125572 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHNERIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVSDACASLATIATIGN |
| Ga0207662_113664991 | 3300025918 | Switchgrass Rhizosphere | MHDRRIGRRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN |
| Ga0207681_101131742 | 3300025923 | Switchgrass Rhizosphere | MHDRRIRLRGRIEHILIAALIVGFALALGFALNEFDAAVSDACSSLATIATIGN |
| Ga0207681_101716723 | 3300025923 | Switchgrass Rhizosphere | MHDRRIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACSSLATIATIGN |
| Ga0207681_109468661 | 3300025923 | Switchgrass Rhizosphere | MHDRRIGLRGRIGRIFTAALIVGFALALGFALNELDAAVKDACSSLATIATIGN |
| Ga0207659_106859861 | 3300025926 | Miscanthus Rhizosphere | RIRRHAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0207644_101171553 | 3300025931 | Switchgrass Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATIATIGN |
| Ga0207706_100809793 | 3300025933 | Corn Rhizosphere | MHDRRIRLRGRIEHILIAALIVGFALALGFALNELDAAVSDACSSLATIATIGN |
| Ga0207704_105307521 | 3300025938 | Miscanthus Rhizosphere | IRRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0207668_112184841 | 3300025972 | Switchgrass Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAESDACS |
| Ga0207703_119711821 | 3300026035 | Switchgrass Rhizosphere | MHDRRIEPRPGVERMVIAALIVGFALALGYAFNELDAALTDACASLATIATIGN |
| Ga0207639_111748441 | 3300026041 | Corn Rhizosphere | MHDRRIRLRGRIEHILIAALIVGLALALGFALNEFDAAVSDACSSLATIATIGN |
| Ga0207678_100531262 | 3300026067 | Corn Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLAIGLGFAFNELDAALKDAGSSLATMATIGN |
| Ga0207708_101109413 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHNERIGPRVGIEHMVIAALIVGFALSLGYALNELDAALRDACSSLATIAAIGN |
| Ga0207648_104929121 | 3300026089 | Miscanthus Rhizosphere | IGLRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0207675_1002804453 | 3300026118 | Switchgrass Rhizosphere | MHNERIGPRAGIEHMVIAALIVGFALALGFAFNELDAAVKDACASLATIATIGN |
| Ga0207683_104136082 | 3300026121 | Miscanthus Rhizosphere | MHDRRIRRHAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0209438_11893662 | 3300026285 | Grasslands Soil | MHDRRSGRRDTIEHIFIAALIIGFVLALGFALNELDAALNGACSSLATIATIGD |
| Ga0268266_100348974 | 3300028379 | Switchgrass Rhizosphere | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN |
| Ga0268265_112358232 | 3300028380 | Switchgrass Rhizosphere | MHDRRIRLRGRIEHILVAALIVGFALALGFALNELDAAVSDACSSLATIATIGN |
| Ga0268265_114530912 | 3300028380 | Switchgrass Rhizosphere | MHDRRIRLLGRIEHIAIAALIVGFALALGFALNELDAAVNDACSSLATIATIGN |
| Ga0268264_107186342 | 3300028381 | Switchgrass Rhizosphere | MHDRRIRRHAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIA |
| Ga0268264_114215441 | 3300028381 | Switchgrass Rhizosphere | TMHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDAALKDACSGLATIATIGN |
| Ga0307517_102075771 | 3300028786 | Ectomycorrhiza | MHDRRIGLRAGIEHILIAALIIGLALGLGFALNELDVALKDAGSSLATMATIGN |
| Ga0307503_107271692 | 3300028802 | Soil | MHDRRIGRRAGIEHILIAALIIGLALGLGFALNELDAALKDAGSSLATMATIGN |
| Ga0307302_103650381 | 3300028814 | Soil | MHDRRIGLRGRIESIFIAALIVGFALALGFALNELDAAVKDACASLAAIATIGN |
| Ga0307499_100005859 | 3300031184 | Soil | MHERRIRLRAGIEHILIAALIIGLALGLGFAFNELDAALKDACSSLATMATIGN |
| Ga0307412_102785652 | 3300031911 | Rhizosphere | MHRERIGPCVGMEHIVIAALIVGFALSLGYALNELDAALKDACSSLATIAAIGN |
| Ga0307472_1008811023 | 3300032205 | Hardwood Forest Soil | MHERRIGRRAGIEHILIAALIIGLTLGLGFALNELDAALKDAGSSLATMATIGN |
| ⦗Top⦘ |