NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071381

Metagenome Family F071381

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071381
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 50 residues
Representative Sequence FLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Number of Associated Samples 106
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 97.54 %
% of genes from short scaffolds (< 2000 bps) 95.90 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.443 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.672 % of family members)
Environment Ontology (ENVO) Unclassified
(41.803 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(57.377 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 85.71%    β-sheet: 0.00%    Coil/Unstructured: 14.29%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF13787HXXEE 54.92
PF00144Beta-lactamase 5.74
PF08334T2SSG 0.82
PF08309LVIVD 0.82
PF12833HTH_18 0.82
PF00440TetR_N 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 5.74
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 5.74
COG2367Beta-lactamase class ADefense mechanisms [V] 5.74
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.44 %
UnclassifiedrootN/A6.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005288|Ga0065714_10531310All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87507Open in IMG/M
3300005294|Ga0065705_10399722All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005328|Ga0070676_10321315All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300005335|Ga0070666_11241100All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005340|Ga0070689_100838027All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005340|Ga0070689_101639552All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87584Open in IMG/M
3300005344|Ga0070661_100522579All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005345|Ga0070692_11167854All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005354|Ga0070675_100595139All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300005355|Ga0070671_101599680All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005356|Ga0070674_100139021All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300005356|Ga0070674_101549166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87597Open in IMG/M
3300005439|Ga0070711_101617584All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87567Open in IMG/M
3300005455|Ga0070663_100722115All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005456|Ga0070678_101600697All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87612Open in IMG/M
3300005459|Ga0068867_100973553All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005459|Ga0068867_102353084All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87507Open in IMG/M
3300005466|Ga0070685_10991796All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005548|Ga0070665_101370182All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005616|Ga0068852_101833913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300005617|Ga0068859_102396420All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005618|Ga0068864_102697440All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87503Open in IMG/M
3300005840|Ga0068870_10410493All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005841|Ga0068863_100460341All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300005841|Ga0068863_101986785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87591Open in IMG/M
3300005842|Ga0068858_100868016All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005843|Ga0068860_101459286All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005844|Ga0068862_100435769All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300006049|Ga0075417_10503800All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006196|Ga0075422_10561411All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006847|Ga0075431_101252089All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300006853|Ga0075420_100385470All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300006881|Ga0068865_101456699All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006881|Ga0068865_102018787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87523Open in IMG/M
3300007076|Ga0075435_101174259All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009036|Ga0105244_10256992All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300009094|Ga0111539_12116794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87653Open in IMG/M
3300009101|Ga0105247_11680440All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87524Open in IMG/M
3300009148|Ga0105243_11730512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87655Open in IMG/M
3300009156|Ga0111538_12703539All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87622Open in IMG/M
3300009177|Ga0105248_11785040All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300009610|Ga0105340_1211072All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300010400|Ga0134122_12039691All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87613Open in IMG/M
3300011435|Ga0137426_1190902All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87610Open in IMG/M
3300012476|Ga0157344_1005738All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012484|Ga0157333_1032794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87526Open in IMG/M
3300012487|Ga0157321_1038907All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87516Open in IMG/M
3300012488|Ga0157343_1008759All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012501|Ga0157351_1023242All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87673Open in IMG/M
3300012502|Ga0157347_1044337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87596Open in IMG/M
3300012514|Ga0157330_1019622All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012672|Ga0137317_1011088All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012882|Ga0157304_1025875All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012884|Ga0157300_1036914All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012891|Ga0157305_10070265All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300012891|Ga0157305_10102810All Organisms → cellular organisms → Bacteria → FCB group707Open in IMG/M
3300012896|Ga0157303_10154525Not Available619Open in IMG/M
3300012899|Ga0157299_10130252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87688Open in IMG/M
3300012903|Ga0157289_10109072All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87803Open in IMG/M
3300012907|Ga0157283_10405615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87508Open in IMG/M
3300012910|Ga0157308_10133550All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012958|Ga0164299_11230087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87568Open in IMG/M
3300012958|Ga0164299_11510700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87524Open in IMG/M
3300012961|Ga0164302_11534793All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87551Open in IMG/M
3300012961|Ga0164302_11613770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87540Open in IMG/M
3300012984|Ga0164309_11522398All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87572Open in IMG/M
3300012986|Ga0164304_10791003All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300012987|Ga0164307_11403824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87588Open in IMG/M
3300012987|Ga0164307_11916222All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87502Open in IMG/M
3300013096|Ga0157307_1145570All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87546Open in IMG/M
3300013296|Ga0157374_11484162All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300013306|Ga0163162_12145794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87641Open in IMG/M
3300014867|Ga0180076_1071294Not Available638Open in IMG/M
3300014880|Ga0180082_1115297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87614Open in IMG/M
3300014969|Ga0157376_12015499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87615Open in IMG/M
3300015373|Ga0132257_100046203All Organisms → cellular organisms → Bacteria4832Open in IMG/M
3300017965|Ga0190266_10559276All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis682Open in IMG/M
3300018051|Ga0184620_10113819All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300018067|Ga0184611_1347705All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87509Open in IMG/M
3300018074|Ga0184640_10390422Not Available628Open in IMG/M
3300018083|Ga0184628_10052392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2061Open in IMG/M
3300018083|Ga0184628_10183798Not Available1092Open in IMG/M
3300018469|Ga0190270_12233504All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87608Open in IMG/M
3300018481|Ga0190271_13087087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87559Open in IMG/M
3300019356|Ga0173481_10178445All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300022756|Ga0222622_10547064All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300022756|Ga0222622_10670287All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300023260|Ga0247798_1059908All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87536Open in IMG/M
3300023270|Ga0247784_1053530Not Available990Open in IMG/M
3300025315|Ga0207697_10240053All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025893|Ga0207682_10156573All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300025906|Ga0207699_11172005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87569Open in IMG/M
3300025926|Ga0207659_11083795All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300025926|Ga0207659_11311108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87621Open in IMG/M
3300025926|Ga0207659_11924645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87501Open in IMG/M
3300025931|Ga0207644_11471628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87572Open in IMG/M
3300025937|Ga0207669_10321497All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300026023|Ga0207677_10653217All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300026075|Ga0207708_10617194All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300026121|Ga0207683_11238305All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300027533|Ga0208185_1012976All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300027543|Ga0209999_1106790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87546Open in IMG/M
3300027573|Ga0208454_1083824Not Available743Open in IMG/M
3300028380|Ga0268265_10442922All Organisms → cellular organisms → Bacteria → Proteobacteria1211Open in IMG/M
3300028380|Ga0268265_12219371All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87556Open in IMG/M
3300028587|Ga0247828_10674559All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300028592|Ga0247822_10842395All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031562|Ga0310886_10090662All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300031562|Ga0310886_10181845All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300031573|Ga0310915_10087518All Organisms → cellular organisms → Bacteria → Acidobacteria2083Open in IMG/M
3300031858|Ga0310892_10465872All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031908|Ga0310900_10542795All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300031913|Ga0310891_10062917All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300032000|Ga0310903_10576089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87596Open in IMG/M
3300032003|Ga0310897_10435214All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87626Open in IMG/M
3300032075|Ga0310890_11130584All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87635Open in IMG/M
3300033551|Ga0247830_11475044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87544Open in IMG/M
3300034147|Ga0364925_0189440All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300034147|Ga0364925_0191783Not Available750Open in IMG/M
3300034149|Ga0364929_0031374All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300034894|Ga0373916_0019512All Organisms → cellular organisms → Bacteria837Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere7.38%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.28%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.46%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.82%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.82%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014867Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034894Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0065714_1053131023300005288Miscanthus RhizosphereCLFPFVAQPMIAEALGLTPMGLRDFMKRRRTELPALLKRTL*
Ga0065705_1039972223300005294Switchgrass RhizosphereQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0070676_1032131523300005328Miscanthus RhizospherePVPADQFLVTLVGSCLFPFVGQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0070666_1124110013300005335Switchgrass RhizosphereKRKKITPVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0070689_10083802713300005340Switchgrass RhizosphereFLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0070689_10163955223300005340Switchgrass RhizosphereTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0070661_10052257923300005344Corn RhizosphereVAADQFLVTLVGSCLFPFVVQPMIAEALGLSTTGVRQFMKRRRTELPALLKRMLHS*
Ga0070692_1116785413300005345Corn, Switchgrass And Miscanthus RhizosphereKIEPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0070675_10059513913300005354Miscanthus RhizosphereVTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0070671_10159968023300005355Switchgrass RhizosphereTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMNRRRTELPALLKRTL*
Ga0070674_10013902133300005356Miscanthus RhizosphereQINERAKQKKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRAFMKRRRVELPALLKRTL*
Ga0070674_10154916613300005356Miscanthus RhizosphereVTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL*
Ga0070711_10161758413300005439Corn, Switchgrass And Miscanthus RhizosphereYPFVAQPMIAEALGLGPKELRAFMKRRRTELPALLKRTL*
Ga0070663_10072211523300005455Corn RhizosphereVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0070678_10160069713300005456Miscanthus RhizosphereTLVGSCLFPFVAQPMIAEALGLTPMGLRDFMKRRRTELPALLKRTL*
Ga0068867_10097355323300005459Miscanthus RhizosphereTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRT*
Ga0068867_10235308413300005459Miscanthus RhizosphereFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0070685_1099179613300005466Switchgrass RhizosphereAKRKKIAPVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPRELRAFMKRRRAELPALLKRTL*
Ga0070665_10137018223300005548Switchgrass RhizosphereLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0068852_10183391313300005616Corn RhizospherePFVAQPMIAEALGLGPKELRDFMTRRRVELPALLKRTL*
Ga0068859_10239642023300005617Switchgrass RhizosphereTLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL*
Ga0068864_10269744023300005618Switchgrass RhizosphereLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0068870_1041049323300005840Miscanthus RhizosphereADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRAFMKRRRVELPALLKRTL*
Ga0068863_10046034113300005841Switchgrass RhizosphereAADQFLVTLVGSCLFPFVAQPMIAEALGLSTTGVRQFMKRRRTELPALLKRMLHS*
Ga0068863_10198678523300005841Switchgrass RhizosphereYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0068858_10086801623300005842Switchgrass RhizosphereVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0068860_10145928623300005843Switchgrass RhizosphereKIAPVAADQFLVTLVGGCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0068862_10043576913300005844Switchgrass RhizosphereLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0075417_1050380013300006049Populus RhizosphereDQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0075422_1056141123300006196Populus RhizosphereLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0075431_10125208913300006847Populus RhizosphereEWKKIAPVPADQFLVTLVGGCLYTFVVQPMIAEALGLGPKELRALMKRRRAELPALLKRTL*
Ga0075420_10038547043300006853Populus RhizosphereADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0068865_10145669913300006881Miscanthus RhizosphereVAPVPADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0068865_10201878713300006881Miscanthus RhizosphereYPFVAQPMIAEALGLRPKGLRDFMKRRRAELPALLKRTL*
Ga0075435_10117425923300007076Populus RhizosphereTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0105244_1025699213300009036Miscanthus RhizosphereTPVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL*
Ga0111539_1211679413300009094Populus RhizosphereNERAKQKGIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0105247_1168044023300009101Switchgrass RhizospherePVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRNFMKRRRAELPALLKRTL*
Ga0105243_1173051223300009148Miscanthus RhizosphereLVGSCLWPFVAQPMIAEALGLTPKGLRDFRKRRRTELPALLKRTL*
Ga0111538_1270353923300009156Populus RhizosphereSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL*
Ga0105248_1178504013300009177Switchgrass RhizosphereLVGSCLWPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL*
Ga0105340_121107213300009610SoilQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0134122_1203969123300010400Terrestrial SoilKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0137426_119090213300011435SoilTLVGSCLYTFVVQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL*
Ga0157344_100573823300012476Arabidopsis RhizosphereVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0157333_103279413300012484SoilVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0157321_103890713300012487Arabidopsis RhizosphereIVPVPADQFLVTLVGSCLYPFWAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0157343_100875923300012488Arabidopsis RhizosphereQQMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0157351_102324213300012501Unplanted SoilQINERAKQEKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRVELPALLKRTL*
Ga0157347_104433713300012502Arabidopsis RhizospherePADQFLVTLVGSCLYPFVAQPMIAEALGLTAKGLRDFMKRRRAELPALLKRTL*
Ga0157330_101962223300012514SoilDQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFLKRRRVELPALLKRTL*
Ga0137317_101108813300012672SoilRKKIAPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0157304_102587523300012882SoilPADQFLVTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL*
Ga0157300_103691423300012884SoilLVTLVGSCLFPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL*
Ga0157305_1007026513300012891SoilSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0157305_1010281013300012891SoilAKQQKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0157303_1015452513300012896SoilTLVGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL*
Ga0157299_1013025213300012899SoilQKKSVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTSRGLRDFMKRRRVELPALLKRTL
Ga0157289_1010907223300012903SoilMGWRKKIEPVSADQFLVTLVGSCLWPFVAQPMIAEALGLAPKGLRDFMKRRRTELPALLKRTL*
Ga0157283_1040561513300012907SoilPVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL*
Ga0157308_1013355023300012910SoilLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0164299_1123008713300012958SoilAPVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPNELRTFMKRRRAALPALLKRTL*
Ga0164299_1151070023300012958SoilWPFVAQPMLAEALGLTPKGLRDFRKRRRTELPALLKRTL*
Ga0164302_1153479313300012961SoilQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL*
Ga0164302_1161377023300012961SoilVAADQFLVTLVGSCLFPFVAQPMFAEALGLTATGVRQFMKRRRAELPALLKRTL*
Ga0164309_1152239823300012984SoilGSCLFPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL*
Ga0164304_1079100313300012986SoilKKIGPVAADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0164307_1140382423300012987SoilAKRKNIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL*
Ga0164307_1191622213300012987SoilPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL*
Ga0157307_114557023300013096SoilASCLFPFVAQPIIAEALGLTSKGLRDFMKRRRTELPALLKRTL*
Ga0157374_1148416223300013296Miscanthus RhizosphereFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0163162_1214579413300013306Switchgrass RhizosphereINERARRKKIAPVSADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL*
Ga0180076_107129413300014867SoilSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL*
Ga0180082_111529713300014880SoilKRIKPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL*
Ga0157376_1201549913300014969Miscanthus RhizosphereINELAKRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL*
Ga0132257_10004620313300015373Arabidopsis RhizosphereFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL*
Ga0190266_1055927623300017965SoilADQFLVTLVGSCLFPFVAQPMIAEALGLSATGVRQFMKRRRTELPALLKRTLSQ
Ga0184620_1011381913300018051Groundwater SedimentLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0184611_134770523300018067Groundwater SedimentFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0184640_1039042223300018074Groundwater SedimentQFLVTLVGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL
Ga0184628_1005239233300018083Groundwater SedimentARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0184628_1018379823300018083Groundwater SedimentFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL
Ga0190270_1223350413300018469SoilDQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0190271_1308708723300018481SoilVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0173481_1017844523300019356SoilSCLWPFVAQPMIAEALGLTPTGLRDFMKRRRTELPALLKRTL
Ga0222622_1054706423300022756Groundwater SedimentQFLVTLVGSCLFPFVAQPMIAEALGLGPRELRGFMKRRRTELPALLKRTL
Ga0222622_1067028723300022756Groundwater SedimentAQPMIAEALGLRPKELRGFMKRRRAELPALLKRTL
Ga0247798_105990823300023260SoilPVPADQFLVTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0247784_105353013300023270Plant LitterFPFVAQPMLAEALGLSATGVRQFMKRRRTELPALLKRTL
Ga0207697_1024005323300025315Corn, Switchgrass And Miscanthus RhizosphereLYPFVAQPMIAEALGLTAKGLRDFMKRRRTELPALLKRTL
Ga0207682_1015657333300025893Miscanthus RhizosphereLVGSCLWPFVAQPMIAEALGLTPKGLRDFIKRRRTELPALLKRTL
Ga0207699_1117200523300025906Corn, Switchgrass And Miscanthus RhizosphereVGSCLYPFVAQPMIAEALGLGPKELRAFMKRRRTELPALLKRTL
Ga0207659_1108379513300025926Miscanthus RhizosphereLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0207659_1131110813300025926Miscanthus RhizospherePADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0207659_1192464523300025926Miscanthus RhizosphereLVTLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL
Ga0207644_1147162823300025931Switchgrass RhizosphereADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMNRRRTELPALLKRTL
Ga0207669_1032149713300025937Miscanthus RhizosphereCLWPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL
Ga0207677_1065321723300026023Miscanthus RhizosphereRKKIAPVSADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0207708_1061719423300026075Corn, Switchgrass And Miscanthus RhizosphereTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL
Ga0207683_1123830523300026121Miscanthus RhizosphereYPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL
Ga0207698_1168470023300026142Corn RhizosphereVEQQINERAKRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL
Ga0208185_101297613300027533SoilADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL
Ga0209999_110679013300027543Arabidopsis Thaliana RhizospherePVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRTELPALLKRTL
Ga0208454_108382423300027573SoilGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL
Ga0268265_1044292233300028380Switchgrass RhizosphereFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL
Ga0268265_1221937113300028380Switchgrass RhizosphereLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0247828_1067455923300028587SoilVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0247822_1084239523300028592SoilRARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL
Ga0310886_1009066213300031562SoilNERARQKQIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL
Ga0310886_1018184513300031562SoilRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRNFMKRRRTELPALLKRTL
Ga0310915_1008751843300031573SoilEVKRKKLAPVPADQFLLTLVGSCLYPFAARSTLADVLGLGPKQVRRFMERRRKELPAFLKRALQR
Ga0310892_1046587223300031858SoilTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKKTL
Ga0310900_1054279523300031908SoilPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0310891_1006291713300031913SoilERAKQKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL
Ga0310903_1057608913300032000SoilQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0310897_1043521413300032003SoilVTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKKTL
Ga0310890_1113058413300032075SoilINERAKQEKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL
Ga0247830_1147504413300033551SoilVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL
Ga0364925_0189440_2_2113300034147SedimentEQQINERARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL
Ga0364925_0191783_616_7503300034147SedimentVGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL
Ga0364929_0031374_2_1603300034149SedimentADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL
Ga0373916_0019512_674_8353300034894Sediment SlurryPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.