Basic Information | |
---|---|
Family ID | F071247 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 43 residues |
Representative Sequence | MGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 86.78 % |
% of genes near scaffold ends (potentially truncated) | 23.77 % |
% of genes from short scaffolds (< 2000 bps) | 54.10 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (85.246 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.672 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.574 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.410 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.17% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF00154 | RecA | 15.57 |
PF07235 | DUF1427 | 15.57 |
PF12705 | PDDEXK_1 | 7.38 |
PF01923 | Cob_adeno_trans | 4.92 |
PF03819 | MazG | 3.28 |
PF02075 | RuvC | 2.46 |
PF03796 | DnaB_C | 2.46 |
PF13640 | 2OG-FeII_Oxy_3 | 1.64 |
PF00565 | SNase | 1.64 |
PF13662 | Toprim_4 | 1.64 |
PF05257 | CHAP | 0.82 |
PF01930 | Cas_Cas4 | 0.82 |
PF13384 | HTH_23 | 0.82 |
PF16861 | Carbam_trans_C | 0.82 |
PF14579 | HHH_6 | 0.82 |
PF01370 | Epimerase | 0.82 |
PF11397 | GlcNAc | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 15.57 |
COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 15.57 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 2.46 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 2.46 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 2.46 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.52 % |
Unclassified | root | N/A | 11.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199792076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300001282|B570J14230_10006733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4522 | Open in IMG/M |
3300002277|B570J29592_100820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
3300002408|B570J29032_109943512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3972 | Open in IMG/M |
3300002835|B570J40625_100041963 | Not Available | 6771 | Open in IMG/M |
3300002835|B570J40625_100102833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3515 | Open in IMG/M |
3300002835|B570J40625_101050508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300003277|JGI25908J49247_10015372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2338 | Open in IMG/M |
3300003277|JGI25908J49247_10045330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300003277|JGI25908J49247_10101473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300003388|JGI25910J50241_10001295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8839 | Open in IMG/M |
3300003388|JGI25910J50241_10130581 | Not Available | 666 | Open in IMG/M |
3300003393|JGI25909J50240_1003821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3856 | Open in IMG/M |
3300003411|JGI25911J50253_10009463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3689 | Open in IMG/M |
3300003430|JGI25921J50272_10009044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2987 | Open in IMG/M |
3300005527|Ga0068876_10029064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3449 | Open in IMG/M |
3300005527|Ga0068876_10045064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2703 | Open in IMG/M |
3300005527|Ga0068876_10065468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2196 | Open in IMG/M |
3300005527|Ga0068876_10319390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300005528|Ga0068872_10030049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3549 | Open in IMG/M |
3300005580|Ga0049083_10059250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
3300005580|Ga0049083_10170085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300005582|Ga0049080_10054789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1375 | Open in IMG/M |
3300005584|Ga0049082_10000347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12779 | Open in IMG/M |
3300005584|Ga0049082_10299897 | Not Available | 536 | Open in IMG/M |
3300005662|Ga0078894_10027605 | All Organisms → Viruses → Predicted Viral | 4651 | Open in IMG/M |
3300005662|Ga0078894_10058597 | Not Available | 3289 | Open in IMG/M |
3300006484|Ga0070744_10002702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5350 | Open in IMG/M |
3300008107|Ga0114340_1000725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58338 | Open in IMG/M |
3300008107|Ga0114340_1020999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3079 | Open in IMG/M |
3300008107|Ga0114340_1022657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5580 | Open in IMG/M |
3300008107|Ga0114340_1057897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1673 | Open in IMG/M |
3300008107|Ga0114340_1063095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
3300008108|Ga0114341_10063740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2345 | Open in IMG/M |
3300008108|Ga0114341_10128097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
3300008110|Ga0114343_1023188 | Not Available | 2705 | Open in IMG/M |
3300008111|Ga0114344_1032041 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300008116|Ga0114350_1026631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2329 | Open in IMG/M |
3300008116|Ga0114350_1043266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1688 | Open in IMG/M |
3300008962|Ga0104242_1045033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300008996|Ga0102831_1004704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5193 | Open in IMG/M |
3300009056|Ga0102860_1243235 | Not Available | 520 | Open in IMG/M |
3300009152|Ga0114980_10000278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36342 | Open in IMG/M |
3300009155|Ga0114968_10000669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25662 | Open in IMG/M |
3300009155|Ga0114968_10183097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
3300009159|Ga0114978_10139331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1570 | Open in IMG/M |
3300009183|Ga0114974_10005300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9619 | Open in IMG/M |
3300009183|Ga0114974_10006440 | Not Available | 8676 | Open in IMG/M |
3300010370|Ga0129336_10147555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1360 | Open in IMG/M |
3300010388|Ga0136551_1010088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
3300010885|Ga0133913_10670617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2716 | Open in IMG/M |
3300010885|Ga0133913_13058605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300011010|Ga0139557_1000198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15522 | Open in IMG/M |
3300011116|Ga0151516_10663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15963 | Open in IMG/M |
3300012000|Ga0119951_1000134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 50647 | Open in IMG/M |
3300013014|Ga0164295_10653720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300013295|Ga0170791_10362988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300017701|Ga0181364_1008270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1772 | Open in IMG/M |
3300019784|Ga0181359_1041412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1784 | Open in IMG/M |
3300019784|Ga0181359_1129485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300020141|Ga0211732_1284207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4543 | Open in IMG/M |
3300020151|Ga0211736_10136019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300020151|Ga0211736_10136504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2116 | Open in IMG/M |
3300020151|Ga0211736_10154553 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Candidatus Sysuiplasmatales → Candidatus Sysuiplasmataceae → Candidatus Sysuiplasma → Candidatus Sysuiplasma superficiale | 826 | Open in IMG/M |
3300020151|Ga0211736_10672575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23113 | Open in IMG/M |
3300020151|Ga0211736_10771670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300020151|Ga0211736_10966384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6088 | Open in IMG/M |
3300020161|Ga0211726_10175091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
3300020161|Ga0211726_10588611 | Not Available | 568 | Open in IMG/M |
3300020161|Ga0211726_10613645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2967 | Open in IMG/M |
3300020172|Ga0211729_11261838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300020205|Ga0211731_10811326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3831 | Open in IMG/M |
3300020506|Ga0208091_1000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18903 | Open in IMG/M |
3300020506|Ga0208091_1005070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1793 | Open in IMG/M |
3300020519|Ga0208223_1000366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 11363 | Open in IMG/M |
3300021519|Ga0194048_10131079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300021961|Ga0222714_10009917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8303 | Open in IMG/M |
3300021961|Ga0222714_10259542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300021962|Ga0222713_10011054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8081 | Open in IMG/M |
3300021962|Ga0222713_10081486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2364 | Open in IMG/M |
3300021962|Ga0222713_10385649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300021962|Ga0222713_10710097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300021963|Ga0222712_10113668 | All Organisms → Viruses → Predicted Viral | 1874 | Open in IMG/M |
3300022752|Ga0214917_10000649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45158 | Open in IMG/M |
3300024346|Ga0244775_10059013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3319 | Open in IMG/M |
3300024346|Ga0244775_10069684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 3017 | Open in IMG/M |
3300024348|Ga0244776_10453052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300027131|Ga0255066_1043943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300027320|Ga0208923_1057691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300027563|Ga0209552_1166557 | Not Available | 561 | Open in IMG/M |
3300027563|Ga0209552_1183746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300027586|Ga0208966_1000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 64675 | Open in IMG/M |
3300027586|Ga0208966_1128683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300027586|Ga0208966_1184272 | Not Available | 539 | Open in IMG/M |
3300027656|Ga0209357_1121356 | Not Available | 719 | Open in IMG/M |
3300027688|Ga0209553_1225837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1287326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027732|Ga0209442_1142096 | Not Available | 931 | Open in IMG/M |
3300027734|Ga0209087_1053645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1832 | Open in IMG/M |
3300027759|Ga0209296_1000586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31699 | Open in IMG/M |
3300027759|Ga0209296_1004956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8610 | Open in IMG/M |
3300027759|Ga0209296_1033551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2806 | Open in IMG/M |
3300027770|Ga0209086_10020424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4165 | Open in IMG/M |
3300027772|Ga0209768_10296580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300027782|Ga0209500_10096059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1475 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1232303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300029349|Ga0238435_100773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6976 | Open in IMG/M |
3300031758|Ga0315907_10000282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 76029 | Open in IMG/M |
3300031857|Ga0315909_10032436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 5045 | Open in IMG/M |
3300031857|Ga0315909_10464101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300031857|Ga0315909_10516930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300031963|Ga0315901_10257600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
3300031963|Ga0315901_10579493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300032093|Ga0315902_11004932 | Not Available | 626 | Open in IMG/M |
3300034071|Ga0335028_0266425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
3300034071|Ga0335028_0501009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300034093|Ga0335012_0323874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300034101|Ga0335027_0340781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300034102|Ga0335029_0607930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300034108|Ga0335050_0265500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300034111|Ga0335063_0462826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.02% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.38% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.56% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.74% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.74% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.10% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.82% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.82% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.82% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002277 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199954116 | 2199352004 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK |
B570J14230_100067335 | 3300001282 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK* |
B570J29592_1008204 | 3300002277 | Freshwater | MGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV* |
B570J29032_1099435124 | 3300002408 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK* |
B570J40625_1000419634 | 3300002835 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
B570J40625_1001028337 | 3300002835 | Freshwater | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK* |
B570J40625_1010505082 | 3300002835 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK* |
JGI25908J49247_100153722 | 3300003277 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25908J49247_100453303 | 3300003277 | Freshwater Lake | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25908J49247_101014733 | 3300003277 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK* |
JGI25910J50241_1000129514 | 3300003388 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA* |
JGI25910J50241_101305811 | 3300003388 | Freshwater Lake | NKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK* |
JGI25909J50240_10038216 | 3300003393 | Freshwater Lake | MGSNNKIPFNQTVIKNGRXVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25911J50253_100094638 | 3300003411 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQ |
JGI25921J50272_100090444 | 3300003430 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK* |
Ga0068876_100290641 | 3300005527 | Freshwater Lake | NKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
Ga0068876_100450647 | 3300005527 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKPNHKKVK* |
Ga0068876_100654686 | 3300005527 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKA |
Ga0068876_103193902 | 3300005527 | Freshwater Lake | MGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK* |
Ga0068872_100300497 | 3300005528 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK* |
Ga0049083_100592502 | 3300005580 | Freshwater Lentic | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK** |
Ga0049083_101700852 | 3300005580 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK* |
Ga0049080_100547891 | 3300005582 | Freshwater Lentic | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK* |
Ga0049082_1000034715 | 3300005584 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN* |
Ga0049082_102998973 | 3300005584 | Freshwater Lentic | KIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK* |
Ga0078894_100276057 | 3300005662 | Freshwater Lake | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADIGPYKTKQTKAK* |
Ga0078894_100585977 | 3300005662 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
Ga0070744_100027027 | 3300006484 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND* |
Ga0102917_12273423 | 3300007590 | Estuarine | MGSSKHPMNKTVIKNGRIVRLRKDGGIKADLGPYLTVH |
Ga0114340_1000725111 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK* |
Ga0114340_10209994 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTQQTKAKK* |
Ga0114340_10226577 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0114340_10578972 | 3300008107 | Freshwater, Plankton | MGSSNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYKVKHKVVK* |
Ga0114340_10630954 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKNGRIVRVRKDGTVKADLGPYKVNHKKDK* |
Ga0114341_100637405 | 3300008108 | Freshwater, Plankton | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0114341_101280974 | 3300008108 | Freshwater, Plankton | MGSSNKKPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK* |
Ga0114343_10231881 | 3300008110 | Freshwater, Plankton | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK* |
Ga0114344_10320413 | 3300008111 | Freshwater, Plankton | MGSNNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYNTKQTKAK* |
Ga0114350_10266311 | 3300008116 | Freshwater, Plankton | KRNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP* |
Ga0114350_10432662 | 3300008116 | Freshwater, Plankton | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK* |
Ga0104242_10450334 | 3300008962 | Freshwater | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK* |
Ga0102831_10047047 | 3300008996 | Estuarine | MGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK* |
Ga0102860_12432352 | 3300009056 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKKKTSND* |
Ga0114980_1000027828 | 3300009152 | Freshwater Lake | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK* |
Ga0114968_1000066929 | 3300009155 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK* |
Ga0114968_101830973 | 3300009155 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK* |
Ga0114978_101393315 | 3300009159 | Freshwater Lake | FGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK* |
Ga0114974_100053009 | 3300009183 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK* |
Ga0114974_1000644010 | 3300009183 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKQKTQKAK* |
Ga0129336_101475553 | 3300010370 | Freshwater To Marine Saline Gradient | MRSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0136551_10100881 | 3300010388 | Pond Fresh Water | MGNNNKIPFNPTIIKNGRIVRIRKDGSIKADLGPYQSKKKIKK* |
Ga0133913_106706177 | 3300010885 | Freshwater Lake | MGSNNKIPFNKTVIKNGRIVRIRKDGSIKADLGPYKGQKAAVKK* |
Ga0133913_130586053 | 3300010885 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK* |
Ga0139557_10001987 | 3300011010 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKKKVKK* |
Ga0151516_1066322 | 3300011116 | Freshwater | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKDK* |
Ga0119951_100013429 | 3300012000 | Freshwater | MGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKANHKKVK* |
Ga0164295_106537202 | 3300013014 | Freshwater | MGNNNKIPFNETVIKNGRIIRLRKDGSIKADLGPYGKKEKPKK* |
Ga0170791_103629882 | 3300013295 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK* |
Ga0181364_10082706 | 3300017701 | Freshwater Lake | SFGRIAMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0181359_10414124 | 3300019784 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK |
Ga0181359_11294852 | 3300019784 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0211732_12842076 | 3300020141 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK |
Ga0211736_101360192 | 3300020151 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKGK |
Ga0211736_101365044 | 3300020151 | Freshwater | MGSNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKHKKVK |
Ga0211736_101545533 | 3300020151 | Freshwater | MGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGSYTPKKKIKRQA |
Ga0211736_1067257515 | 3300020151 | Freshwater | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK |
Ga0211736_107716703 | 3300020151 | Freshwater | MGSNNKIPFNKTIIKNGRIVRIRKDGAIKADLGPYKAKPGKAK |
Ga0211736_109663846 | 3300020151 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKSKKAK |
Ga0211726_101750913 | 3300020161 | Freshwater | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKK |
Ga0211726_105886113 | 3300020161 | Freshwater | NKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTPKKKIKRQAXPQCQAIKIH |
Ga0211726_106136456 | 3300020161 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKNKKAK |
Ga0211729_112618384 | 3300020172 | Freshwater | MGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYKSKKKVKK |
Ga0211731_108113269 | 3300020205 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK |
Ga0208091_100011122 | 3300020506 | Freshwater | MGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV |
Ga0208091_10050703 | 3300020506 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK |
Ga0208223_10003667 | 3300020519 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK |
Ga0194048_101310792 | 3300021519 | Anoxic Zone Freshwater | MGSNNKIPFNKTIIRDGRILRVRKDGSIKADLGPYKTKRGTKNA |
Ga0222714_100099175 | 3300021961 | Estuarine Water | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK |
Ga0222714_102595422 | 3300021961 | Estuarine Water | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK |
Ga0222713_100110541 | 3300021962 | Estuarine Water | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKV |
Ga0222713_100814865 | 3300021962 | Estuarine Water | MGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0222713_103856494 | 3300021962 | Estuarine Water | MGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK |
Ga0222713_107100972 | 3300021962 | Estuarine Water | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYSTKKKGLNIDKR |
Ga0222712_101136684 | 3300021963 | Estuarine Water | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAKQ |
Ga0214917_1000064943 | 3300022752 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK |
Ga0244775_100590135 | 3300024346 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND |
Ga0244775_100696844 | 3300024346 | Estuarine | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK |
Ga0244776_104530521 | 3300024348 | Estuarine | MGSSNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0255066_10439431 | 3300027131 | Freshwater | TMGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0208923_10576911 | 3300027320 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTS |
Ga0209552_11665572 | 3300027563 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA |
Ga0209552_11837462 | 3300027563 | Freshwater Lake | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0208966_100001664 | 3300027586 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN |
Ga0208966_11286833 | 3300027586 | Freshwater Lentic | MGSSNKIPFNKTIIKNGRIIRIRKDGTVKADLGPYQVKKSKTNN |
Ga0208966_11842723 | 3300027586 | Freshwater Lentic | NKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK |
Ga0209357_11213562 | 3300027656 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAY |
Ga0209553_12258371 | 3300027688 | Freshwater Lake | VGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKS |
(restricted) Ga0247833_12873262 | 3300027730 | Freshwater | MGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKTEQTKGK |
Ga0209442_11420962 | 3300027732 | Freshwater Lake | PFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKKX |
Ga0209087_10536454 | 3300027734 | Freshwater Lake | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK |
Ga0209296_100058613 | 3300027759 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK |
Ga0209296_10049564 | 3300027759 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK |
Ga0209296_10335514 | 3300027759 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK |
Ga0209086_100204247 | 3300027770 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK |
Ga0209768_102965804 | 3300027772 | Freshwater Lake | SFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK |
Ga0209500_100960595 | 3300027782 | Freshwater Lake | SFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK |
(restricted) Ga0247831_12323031 | 3300028559 | Freshwater | MGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKT |
Ga0238435_1007734 | 3300029349 | Freshwater | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYTKRDKSQK |
Ga0315907_100002827 | 3300031758 | Freshwater | MGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK |
Ga0315909_100324363 | 3300031857 | Freshwater | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK |
Ga0315909_104641013 | 3300031857 | Freshwater | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYQKGKKNK |
Ga0315909_105169304 | 3300031857 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK |
Ga0315901_102576003 | 3300031963 | Freshwater | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK |
Ga0315901_105794935 | 3300031963 | Freshwater | GSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK |
Ga0315902_110049323 | 3300032093 | Freshwater | SSGRITMGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKTKQTKAK |
Ga0335028_0266425_3_107 | 3300034071 | Freshwater | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPY |
Ga0335028_0501009_88_231 | 3300034071 | Freshwater | MIMGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTLKKKAKGQA |
Ga0335012_0323874_2_121 | 3300034093 | Freshwater | MGSSNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYNPKKK |
Ga0335027_0340781_424_567 | 3300034101 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGTIKADLGPYSTKKKGLKIDKR |
Ga0335029_0607930_1_120 | 3300034102 | Freshwater | MGSNNKHPMNKTVIKNGRIVRIRKDGAIKADLGPYLTVHK |
Ga0335050_0265500_222_347 | 3300034108 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKVKKDK |
Ga0335063_0462826_503_625 | 3300034111 | Freshwater | NKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP |
⦗Top⦘ |