NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071247

Metagenome / Metatranscriptome Family F071247

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071247
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 43 residues
Representative Sequence MGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK
Number of Associated Samples 79
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 86.78 %
% of genes near scaffold ends (potentially truncated) 23.77 %
% of genes from short scaffolds (< 2000 bps) 54.10 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (85.246 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(19.672 % of family members)
Environment Ontology (ENVO) Unclassified
(65.574 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(75.410 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 28.17%    Coil/Unstructured: 71.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00154RecA 15.57
PF07235DUF1427 15.57
PF12705PDDEXK_1 7.38
PF01923Cob_adeno_trans 4.92
PF03819MazG 3.28
PF02075RuvC 2.46
PF03796DnaB_C 2.46
PF136402OG-FeII_Oxy_3 1.64
PF00565SNase 1.64
PF13662Toprim_4 1.64
PF05257CHAP 0.82
PF01930Cas_Cas4 0.82
PF13384HTH_23 0.82
PF16861Carbam_trans_C 0.82
PF14579HHH_6 0.82
PF01370Epimerase 0.82
PF11397GlcNAc 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 15.57
COG4317Xanthosine utilization system component, XapX domainNucleotide transport and metabolism [F] 15.57
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 2.46
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 2.46
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 2.46
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.52 %
UnclassifiedrootN/A11.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352004|2199792076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300001282|B570J14230_10006733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4522Open in IMG/M
3300002277|B570J29592_100820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1439Open in IMG/M
3300002408|B570J29032_109943512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3972Open in IMG/M
3300002835|B570J40625_100041963Not Available6771Open in IMG/M
3300002835|B570J40625_100102833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3515Open in IMG/M
3300002835|B570J40625_101050508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300003277|JGI25908J49247_10015372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2338Open in IMG/M
3300003277|JGI25908J49247_10045330All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1169Open in IMG/M
3300003277|JGI25908J49247_10101473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300003388|JGI25910J50241_10001295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8839Open in IMG/M
3300003388|JGI25910J50241_10130581Not Available666Open in IMG/M
3300003393|JGI25909J50240_1003821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3856Open in IMG/M
3300003411|JGI25911J50253_10009463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3689Open in IMG/M
3300003430|JGI25921J50272_10009044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2987Open in IMG/M
3300005527|Ga0068876_10029064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3449Open in IMG/M
3300005527|Ga0068876_10045064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2703Open in IMG/M
3300005527|Ga0068876_10065468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2196Open in IMG/M
3300005527|Ga0068876_10319390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300005528|Ga0068872_10030049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3549Open in IMG/M
3300005580|Ga0049083_10059250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1346Open in IMG/M
3300005580|Ga0049083_10170085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300005582|Ga0049080_10054789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1375Open in IMG/M
3300005584|Ga0049082_10000347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12779Open in IMG/M
3300005584|Ga0049082_10299897Not Available536Open in IMG/M
3300005662|Ga0078894_10027605All Organisms → Viruses → Predicted Viral4651Open in IMG/M
3300005662|Ga0078894_10058597Not Available3289Open in IMG/M
3300006484|Ga0070744_10002702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5350Open in IMG/M
3300008107|Ga0114340_1000725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes58338Open in IMG/M
3300008107|Ga0114340_1020999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3079Open in IMG/M
3300008107|Ga0114340_1022657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5580Open in IMG/M
3300008107|Ga0114340_1057897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1673Open in IMG/M
3300008107|Ga0114340_1063095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1584Open in IMG/M
3300008108|Ga0114341_10063740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2345Open in IMG/M
3300008108|Ga0114341_10128097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1504Open in IMG/M
3300008110|Ga0114343_1023188Not Available2705Open in IMG/M
3300008111|Ga0114344_1032041All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300008116|Ga0114350_1026631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2329Open in IMG/M
3300008116|Ga0114350_1043266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1688Open in IMG/M
3300008962|Ga0104242_1045033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300008996|Ga0102831_1004704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5193Open in IMG/M
3300009056|Ga0102860_1243235Not Available520Open in IMG/M
3300009152|Ga0114980_10000278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage36342Open in IMG/M
3300009155|Ga0114968_10000669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage25662Open in IMG/M
3300009155|Ga0114968_10183097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1224Open in IMG/M
3300009159|Ga0114978_10139331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1570Open in IMG/M
3300009183|Ga0114974_10005300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9619Open in IMG/M
3300009183|Ga0114974_10006440Not Available8676Open in IMG/M
3300010370|Ga0129336_10147555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1360Open in IMG/M
3300010388|Ga0136551_1010088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1974Open in IMG/M
3300010885|Ga0133913_10670617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2716Open in IMG/M
3300010885|Ga0133913_13058605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300011010|Ga0139557_1000198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes15522Open in IMG/M
3300011116|Ga0151516_10663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15963Open in IMG/M
3300012000|Ga0119951_1000134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage50647Open in IMG/M
3300013014|Ga0164295_10653720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300013295|Ga0170791_10362988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300017701|Ga0181364_1008270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1772Open in IMG/M
3300019784|Ga0181359_1041412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1784Open in IMG/M
3300019784|Ga0181359_1129485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300020141|Ga0211732_1284207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4543Open in IMG/M
3300020151|Ga0211736_10136019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300020151|Ga0211736_10136504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2116Open in IMG/M
3300020151|Ga0211736_10154553All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Candidatus Sysuiplasmatales → Candidatus Sysuiplasmataceae → Candidatus Sysuiplasma → Candidatus Sysuiplasma superficiale826Open in IMG/M
3300020151|Ga0211736_10672575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes23113Open in IMG/M
3300020151|Ga0211736_10771670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300020151|Ga0211736_10966384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6088Open in IMG/M
3300020161|Ga0211726_10175091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1468Open in IMG/M
3300020161|Ga0211726_10588611Not Available568Open in IMG/M
3300020161|Ga0211726_10613645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2967Open in IMG/M
3300020172|Ga0211729_11261838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300020205|Ga0211731_10811326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3831Open in IMG/M
3300020506|Ga0208091_1000111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes18903Open in IMG/M
3300020506|Ga0208091_1005070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1793Open in IMG/M
3300020519|Ga0208223_1000366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay11363Open in IMG/M
3300021519|Ga0194048_10131079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage951Open in IMG/M
3300021961|Ga0222714_10009917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay8303Open in IMG/M
3300021961|Ga0222714_10259542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage970Open in IMG/M
3300021962|Ga0222713_10011054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay8081Open in IMG/M
3300021962|Ga0222713_10081486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2364Open in IMG/M
3300021962|Ga0222713_10385649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
3300021962|Ga0222713_10710097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300021963|Ga0222712_10113668All Organisms → Viruses → Predicted Viral1874Open in IMG/M
3300022752|Ga0214917_10000649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage45158Open in IMG/M
3300024346|Ga0244775_10059013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3319Open in IMG/M
3300024346|Ga0244775_10069684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay3017Open in IMG/M
3300024348|Ga0244776_10453052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300027131|Ga0255066_1043943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300027320|Ga0208923_1057691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300027563|Ga0209552_1166557Not Available561Open in IMG/M
3300027563|Ga0209552_1183746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300027586|Ga0208966_1000016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes64675Open in IMG/M
3300027586|Ga0208966_1128683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300027586|Ga0208966_1184272Not Available539Open in IMG/M
3300027656|Ga0209357_1121356Not Available719Open in IMG/M
3300027688|Ga0209553_1225837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
(restricted) 3300027730|Ga0247833_1287326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300027732|Ga0209442_1142096Not Available931Open in IMG/M
3300027734|Ga0209087_1053645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1832Open in IMG/M
3300027759|Ga0209296_1000586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes31699Open in IMG/M
3300027759|Ga0209296_1004956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay8610Open in IMG/M
3300027759|Ga0209296_1033551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2806Open in IMG/M
3300027770|Ga0209086_10020424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay4165Open in IMG/M
3300027772|Ga0209768_10296580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300027782|Ga0209500_10096059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1475Open in IMG/M
(restricted) 3300028559|Ga0247831_1232303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
3300029349|Ga0238435_100773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6976Open in IMG/M
3300031758|Ga0315907_10000282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage76029Open in IMG/M
3300031857|Ga0315909_10032436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay5045Open in IMG/M
3300031857|Ga0315909_10464101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300031857|Ga0315909_10516930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300031963|Ga0315901_10257600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1471Open in IMG/M
3300031963|Ga0315901_10579493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300032093|Ga0315902_11004932Not Available626Open in IMG/M
3300034071|Ga0335028_0266425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1030Open in IMG/M
3300034071|Ga0335028_0501009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300034093|Ga0335012_0323874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300034101|Ga0335027_0340781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage995Open in IMG/M
3300034102|Ga0335029_0607930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300034108|Ga0335050_0265500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300034111|Ga0335063_0462826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake19.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.02%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton9.02%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater7.38%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic6.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.74%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.10%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.82%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.82%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.82%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.82%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352004Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002277Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
21999541162199352004FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK
B570J14230_1000673353300001282FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK*
B570J29592_10082043300002277FreshwaterMGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV*
B570J29032_10994351243300002408FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK*
B570J40625_10004196343300002835FreshwaterMGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK*
B570J40625_10010283373300002835FreshwaterMGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK*
B570J40625_10105050823300002835FreshwaterMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK*
JGI25908J49247_1001537223300003277Freshwater LakeMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ*
JGI25908J49247_1004533033300003277Freshwater LakeMGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ*
JGI25908J49247_1010147333300003277Freshwater LakeMGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK*
JGI25910J50241_10001295143300003388Freshwater LakeMGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA*
JGI25910J50241_1013058113300003388Freshwater LakeNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK*
JGI25909J50240_100382163300003393Freshwater LakeMGSNNKIPFNQTVIKNGRXVRVRKDGSVKADLGPYKTEQTKAKQ*
JGI25911J50253_1000946383300003411Freshwater LakeMGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQ
JGI25921J50272_1000904443300003430Freshwater LakeMGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK*
Ga0068876_1002906413300005527Freshwater LakeNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK*
Ga0068876_1004506473300005527Freshwater LakeMGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKPNHKKVK*
Ga0068876_1006546863300005527Freshwater LakeMGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKA
Ga0068876_1031939023300005527Freshwater LakeMGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK*
Ga0068872_1003004973300005528Freshwater LakeMGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK*
Ga0049083_1005925023300005580Freshwater LenticMGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK**
Ga0049083_1017008523300005580Freshwater LenticMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK*
Ga0049080_1005478913300005582Freshwater LenticMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK*
Ga0049082_10000347153300005584Freshwater LenticMGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN*
Ga0049082_1029989733300005584Freshwater LenticKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK*
Ga0078894_1002760573300005662Freshwater LakeMGSSNKIPFNETVIKNGRIVRLRKDGTVKADIGPYKTKQTKAK*
Ga0078894_1005859773300005662Freshwater LakeMGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK*
Ga0070744_1000270273300006484EstuarineMGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND*
Ga0102917_122734233300007590EstuarineMGSSKHPMNKTVIKNGRIVRLRKDGGIKADLGPYLTVH
Ga0114340_10007251113300008107Freshwater, PlanktonMGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK*
Ga0114340_102099943300008107Freshwater, PlanktonMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTQQTKAKK*
Ga0114340_102265773300008107Freshwater, PlanktonMGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK*
Ga0114340_105789723300008107Freshwater, PlanktonMGSSNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYKVKHKVVK*
Ga0114340_106309543300008107Freshwater, PlanktonMGSNNKIPFNKTIIKNGRIVRVRKDGTVKADLGPYKVNHKKDK*
Ga0114341_1006374053300008108Freshwater, PlanktonMGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK*
Ga0114341_1012809743300008108Freshwater, PlanktonMGSSNKKPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK*
Ga0114343_102318813300008110Freshwater, PlanktonMGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK*
Ga0114344_103204133300008111Freshwater, PlanktonMGSNNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYNTKQTKAK*
Ga0114350_102663113300008116Freshwater, PlanktonKRNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP*
Ga0114350_104326623300008116Freshwater, PlanktonMGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK*
Ga0104242_104503343300008962FreshwaterMGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK*
Ga0102831_100470473300008996EstuarineMGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK*
Ga0102860_124323523300009056EstuarineMGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKKKTSND*
Ga0114980_10000278283300009152Freshwater LakeMGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK*
Ga0114968_10000669293300009155Freshwater LakeMGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK*
Ga0114968_1018309733300009155Freshwater LakeMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK*
Ga0114978_1013933153300009159Freshwater LakeFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK*
Ga0114974_1000530093300009183Freshwater LakeMGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK*
Ga0114974_10006440103300009183Freshwater LakeMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKQKTQKAK*
Ga0129336_1014755533300010370Freshwater To Marine Saline GradientMRSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK*
Ga0136551_101008813300010388Pond Fresh WaterMGNNNKIPFNPTIIKNGRIVRIRKDGSIKADLGPYQSKKKIKK*
Ga0133913_1067061773300010885Freshwater LakeMGSNNKIPFNKTVIKNGRIVRIRKDGSIKADLGPYKGQKAAVKK*
Ga0133913_1305860533300010885Freshwater LakeMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK*
Ga0139557_100019873300011010FreshwaterMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKKKVKK*
Ga0151516_10663223300011116FreshwaterMGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKDK*
Ga0119951_1000134293300012000FreshwaterMGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKANHKKVK*
Ga0164295_1065372023300013014FreshwaterMGNNNKIPFNETVIKNGRIIRLRKDGSIKADLGPYGKKEKPKK*
Ga0170791_1036298823300013295FreshwaterMGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK*
Ga0181364_100827063300017701Freshwater LakeSFGRIAMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ
Ga0181359_104141243300019784Freshwater LakeMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK
Ga0181359_112948523300019784Freshwater LakeMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ
Ga0211732_128420763300020141FreshwaterMGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK
Ga0211736_1013601923300020151FreshwaterMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKGK
Ga0211736_1013650443300020151FreshwaterMGSNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKHKKVK
Ga0211736_1015455333300020151FreshwaterMGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGSYTPKKKIKRQA
Ga0211736_10672575153300020151FreshwaterMGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK
Ga0211736_1077167033300020151FreshwaterMGSNNKIPFNKTIIKNGRIVRIRKDGAIKADLGPYKAKPGKAK
Ga0211736_1096638463300020151FreshwaterMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKSKKAK
Ga0211726_1017509133300020161FreshwaterMGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKK
Ga0211726_1058861133300020161FreshwaterNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTPKKKIKRQAXPQCQAIKIH
Ga0211726_1061364563300020161FreshwaterMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKNKKAK
Ga0211729_1126183843300020172FreshwaterMGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYKSKKKVKK
Ga0211731_1081132693300020205FreshwaterMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK
Ga0208091_1000111223300020506FreshwaterMGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV
Ga0208091_100507033300020506FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK
Ga0208223_100036673300020519FreshwaterMGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK
Ga0194048_1013107923300021519Anoxic Zone FreshwaterMGSNNKIPFNKTIIRDGRILRVRKDGSIKADLGPYKTKRGTKNA
Ga0222714_1000991753300021961Estuarine WaterMGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK
Ga0222714_1025954223300021961Estuarine WaterMGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK
Ga0222713_1001105413300021962Estuarine WaterMGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKV
Ga0222713_1008148653300021962Estuarine WaterMGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK
Ga0222713_1038564943300021962Estuarine WaterMGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK
Ga0222713_1071009723300021962Estuarine WaterMGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYSTKKKGLNIDKR
Ga0222712_1011366843300021963Estuarine WaterMGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAKQ
Ga0214917_10000649433300022752FreshwaterMGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK
Ga0244775_1005901353300024346EstuarineMGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND
Ga0244775_1006968443300024346EstuarineMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK
Ga0244776_1045305213300024348EstuarineMGSSNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK
Ga0255066_104394313300027131FreshwaterTMGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK
Ga0208923_105769113300027320EstuarineMGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTS
Ga0209552_116655723300027563Freshwater LakeMGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA
Ga0209552_118374623300027563Freshwater LakeMGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ
Ga0208966_1000016643300027586Freshwater LenticMGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN
Ga0208966_112868333300027586Freshwater LenticMGSSNKIPFNKTIIKNGRIIRIRKDGTVKADLGPYQVKKSKTNN
Ga0208966_118427233300027586Freshwater LenticNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK
Ga0209357_112135623300027656Freshwater LakeMGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAY
Ga0209553_122583713300027688Freshwater LakeVGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKS
(restricted) Ga0247833_128732623300027730FreshwaterMGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKTEQTKGK
Ga0209442_114209623300027732Freshwater LakePFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKKX
Ga0209087_105364543300027734Freshwater LakeMGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK
Ga0209296_1000586133300027759Freshwater LakeMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK
Ga0209296_100495643300027759Freshwater LakeMGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK
Ga0209296_103355143300027759Freshwater LakeMGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK
Ga0209086_1002042473300027770Freshwater LakeMGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK
Ga0209768_1029658043300027772Freshwater LakeSFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK
Ga0209500_1009605953300027782Freshwater LakeSFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK
(restricted) Ga0247831_123230313300028559FreshwaterMGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKT
Ga0238435_10077343300029349FreshwaterMGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYTKRDKSQK
Ga0315907_1000028273300031758FreshwaterMGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK
Ga0315909_1003243633300031857FreshwaterMGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK
Ga0315909_1046410133300031857FreshwaterMGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYQKGKKNK
Ga0315909_1051693043300031857FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK
Ga0315901_1025760033300031963FreshwaterMGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK
Ga0315901_1057949353300031963FreshwaterGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK
Ga0315902_1100493233300032093FreshwaterSSGRITMGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKTKQTKAK
Ga0335028_0266425_3_1073300034071FreshwaterMGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPY
Ga0335028_0501009_88_2313300034071FreshwaterMIMGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTLKKKAKGQA
Ga0335012_0323874_2_1213300034093FreshwaterMGSSNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYNPKKK
Ga0335027_0340781_424_5673300034101FreshwaterMGSNNKIPFNKTIIKNGRIIRIRKDGTIKADLGPYSTKKKGLKIDKR
Ga0335029_0607930_1_1203300034102FreshwaterMGSNNKHPMNKTVIKNGRIVRIRKDGAIKADLGPYLTVHK
Ga0335050_0265500_222_3473300034108FreshwaterMGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKVKKDK
Ga0335063_0462826_503_6253300034111FreshwaterNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.