Basic Information | |
---|---|
Family ID | F071351 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 44 residues |
Representative Sequence | LPTIFRLENDFVQPWLLGFRPPVFSTYWKYLDIDLARRK |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 90.98 % |
% of genes from short scaffolds (< 2000 bps) | 92.62 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.967 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.836 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.328 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.443 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 0.00% Coil/Unstructured: 83.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF00067 | p450 | 18.03 |
PF04909 | Amidohydro_2 | 15.57 |
PF11838 | ERAP1_C | 3.28 |
PF00496 | SBP_bac_5 | 3.28 |
PF00156 | Pribosyltran | 2.46 |
PF07452 | CHRD | 1.64 |
PF01717 | Meth_synt_2 | 1.64 |
PF13436 | Gly-zipper_OmpA | 1.64 |
PF00691 | OmpA | 1.64 |
PF01594 | AI-2E_transport | 0.82 |
PF00498 | FHA | 0.82 |
PF13899 | Thioredoxin_7 | 0.82 |
PF01872 | RibD_C | 0.82 |
PF13417 | GST_N_3 | 0.82 |
PF13098 | Thioredoxin_2 | 0.82 |
PF00441 | Acyl-CoA_dh_1 | 0.82 |
PF05292 | MCD | 0.82 |
PF13419 | HAD_2 | 0.82 |
PF00817 | IMS | 0.82 |
PF07043 | DUF1328 | 0.82 |
PF00005 | ABC_tran | 0.82 |
PF11799 | IMS_C | 0.82 |
PF07584 | BatA | 0.82 |
PF01227 | GTP_cyclohydroI | 0.82 |
PF13714 | PEP_mutase | 0.82 |
PF12695 | Abhydrolase_5 | 0.82 |
PF13847 | Methyltransf_31 | 0.82 |
PF13519 | VWA_2 | 0.82 |
PF13458 | Peripla_BP_6 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 18.03 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.64 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.82 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.82 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.82 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.82 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.82 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.97 % |
Unclassified | root | N/A | 18.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000886|AL3A1W_1802184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300004091|Ga0062387_100851163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 685 | Open in IMG/M |
3300004092|Ga0062389_103698465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 574 | Open in IMG/M |
3300004156|Ga0062589_100208125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1420 | Open in IMG/M |
3300004779|Ga0062380_10067493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
3300004781|Ga0062379_10029657 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005176|Ga0066679_10085413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1893 | Open in IMG/M |
3300005187|Ga0066675_10049684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2575 | Open in IMG/M |
3300005328|Ga0070676_10779024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 704 | Open in IMG/M |
3300005331|Ga0070670_101755378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 571 | Open in IMG/M |
3300005343|Ga0070687_100361915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300005356|Ga0070674_100558569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300005367|Ga0070667_100774924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 890 | Open in IMG/M |
3300005436|Ga0070713_100118346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2319 | Open in IMG/M |
3300005438|Ga0070701_11374238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae | 507 | Open in IMG/M |
3300005439|Ga0070711_100991043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 721 | Open in IMG/M |
3300005445|Ga0070708_101415246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 648 | Open in IMG/M |
3300005450|Ga0066682_10547391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300005458|Ga0070681_10382812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1317 | Open in IMG/M |
3300005467|Ga0070706_100593348 | Not Available | 1029 | Open in IMG/M |
3300005468|Ga0070707_101825600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300005471|Ga0070698_100671722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 977 | Open in IMG/M |
3300005539|Ga0068853_102119266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 545 | Open in IMG/M |
3300005547|Ga0070693_101230182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 576 | Open in IMG/M |
3300005598|Ga0066706_10459985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
3300005841|Ga0068863_100042143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4337 | Open in IMG/M |
3300005841|Ga0068863_102134272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 570 | Open in IMG/M |
3300006237|Ga0097621_100219450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1656 | Open in IMG/M |
3300006755|Ga0079222_10249746 | Not Available | 1114 | Open in IMG/M |
3300006903|Ga0075426_10237796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1325 | Open in IMG/M |
3300006904|Ga0075424_101577932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 696 | Open in IMG/M |
3300006914|Ga0075436_100782512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
3300006954|Ga0079219_11295795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 641 | Open in IMG/M |
3300009091|Ga0102851_12464685 | Not Available | 595 | Open in IMG/M |
3300009101|Ga0105247_11792038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 510 | Open in IMG/M |
3300009156|Ga0111538_12238098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 687 | Open in IMG/M |
3300009162|Ga0075423_11982448 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300009174|Ga0105241_12564507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
3300010038|Ga0126315_11208310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
3300010043|Ga0126380_10552283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
3300010303|Ga0134082_10138430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 979 | Open in IMG/M |
3300010320|Ga0134109_10061574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1258 | Open in IMG/M |
3300010326|Ga0134065_10478081 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010343|Ga0074044_10356840 | Not Available | 959 | Open in IMG/M |
3300010376|Ga0126381_100766086 | Not Available | 1384 | Open in IMG/M |
3300010376|Ga0126381_101086301 | Not Available | 1156 | Open in IMG/M |
3300010396|Ga0134126_11014342 | Not Available | 929 | Open in IMG/M |
3300010397|Ga0134124_11585977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 685 | Open in IMG/M |
3300010400|Ga0134122_13154376 | Not Available | 516 | Open in IMG/M |
3300012199|Ga0137383_11290862 | Not Available | 521 | Open in IMG/M |
3300012200|Ga0137382_10885143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
3300012205|Ga0137362_10934611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300012208|Ga0137376_10688004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
3300012210|Ga0137378_11526042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300012349|Ga0137387_10393651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
3300012359|Ga0137385_10993411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
3300012361|Ga0137360_11004315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 720 | Open in IMG/M |
3300012361|Ga0137360_11348497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300012362|Ga0137361_11772571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
3300012927|Ga0137416_11145844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
3300012960|Ga0164301_10771924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 732 | Open in IMG/M |
3300012988|Ga0164306_11034450 | Not Available | 679 | Open in IMG/M |
3300013102|Ga0157371_10473949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 922 | Open in IMG/M |
3300013307|Ga0157372_11116901 | Not Available | 912 | Open in IMG/M |
3300013308|Ga0157375_12158892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 663 | Open in IMG/M |
3300013308|Ga0157375_12180194 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300014157|Ga0134078_10635295 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300014969|Ga0157376_10295380 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300014969|Ga0157376_10428311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1285 | Open in IMG/M |
3300016357|Ga0182032_10072186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2337 | Open in IMG/M |
3300017927|Ga0187824_10235698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 632 | Open in IMG/M |
3300017961|Ga0187778_10611007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300018071|Ga0184618_10230402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 780 | Open in IMG/M |
3300018072|Ga0184635_10246666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 707 | Open in IMG/M |
3300018081|Ga0184625_10640380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
3300018482|Ga0066669_12315423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300019879|Ga0193723_1026030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1777 | Open in IMG/M |
3300019888|Ga0193751_1243507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
3300020579|Ga0210407_11456752 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300021080|Ga0210382_10074536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1379 | Open in IMG/M |
3300022534|Ga0224452_1188304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
3300025885|Ga0207653_10066720 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300025898|Ga0207692_10630937 | Not Available | 691 | Open in IMG/M |
3300025907|Ga0207645_10668048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 706 | Open in IMG/M |
3300025910|Ga0207684_10229636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1601 | Open in IMG/M |
3300025913|Ga0207695_10663402 | Not Available | 924 | Open in IMG/M |
3300025916|Ga0207663_10362221 | Not Available | 1100 | Open in IMG/M |
3300025918|Ga0207662_10754800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 684 | Open in IMG/M |
3300025927|Ga0207687_10931286 | Not Available | 744 | Open in IMG/M |
3300025944|Ga0207661_10737257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
3300025986|Ga0207658_12149407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300026550|Ga0209474_10343700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
3300027616|Ga0209106_1128874 | Not Available | 567 | Open in IMG/M |
3300029951|Ga0311371_10477634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1656 | Open in IMG/M |
3300029987|Ga0311334_10127439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1901 | Open in IMG/M |
3300030052|Ga0302217_10140229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
3300030838|Ga0311335_10266788 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300031170|Ga0307498_10379584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 550 | Open in IMG/M |
3300031199|Ga0307495_10129634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 631 | Open in IMG/M |
3300031232|Ga0302323_101520408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
3300031680|Ga0318574_10070682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1884 | Open in IMG/M |
3300031720|Ga0307469_10136847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
3300031740|Ga0307468_102363780 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300031820|Ga0307473_11300075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 544 | Open in IMG/M |
3300031938|Ga0308175_102211671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
3300032009|Ga0318563_10742699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
3300032076|Ga0306924_10035742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5425 | Open in IMG/M |
3300032164|Ga0315283_11991237 | Not Available | 578 | Open in IMG/M |
3300032174|Ga0307470_11077218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 645 | Open in IMG/M |
3300032174|Ga0307470_11778241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300032180|Ga0307471_102873669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 611 | Open in IMG/M |
3300032205|Ga0307472_100220518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1461 | Open in IMG/M |
3300032261|Ga0306920_101374573 | Not Available | 1013 | Open in IMG/M |
3300032397|Ga0315287_10303986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax | 1880 | Open in IMG/M |
3300032892|Ga0335081_10395092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
3300033433|Ga0326726_10498396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 1165 | Open in IMG/M |
3300034125|Ga0370484_0041653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1120 | Open in IMG/M |
3300034354|Ga0364943_0068509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1199 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.02% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.28% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.46% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.64% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.64% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.64% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.82% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.82% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.82% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.82% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.82% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AL3A1W_18021841 | 3300000886 | Permafrost | YMPELPTIFRLENDFVQPWLLGFSPPVFSTYWKYLDIDLARRESAR* |
Ga0062387_1008511631 | 3300004091 | Bog Forest Soil | TIFRLENDFVQPWVQGYSPPVWTSYWKYLDIDPARRRAMAR* |
Ga0062389_1036984651 | 3300004092 | Bog Forest Soil | ELPLIFRQENDFLQPWLLGFRPPVFETYWKYLDIDLARRRQAGH* |
Ga0062589_1002081251 | 3300004156 | Soil | PAIFRLENDFVQPWIQGYRPQLFQTYWKYIDIDLARQRGAGGK* |
Ga0062380_100674932 | 3300004779 | Wetland Sediment | PLVPAIFRLENNFVQPWLQGFSPPVFKTYWKYLDLDLAQRRRVEGR* |
Ga0062379_100296571 | 3300004781 | Wetland Sediment | PAVFRLENDFVQPWVRGFSPPIFRPYWKYLDLDLPKRDAASRR* |
Ga0066679_100854132 | 3300005176 | Soil | YMPELPAIFRLENDFVQPWLLGFRPPVFATYWKYLDIDLARRK* |
Ga0066675_100496842 | 3300005187 | Soil | MSELARTYMPMLPAIFRLENDFVQPWLRGFRPPIFSTYWKYLDIDFDRRK* |
Ga0070676_107790241 | 3300005328 | Miscanthus Rhizosphere | AYMPLLPTIFRRENDFVQPWLQGFRPQVFSTYWQFMDIDLARRKRAG* |
Ga0070670_1017553781 | 3300005331 | Switchgrass Rhizosphere | YMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERKKRAG* |
Ga0070666_109286891 | 3300005335 | Switchgrass Rhizosphere | PLYFRLESDYVHPWVSGYRPFVFSSYWKYLDVDVARRRRAGTKE* |
Ga0070687_1003619151 | 3300005343 | Switchgrass Rhizosphere | PAIFRLQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESGR* |
Ga0070674_1005585693 | 3300005356 | Miscanthus Rhizosphere | YFRLESDYVHPWVSGYRPFVFSSYWKYLDVDLARQRRAGTKE* |
Ga0070667_1007749242 | 3300005367 | Switchgrass Rhizosphere | MNEMARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERKKRAG* |
Ga0070713_1001183464 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEMARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERRKRAG* |
Ga0070701_113742381 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EMPTIFRLQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESGR* |
Ga0070711_1009910432 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERRKRAG* |
Ga0070708_1014152461 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YMPELPAIFRLENDFVQPWLLGFRPPIFSTYWKYLDIDLARRK* |
Ga0066682_105473912 | 3300005450 | Soil | SELASTYAPILPTIFRLQNDFVQPWVQGYSKQLYTNYWKYLDVDLARRK* |
Ga0070681_103828121 | 3300005458 | Corn Rhizosphere | RAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG* |
Ga0070706_1005933482 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG* |
Ga0070707_1018256002 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YVPIIPAIFRLENDFVQPWIQGYRPQMFQTYWKYLDIDLARLRRAEGK* |
Ga0070698_1006717221 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RTYMPELPAIFRLENDFVQPWLLGFRPPIFSTYWKYLDIDLARRK* |
Ga0068853_1021192662 | 3300005539 | Corn Rhizosphere | MNEMARAYMPLLPTIFRRENDFVHPWLQGFRPQVFSTYWQFMDIDLDRRKRAG* |
Ga0070693_1012301821 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RTFVPIIPAIFRLENDFVQPWIQGYRPQLFQTYWKYIDIDLARQRRAEGK* |
Ga0066706_104599851 | 3300005598 | Soil | MSELARTYMPMLPAIFRLENDFVQPWLRGFRPPIFSTYWKYLDIDLDRRK* |
Ga0068863_1000421438 | 3300005841 | Switchgrass Rhizosphere | RLESNYVQPWLQGFRPGVFSSYWKYLDIDLARRK* |
Ga0068863_1021342722 | 3300005841 | Switchgrass Rhizosphere | MYMPELPAAFRLESHIAQPWVQGFAPPVFTSYWKYLDIDLARRKASLGK* |
Ga0097621_1002194501 | 3300006237 | Miscanthus Rhizosphere | RTYTPELPAIFRLQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESAR* |
Ga0079222_102497461 | 3300006755 | Agricultural Soil | RENDFVQPWLLGFRPQVFSTYWQFMDIDLERKKRAG* |
Ga0075426_102377962 | 3300006903 | Populus Rhizosphere | ARTYMPEMPAIYRLENFFVHGWVRGFAPPIFSTYWKYLDIDVAQRRQAADKAPR* |
Ga0075424_1015779322 | 3300006904 | Populus Rhizosphere | RAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERRKRAG* |
Ga0075436_1007825121 | 3300006914 | Populus Rhizosphere | MSDIARTYMPEMPAIYRLENFFVHGWVRGFAPPIFSSYWKYLDIDLAQRRQAADKAPR* |
Ga0079219_112957952 | 3300006954 | Agricultural Soil | LARTYMPEMPAIFRLENDFVQPWLLGFSPQLFSTYWKYLDIDLARRKSAR* |
Ga0102851_124646851 | 3300009091 | Freshwater Wetlands | TDIARTYAPLIPGVFRLQNIYVQPWLQGFSPPVFQTYWKYLDIDLARRQQANGK* |
Ga0105247_117920381 | 3300009101 | Switchgrass Rhizosphere | DFVQPWILGYRPQIFQTYWKYIDIDLARQRRADGK* |
Ga0111538_122380981 | 3300009156 | Populus Rhizosphere | PELPAAFRLESNIVQPWVLGFAPPIFTSYWKYLDIDLARRKAALGK* |
Ga0075423_119824481 | 3300009162 | Populus Rhizosphere | DLARTYVPELPVIFRLENDFVQPWLLGFRPPTFATYWKYLDIDLARRQAAKK* |
Ga0105241_125645071 | 3300009174 | Corn Rhizosphere | TYVPELPTIFRLENDFVQPWLEGFAPQTFETYWKYMDIDEAKRRATR* |
Ga0126315_112083101 | 3300010038 | Serpentine Soil | RTYMPELPAVYRLDNNFVQPWVQGFAPPVFSSYWKYLDIDLERRRRGTDKSRP* |
Ga0126380_105522832 | 3300010043 | Tropical Forest Soil | LIPTIFRLENDFVQPWVLGYYKPLYQSYWKYLDIDLARRQQAHR* |
Ga0134082_101384301 | 3300010303 | Grasslands Soil | LPTIFRLENDFVQPWLLGFRPPVFSTYWKYLDIDLARRK* |
Ga0134109_100615741 | 3300010320 | Grasslands Soil | RTYMPELPAIFRLENDFVQPWLLGFRPPVFSTYWKYLDIDLARRK* |
Ga0134065_104780811 | 3300010326 | Grasslands Soil | IFRQQNDFTQPWLLGYSPMRFATYWKYLDIDLARRQRAGH* |
Ga0074044_103568402 | 3300010343 | Bog Forest Soil | PTVFRLENDFVQPWLLGFRPQVFSTYWKYLDIDLAQREQAGVR* |
Ga0126381_1007660862 | 3300010376 | Tropical Forest Soil | TYVPLIPTIFRLENDFVQPWVLGYYKPLYRSYWKYLDIDLARKQQAHR* |
Ga0126381_1010863011 | 3300010376 | Tropical Forest Soil | TYVPLIPTIFRLENDFVQPWVLGYYKPLYRSYWKYLDIDLARRQQAQR* |
Ga0134126_110143421 | 3300010396 | Terrestrial Soil | PLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG* |
Ga0134124_115859771 | 3300010397 | Terrestrial Soil | RLQNDFIQPWLLGFSPQVFSTYWKYLDIDLARRESAR* |
Ga0134122_131543761 | 3300010400 | Terrestrial Soil | RLESNYVQPWLKGFRPGVFSSYWKYLDIDLARRK* |
Ga0137383_112908621 | 3300012199 | Vadose Zone Soil | FRLENDFVQPWLRGFSAPIFSTYWKYLDIDLDRRK* |
Ga0137382_108851431 | 3300012200 | Vadose Zone Soil | TYMPQLPAVYRLDNHFVQPWVQGFAPPVFSSYWKYLDIDLPLRRRATEKSRP* |
Ga0137362_109346112 | 3300012205 | Vadose Zone Soil | PAIFRLENDFVQPWLRGFSAPVFSTYWKYLDIDLDRRR* |
Ga0137376_106880043 | 3300012208 | Vadose Zone Soil | MLPAIFRLENDFVQPWLRGFRPPIFSTYWKYLDIDLDRRK* |
Ga0137378_115260421 | 3300012210 | Vadose Zone Soil | LFPVIFRLENDFVQPWLRGFSSPIFSTYWKYLDIDLDRRK* |
Ga0137387_103936512 | 3300012349 | Vadose Zone Soil | SELARTYMPELPAIFRLENDFVQPWLFGFRPPIFSTYWKYLDIDLARRQAR* |
Ga0137385_109934111 | 3300012359 | Vadose Zone Soil | FRLENDFVQPWVQGYSPPRFTNYWKYLDIDLARRKAK* |
Ga0137360_110043152 | 3300012361 | Vadose Zone Soil | MTDLALTYMPQLPAAFRLENEFVQPWVRGFSPMVFSSYWKYLDIDLTKRRTMTGK* |
Ga0137360_113484971 | 3300012361 | Vadose Zone Soil | TYMPMLPAIFRLENDFVQPWVRGFSPPVFSTYWKYLDIDLARPK* |
Ga0137361_117725712 | 3300012362 | Vadose Zone Soil | PMLPAIFRLENDFVQPWLRGFSPPVFSTYWKYLDIDLARPK* |
Ga0137416_111458442 | 3300012927 | Vadose Zone Soil | YFRLENNYVQPWLMGFSPFVFSSYWKYLDIDLARRR* |
Ga0164301_107719241 | 3300012960 | Soil | MTELARTYMPELPAIFRLQNDFVQPWLLGFSPQVFSTYWKYLDID |
Ga0164306_110344502 | 3300012988 | Soil | LQNDFVQPWVLGFSPQVFSTYWKYLDIDLARRESGR* |
Ga0157371_104739492 | 3300013102 | Corn Rhizosphere | AIARAYMPLLPTIFRRENDFVQPWLQGFRPQVFSTYWQFMDIDLARRKRAG* |
Ga0157372_111169012 | 3300013307 | Corn Rhizosphere | ARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG* |
Ga0157375_121588921 | 3300013308 | Miscanthus Rhizosphere | LQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESAR* |
Ga0157375_121801942 | 3300013308 | Miscanthus Rhizosphere | VYFRLESNYVQPWLTGFRPFVFSTYWKYLDIDPAKRK* |
Ga0134078_106352951 | 3300014157 | Grasslands Soil | TIFRLQNDLVQPWVQGYSKQLYTNYWKYLDVDLARRK* |
Ga0157376_102953801 | 3300014969 | Miscanthus Rhizosphere | RLESNYVQPWLSGFRPGVFSSYWKYLDVDTAKRK* |
Ga0157376_104283111 | 3300014969 | Miscanthus Rhizosphere | MTELARTYTPELPAIFRLQNDFVQPWLLGFSPQVFSTYW |
Ga0182032_100721861 | 3300016357 | Soil | RTYEPLIPTIFRLQNDFVQPWVLGYNKPLYTTYWKYLDIDLARQRAAAR |
Ga0187824_102356982 | 3300017927 | Freshwater Sediment | ARTYMPELPVIFRLENDFVQPWLLGFRPPKFGTYWKYLDIDRARQKQK |
Ga0187778_106110072 | 3300017961 | Tropical Peatland | PTIFRLENDFVQPWVLGYHKHPYTTYWKYIDIDLAREKRASH |
Ga0187778_111751781 | 3300017961 | Tropical Peatland | RTYMPMLPNVFRLESQVVQPWVEGFSPFVFQQYWKYLDIELTRRPVYGR |
Ga0187765_101215642 | 3300018060 | Tropical Peatland | LQNDFVQPWVLGYHKHPYATYWKYLDLDLARRQQAQH |
Ga0184618_102304021 | 3300018071 | Groundwater Sediment | MPTIFRQQNDFTQPWVLGYSPMRFTNYWKYLDIDLARRRAK |
Ga0184635_102466661 | 3300018072 | Groundwater Sediment | EIARTYVPIIPAIFRLENDFVQPWILGYRPQMFQTYWKYVDIDLARLRRAEGK |
Ga0184625_106403803 | 3300018081 | Groundwater Sediment | DFVQPWIQGYRPQMFQTYWKYVDIDLARLRRAEGK |
Ga0066669_123154232 | 3300018482 | Grasslands Soil | LLAIFRLENDFVQPWLRGFRPPIFSTYWKYLDIDFDRRK |
Ga0193723_10260303 | 3300019879 | Soil | RTYTPLLPVIFRLENDFVQPWLRGFSSPVFSTYWKYLDIDLDRRK |
Ga0193751_12435071 | 3300019888 | Soil | AYMPLLPMIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRRKRAG |
Ga0210407_114567522 | 3300020579 | Soil | LPVIFRLENDFVQPWLLGFRPPVFGTYWKYLDIDLARQRAGK |
Ga0210382_100745361 | 3300021080 | Groundwater Sediment | YFRLENNYVQPWLMGFSPFVFTSYWKYLDIDLARRNGK |
Ga0224452_11883042 | 3300022534 | Groundwater Sediment | TYMPELPAIFRLENDFAQPWLLGFRPPVFATYWKYLDIDLARRRAK |
Ga0207653_100667202 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELARTYMPEMPTIFRLQNDFVQPWLLGFSPQVFSTYWNYLDIDLARRESGR |
Ga0207692_106309371 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ELPTIFRLQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESAR |
Ga0207645_106680481 | 3300025907 | Miscanthus Rhizosphere | ARAYMPLLPTIFRRENDFVQPWLQGFRPQVFSTYWQFMDIDLARRKRAG |
Ga0207684_102296362 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAYMPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG |
Ga0207695_106634022 | 3300025913 | Corn Rhizosphere | IFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLERKKRAG |
Ga0207663_103622212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TYMPMLPAIFRLENDFVQPWLRGFSAPIFSTYWKYLDIDLDRRK |
Ga0207662_107548001 | 3300025918 | Switchgrass Rhizosphere | MPLLPTIFRRENDFVQPWLLGFRPQVFSTYWQFMDIDLDRKKRAG |
Ga0207687_109312862 | 3300025927 | Miscanthus Rhizosphere | YFRLESNYVQPWLQGFRPGVFSSYWKYLDIDLARRR |
Ga0207661_107372571 | 3300025944 | Corn Rhizosphere | MYRLQNDFVQPWLEGFAPQTFETYWKYMDIDEAKRRATR |
Ga0207658_121494071 | 3300025986 | Switchgrass Rhizosphere | VYFRLESNYVQPWLTGFRPFVFSTYWKYLDIDPAKRK |
Ga0209131_13633582 | 3300026320 | Grasslands Soil | YMPLLPAVFRLETNYVQPWVQGFNSFVFQPYWKYLDIDLAKRRQMSRN |
Ga0209474_103437002 | 3300026550 | Soil | PAIFRLENDFVQPWLLGFRPPVFSTYWKYLDIDLARRK |
Ga0209106_11288742 | 3300027616 | Forest Soil | RAFMPLLPTIFRRENDFVQPWLLGYRPQVFSTYWQFMDIDLDRRKRAG |
Ga0311371_104776341 | 3300029951 | Palsa | IFRQENDFLQPWLLGFRPPVFETYWKYLDIDLTQRRRAGH |
Ga0311334_101274391 | 3300029987 | Fen | NNFVQPWVLGFSPPVFSSYWKYLDIDIDRRRRGAATQR |
Ga0302217_101402292 | 3300030052 | Fen | FRIESSFVQPWLLGFSPPVFQPYWKYLDIDLPKRRSMAGKS |
Ga0311335_102667882 | 3300030838 | Fen | FVQPWLLGFSPPVFQPYWKYLDIDLPKRRSMAGKS |
Ga0307498_103795842 | 3300031170 | Soil | IARAYAPMLPAVFRLESDFVQPWVQGFSPPIFQSYWKYLDIDLARRGQVTGK |
Ga0307495_101296341 | 3300031199 | Soil | IFRLQNDFVQPWLLGFSPQVFSTYWKYLDIDLARRESAR |
Ga0302323_1015204081 | 3300031232 | Fen | PLVPIIFRLENDFVQPWLKGFAPPVFTTYWKYLDIDLELQKRAGE |
Ga0318574_100706821 | 3300031680 | Soil | TYEPLIPTIFRLQNDFVQPWVLGYNKPLYTTYWKYLDIDLARQRAAAR |
Ga0307469_101368471 | 3300031720 | Hardwood Forest Soil | QNDFVQPWLQGFAPPVFSTYWKYLDIDLAARRQAGR |
Ga0307468_1023637802 | 3300031740 | Hardwood Forest Soil | IFRLENDFVQPWVVGFRPPIFSTYWKYLDIDVARRK |
Ga0307473_113000751 | 3300031820 | Hardwood Forest Soil | YMPELPAIFRLENDFVQPWLLGFRSPIFSTYWKYLDIDLARRK |
Ga0308175_1022116711 | 3300031938 | Soil | ARNYTPLMPLFFRLQNDYVQPWVQGYAPPRWASYWKYLDIDLARRGKAP |
Ga0318563_107426992 | 3300032009 | Soil | VPIIPAIFRLQNDFVQPWIVGYRPQMFQTYWKYVDIDLVRQRQSQGK |
Ga0306924_100357421 | 3300032076 | Soil | LIPTIFRLQNDFVQPWVLGYNKPLYTTYWKYLDIDLARQRAAAR |
Ga0315283_119912372 | 3300032164 | Sediment | MTDIARTYAPLIPAIFRLENNFVQPWLQGFSPPVFQTYWKYLDLDLARRQQANGR |
Ga0307470_110772181 | 3300032174 | Hardwood Forest Soil | PVIFRLENDFVQPWIQGYRPQMFQTYWKYIDIDLARLRRAEGK |
Ga0307470_117782412 | 3300032174 | Hardwood Forest Soil | PLIPTIFRLENDFVQPWVQGYNKPLYTTYWKYLDIDLARRRQAAR |
Ga0307471_1028736691 | 3300032180 | Hardwood Forest Soil | IPAIFRLENDFVQPWIQGYRPQIFQTYWKYVDIDLARQRQSHGK |
Ga0307472_1002205181 | 3300032205 | Hardwood Forest Soil | LQNDFVQPWIQGYRPQMFQTYWKYVDIDLVRQRQAQGK |
Ga0306920_1013745732 | 3300032261 | Soil | ASTYVPLIPTIFRLQNDFVQPWVLGYNKPLYITYWKYLDIDLARQRAAAR |
Ga0315287_103039861 | 3300032397 | Sediment | PAVFRLQSDYVQPWVLGFSAPVFQTYWKYLDIDLARRRQATGK |
Ga0335081_103950921 | 3300032892 | Soil | IPTIFRLENDFVQPWVLGYYKHPYTTYWKYIDIDLARQKRASH |
Ga0326726_104983963 | 3300033433 | Peat Soil | IPTIFRLENDFVQPWLLGFRPQQFQTYWKYLDIDLARQRQAGGR |
Ga0370484_0041653_694_846 | 3300034125 | Untreated Peat Soil | MSELARTYMPMLPAIFRLENDFVQPWLRGFSPPVFSTYWKYLDIDLDRRK |
Ga0364943_0068509_1_111 | 3300034354 | Sediment | RLENDFAQPWLLGFKPPVFTTYWKYLDVDLARRQAK |
⦗Top⦘ |