| Basic Information | |
|---|---|
| Family ID | F071227 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 48 residues |
| Representative Sequence | SGIVVIAYPNTFPALTSIGGGLTYDQPTRSGYRVYRFTAGTGTVTV |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 5.98 % |
| % of genes near scaffold ends (potentially truncated) | 90.16 % |
| % of genes from short scaffolds (< 2000 bps) | 81.15 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.76 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (55.738 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.311 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.918 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.574 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.73% Coil/Unstructured: 70.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.76 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| b.1.1.1: V set domains (antibody variable domain-like) | d1kj2b_ | 1kj2 | 0.62125 |
| b.1.26.0: automated matches | d6cjza1 | 6cjz | 0.61867 |
| b.1.26.1: ICP-like | d3e1za_ | 3e1z | 0.61784 |
| d.58.5.0: automated matches | d2dcla_ | 2dcl | 0.61428 |
| d.264.1.1: PriA-like | d1v33a_ | 1v33 | 0.61156 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01391 | Collagen | 5.74 |
| PF13385 | Laminin_G_3 | 4.92 |
| PF05345 | He_PIG | 4.92 |
| PF00041 | fn3 | 4.10 |
| PF09723 | Zn-ribbon_8 | 4.10 |
| PF01833 | TIG | 2.46 |
| PF06739 | SBBP | 0.82 |
| PF01555 | N6_N4_Mtase | 0.82 |
| PF14550 | Peptidase_S78_2 | 0.82 |
| PF13578 | Methyltransf_24 | 0.82 |
| PF02839 | CBM_5_12 | 0.82 |
| PF04860 | Phage_portal | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.82 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.13 % |
| Unclassified | root | N/A | 27.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109174505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300004460|Ga0066222_1095443 | Not Available | 602 | Open in IMG/M |
| 3300005517|Ga0070374_10050192 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300005528|Ga0068872_10262180 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005662|Ga0078894_11085139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300006030|Ga0075470_10042464 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
| 3300006484|Ga0070744_10065150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300006639|Ga0079301_1126417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300006917|Ga0075472_10053818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1912 | Open in IMG/M |
| 3300007169|Ga0102976_1038595 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300007539|Ga0099849_1331869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300007551|Ga0102881_1238827 | Not Available | 503 | Open in IMG/M |
| 3300007603|Ga0102921_1235813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300007708|Ga0102859_1072428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300007974|Ga0105747_1038839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
| 3300007992|Ga0105748_10056446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1526 | Open in IMG/M |
| 3300007992|Ga0105748_10204022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300008107|Ga0114340_1042588 | Not Available | 2023 | Open in IMG/M |
| 3300008107|Ga0114340_1131339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300008107|Ga0114340_1226725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300008108|Ga0114341_10213168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300008110|Ga0114343_1167453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300008110|Ga0114343_1195534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300008110|Ga0114343_1227248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300008111|Ga0114344_1021896 | Not Available | 2587 | Open in IMG/M |
| 3300008117|Ga0114351_1078255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1981 | Open in IMG/M |
| 3300008117|Ga0114351_1110749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora cretacea | 1582 | Open in IMG/M |
| 3300008448|Ga0114876_1235151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300009151|Ga0114962_10682057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009154|Ga0114963_10067939 | All Organisms → Viruses → Predicted Viral | 2234 | Open in IMG/M |
| 3300009159|Ga0114978_10098977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1928 | Open in IMG/M |
| 3300009164|Ga0114975_10283105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300009181|Ga0114969_10078953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2146 | Open in IMG/M |
| 3300009181|Ga0114969_10557956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300009184|Ga0114976_10132578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
| 3300010160|Ga0114967_10584504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300010334|Ga0136644_10126937 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300010334|Ga0136644_10685318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium TMED261 | 558 | Open in IMG/M |
| 3300010354|Ga0129333_10143222 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300010368|Ga0129324_10357416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 568 | Open in IMG/M |
| 3300010885|Ga0133913_11135751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2009 | Open in IMG/M |
| 3300010885|Ga0133913_11211276 | Not Available | 1936 | Open in IMG/M |
| 3300011268|Ga0151620_1001023 | Not Available | 10782 | Open in IMG/M |
| 3300012705|Ga0157555_1116101 | Not Available | 884 | Open in IMG/M |
| 3300012710|Ga0157550_1083752 | Not Available | 2082 | Open in IMG/M |
| 3300013295|Ga0170791_10998065 | Not Available | 842 | Open in IMG/M |
| 3300013295|Ga0170791_14294470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300013372|Ga0177922_10658462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300013372|Ga0177922_11156219 | Not Available | 754 | Open in IMG/M |
| 3300016685|Ga0180050_1120006 | Not Available | 614 | Open in IMG/M |
| 3300017754|Ga0181344_1073293 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300017757|Ga0181420_1149840 | Not Available | 696 | Open in IMG/M |
| 3300017986|Ga0181569_10929040 | Not Available | 564 | Open in IMG/M |
| 3300020084|Ga0194110_10102403 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300020151|Ga0211736_10782167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300020159|Ga0211734_10331250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300020161|Ga0211726_11058193 | Not Available | 773 | Open in IMG/M |
| 3300020172|Ga0211729_10133504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300020172|Ga0211729_10730366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300020196|Ga0194124_10257262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300020205|Ga0211731_11563549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300020221|Ga0194127_10852546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300020529|Ga0208233_1042103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300021963|Ga0222712_10039142 | Not Available | 3647 | Open in IMG/M |
| 3300022198|Ga0196905_1045808 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300022407|Ga0181351_1090019 | Not Available | 1206 | Open in IMG/M |
| 3300023184|Ga0214919_10262481 | Not Available | 1226 | Open in IMG/M |
| 3300024289|Ga0255147_1060816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300024346|Ga0244775_10008995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 9646 | Open in IMG/M |
| 3300024481|Ga0256330_1097308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300024484|Ga0256332_1145247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300024864|Ga0255271_1097905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300026462|Ga0247568_1062418 | Not Available | 727 | Open in IMG/M |
| 3300026503|Ga0247605_1090848 | Not Available | 748 | Open in IMG/M |
| 3300027138|Ga0255064_1069778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300027467|Ga0255154_1072185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300027659|Ga0208975_1043656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora cretacea | 1394 | Open in IMG/M |
| 3300027659|Ga0208975_1154339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300027712|Ga0209499_1018992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3234 | Open in IMG/M |
| 3300027712|Ga0209499_1105631 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300027720|Ga0209617_10273243 | Not Available | 637 | Open in IMG/M |
| 3300027741|Ga0209085_1014506 | All Organisms → cellular organisms → Bacteria | 3879 | Open in IMG/M |
| 3300027741|Ga0209085_1075721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1517 | Open in IMG/M |
| 3300027754|Ga0209596_1352038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300027782|Ga0209500_10087736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1565 | Open in IMG/M |
| 3300027793|Ga0209972_10401805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027797|Ga0209107_10036248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2817 | Open in IMG/M |
| 3300027805|Ga0209229_10129609 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300027808|Ga0209354_10114851 | Not Available | 1099 | Open in IMG/M |
| 3300027816|Ga0209990_10325048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300027971|Ga0209401_1103656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
| 3300027971|Ga0209401_1175171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300027973|Ga0209298_10161979 | Not Available | 935 | Open in IMG/M |
| 3300027974|Ga0209299_1160000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300028025|Ga0247723_1149822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300028025|Ga0247723_1150156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300028027|Ga0247722_10023878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2494 | Open in IMG/M |
| 3300028027|Ga0247722_10055223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
| 3300028394|Ga0304730_1041638 | All Organisms → Viruses → Predicted Viral | 2294 | Open in IMG/M |
| 3300028394|Ga0304730_1056841 | All Organisms → Viruses → Predicted Viral | 1864 | Open in IMG/M |
| 3300028394|Ga0304730_1208627 | Not Available | 733 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1260849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300031758|Ga0315907_11056023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300032050|Ga0315906_10877286 | Not Available | 692 | Open in IMG/M |
| 3300033521|Ga0316616_103219459 | Not Available | 615 | Open in IMG/M |
| 3300033979|Ga0334978_0228205 | Not Available | 906 | Open in IMG/M |
| 3300033981|Ga0334982_0142140 | Not Available | 1229 | Open in IMG/M |
| 3300033981|Ga0334982_0428012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300034013|Ga0334991_0302634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300034072|Ga0310127_193156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300034073|Ga0310130_0001822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10753 | Open in IMG/M |
| 3300034082|Ga0335020_0458553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034116|Ga0335068_0312186 | Not Available | 779 | Open in IMG/M |
| 3300034122|Ga0335060_0629071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300034283|Ga0335007_0825775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300034356|Ga0335048_0162527 | Not Available | 1267 | Open in IMG/M |
| 3300034356|Ga0335048_0255985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.30% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.10% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.28% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.28% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.46% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.64% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.64% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.64% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.64% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.64% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.82% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.82% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300016685 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES029 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_102114412 | 3300001282 | Freshwater | GSGIVVISYLNTYPPIRIIDAGLTYDQPTVAGYRVYRFLAGTGTIIF* |
| B570J29032_1091745052 | 3300002408 | Freshwater | PALSSISGGLTYDQPSRTGYRVYRFTAGTGTITF* |
| Ga0063232_100156771 | 3300004054 | Freshwater Lake | GSGIVILAYPDSFAALTSISGGLTYSQPTRAGYRVYQFTSGTGTVTI* |
| Ga0066222_10954431 | 3300004460 | Marine | GGSGVVIIAYPDTNPALTSLPGGLTYPQPTRAGYRVYRFTAGTGVVTF* |
| Ga0070374_100501921 | 3300005517 | Freshwater Lake | INGGAGGSGVVVIAYPDTFPALTNIPGSLTYNQPTRAGYRVYRFTAGSGTITV* |
| Ga0068872_102621801 | 3300005528 | Freshwater Lake | GSGVVIIAYPNTFPALTSTTGNLTYDQPTRSGYRVYRFTGGTGTVTF* |
| Ga0078894_110851392 | 3300005662 | Freshwater Lake | AASQGWNGGSGVVVIAYPDTYPALTIGGGLTYSQPSRSGFRVYRFTAGTGTITFN* |
| Ga0075470_100424641 | 3300006030 | Aqueous | IIAYPNTKPALTISGGLTYDQPTRSGYRVYRFTAGTGTITF* |
| Ga0070744_100651504 | 3300006484 | Estuarine | SGIVVIAYPDSLPALNIGSGLSYTQPTRSGYRVYRFSSGTGTITF* |
| Ga0079301_11264171 | 3300006639 | Deep Subsurface | GQRVDGTGGNTGSNGGSGVVIIAYPSSFPALTSIDVGLTYDQPTRSGYRVYRFTAGTGTVTV* |
| Ga0075472_100538182 | 3300006917 | Aqueous | GVVIIAYPNTRPALTIPGTLTYDTPTRSGYRVYRFTAGSGTITVN* |
| Ga0102976_10385951 | 3300007169 | Freshwater Lake | VSNGGNGSSGVLIIAYPSNNPALTISGGLTYDQPTRSGYRVYRITAGSGTITIP* |
| Ga0099849_13318691 | 3300007539 | Aqueous | LGTTTDAQAGGGGVVIIAYPDTYPAPLAITGTYDEPTRAGYRVYRWTAGTGT |
| Ga0102881_12388271 | 3300007551 | Estuarine | AGGSGVVVIAYPNTYPALTSIGGGLTYNEPTRSGYRVYRFTAGTGTVTV* |
| Ga0102921_12358131 | 3300007603 | Estuarine | IIAYPNTFPAITTIPGTLTYDQPTRSGYRVYRFTAGTGTVTF* |
| Ga0102859_10724281 | 3300007708 | Estuarine | IGGSGANGVVVIAYPNSFIAPTISEGLTYDQPTRSGYRVYRFTSGSGTVTF* |
| Ga0105747_10388395 | 3300007974 | Estuary Water | SGIVVIAYPNTFPALTSIGGGLTYDQPTRSGYRVYRFTAGTGTVTV* |
| Ga0105748_100564461 | 3300007992 | Estuary Water | AYLDSKPAITTIPGTLTYDQPARAGYRVYRFTAGSGTVTW* |
| Ga0105748_102040223 | 3300007992 | Estuary Water | IGGNGSDGVIIIAYPNTFPAITTIPGTLTYDQPTRSGYRVYRFTAGTGTVTF* |
| Ga0114340_10425882 | 3300008107 | Freshwater, Plankton | PNTFPALSNIPGTLTYDQPTRSGYRVYRFTAGTGTITF* |
| Ga0114340_11313392 | 3300008107 | Freshwater, Plankton | GARDTGPGGDGAAGVVIIAYPNTLPAIASIPGTLTYNQPTRAGYRVYRFTAGTGTITL* |
| Ga0114340_12267253 | 3300008107 | Freshwater, Plankton | VVIIAYPITKPALTISGGLTYDHPTRSGYRVYRFTAGSGTITI* |
| Ga0114341_102131681 | 3300008108 | Freshwater, Plankton | FPSGGQAENGGSGVVIIAYSSALPAPTIPGTLTYDQPTRAGYRVYRFTAGSGTITF* |
| Ga0114343_11674531 | 3300008110 | Freshwater, Plankton | AYSNTFRDLTIGPGLSYTTPVRSGYKVYRFTGGTGTVSW* |
| Ga0114343_11955341 | 3300008110 | Freshwater, Plankton | VVVIAYPNTFPALTTIPGTLTYDQPTRSGYRVYRFTSGTGTITI* |
| Ga0114343_12272481 | 3300008110 | Freshwater, Plankton | PNTKPALSNIPGTLTYDQPTRSGYRVYRFTAGSGTVTL* |
| Ga0114344_10218964 | 3300008111 | Freshwater, Plankton | GNGVVIIAYPNTFPAITTIPGTLTYDQPTRSGYRVYRFTAGSGTITI* |
| Ga0114351_10782551 | 3300008117 | Freshwater, Plankton | GVVIIAYPTSFAPLSNIPGTLTYDQPTRSGYRVYRFTAGSGTITF* |
| Ga0114351_11107491 | 3300008117 | Freshwater, Plankton | GSNGVVIIAYSNSYPALTISGGLTYTQPSRSGYRVYQFTAGTGTVSF* |
| Ga0114336_12702761 | 3300008261 | Freshwater, Plankton | YLNTYPPIRIIDPGLTYDQPTVAGYRVYRFLAGTGTIIF* |
| Ga0114876_12351511 | 3300008448 | Freshwater Lake | GAGGSGVVIIAYPDTYRAITTIPGTLTYNQPTRAGYRVYRFTAGSGTITF* |
| Ga0114962_106820573 | 3300009151 | Freshwater Lake | GSGGSGGSGVVIIAYPNTLPALTTIGSGLTYTNPTRYGYRVYRFTGGTGSITF* |
| Ga0114963_100679392 | 3300009154 | Freshwater Lake | GVVVIAYPNTYNAPTSISGGLTYDQPTRSGYRVYRFTAGTGTITW* |
| Ga0114978_100989771 | 3300009159 | Freshwater Lake | GGDGAAGVVVIAYPNTLPAIASIPGTLTYNQPTRTGYRVYRFTAGTGTITL* |
| Ga0114975_102831051 | 3300009164 | Freshwater Lake | PDSYNALASIGGGLSYDQPSRSGYRVYRFYSGTGTISW* |
| Ga0114969_100789533 | 3300009181 | Freshwater Lake | VSNGGSGSSGVLIIAYPSTIPALTISGLTYDQPTRSGYRVYRFTAGTGTVTL* |
| Ga0114969_105579561 | 3300009181 | Freshwater Lake | GVVIIAYPDSKPAIATIPGTLTYDQPTRSGYRVYRFTAGSGTITV* |
| Ga0114976_101325783 | 3300009184 | Freshwater Lake | AYPDTYPAPTISGGLTYTQPTRSGYRVYRFTAGTGTITF* |
| Ga0114967_105845042 | 3300010160 | Freshwater Lake | GSGVVIIAYPNSFLPLSSISGGLSYDQPSRSGYRVYRFTGGTGSISW* |
| Ga0136644_101269371 | 3300010334 | Freshwater Lake | GGAATTYYGGNGGSGVVVIAFPDSYPALTSIGGGLTYDQPTRSGYRVYRFTAGTGTVTV* |
| Ga0136644_106853181 | 3300010334 | Freshwater Lake | VIIAYPSSYLPITSISGGLTYDQPTRSGYRVYRFTAGTGTIQW* |
| Ga0129333_101432223 | 3300010354 | Freshwater To Marine Saline Gradient | GSGVVILAYLSSLPALSSIAVGLTYTVDTAGRSGYRVYRFTAGTGTISW* |
| Ga0129324_103574161 | 3300010368 | Freshwater To Marine Saline Gradient | KSASSGGTADAQDGGSGVVIIAYPDTYPVPLAITGTYDEPTRAGYRVYRWTAGTGTVKF* |
| Ga0133913_111357511 | 3300010885 | Freshwater Lake | PGGDGAAGVVVIAYPNTLPAIASIPGTLTYNQPTRTGYRVYRFTAGTGTITL* |
| Ga0133913_112112763 | 3300010885 | Freshwater Lake | GVVIIAYPDSYNALSSISGGLSYDQPTRSGYRVYRFTGGTGTISW* |
| Ga0151620_10010232 | 3300011268 | Freshwater | VVIAYPNTYPALTTIPGTLTYDQPTRSGYRVYRFTAGSGTITF* |
| Ga0157555_11161011 | 3300012705 | Freshwater | SGGGNGGSGVVIIAYPDTFAPITSITGTLSYTEPTRAGYRVYRFVSGTGTIKW* |
| Ga0157550_10837521 | 3300012710 | Freshwater | GSGVVIIAYPDTFAPITSITGTLSYTEPTRAGYRVYRFVSGTGTIKW* |
| Ga0170791_109980653 | 3300013295 | Freshwater | PAWGAGGNGSSGVVIIAYPNTFKTLSSIGGGLSYDQPSRSGYRVYRFTGGTGSISW* |
| Ga0170791_142944703 | 3300013295 | Freshwater | GGKGGDGVVIIAYPDTFAAPSSISGLTYDQPTRSGYRVYRFTAGTGTITW* |
| Ga0177922_106584621 | 3300013372 | Freshwater | PSAVPAITTIPGTLIYTQPIRTGYRVYRFTAGSGTVTF* |
| Ga0177922_111562191 | 3300013372 | Freshwater | VVVIAYSNTYPALTVGAGLTYTQPTRSGYRVYQFTAGTGTVNW* |
| Ga0180050_11200061 | 3300016685 | Freshwater | VIIAYPDTFAPITSITGTLSYTEPTRAGYRVYRFVSGTGTIKW |
| Ga0181344_10732931 | 3300017754 | Freshwater Lake | NSFPAPTSISGGLTYDQPTRSGYRVYRFTAGTGTIQW |
| Ga0181420_11498402 | 3300017757 | Seawater | YPDTFAEITTIPATLTYTKLTSRVGYHVYHFTAGTGTVQF |
| Ga0181569_109290403 | 3300017986 | Salt Marsh | SFPAITTIGGGLTYNEPSRSGFRVYRFTAGTDTITI |
| Ga0194110_101024033 | 3300020084 | Freshwater Lake | GNGGSGIVVIAYPDTLPPITTIPGTLSYNQPTRSGYRVYRFTGGTGTITF |
| Ga0211736_107821673 | 3300020151 | Freshwater | IAYADTHPAPTSIPGTLTYTQPTRAGYRVYRFTAGSGTVTL |
| Ga0211734_103312501 | 3300020159 | Freshwater | NGAGGAGGSGIVVIAYPNTFAPLSNISGGLTYDQPTRAGYRVYRFTAGTGTVTI |
| Ga0211726_110581933 | 3300020161 | Freshwater | GIVVIAYPDTSPAITSIGAGLTYDQPSRAGYRVYRFTGGTGTVTV |
| Ga0211729_101335044 | 3300020172 | Freshwater | VIIAYSNSYDAPTIAAGLSYDQPSRSGFRVYRFNSGSGNVSWA |
| Ga0211729_107303663 | 3300020172 | Freshwater | GNGGSGVVIIAYPNTLPAITTIPGTLTYTQPTRSGYRVYRFTAGTGTITI |
| Ga0194124_102572623 | 3300020196 | Freshwater Lake | KNASPDLTSIGGGLSYTQPTRTGFRVYRFTAGTGDITF |
| Ga0211731_115635492 | 3300020205 | Freshwater | NFGGSGNKLGGSGVVIYAYPDSAAALTTIPGTLTYTVDTTTRAGYRVYKFTAGSGTVTI |
| Ga0194127_108525462 | 3300020221 | Freshwater Lake | YPNASPDLTSIGGGLSYTQPTRTGFRVYRFTAGTGDITF |
| Ga0208233_10421031 | 3300020529 | Freshwater | IIAYADTFPAITTIPGTLTYTQPTRAGYRVYRFTAGSGTVTF |
| Ga0222712_100391421 | 3300021963 | Estuarine Water | SSFDGGRGGNGVVIIAYSDSKPAISNIPGTLTYDQPTRAGYRVYRFTAGTGTITF |
| Ga0196905_10458081 | 3300022198 | Aqueous | GNSGDGGAGKSGVVIIAYPNNYPPLKSISGLTYDQPSRAGYIVYRFYAGSGTIAF |
| Ga0181351_10900193 | 3300022407 | Freshwater Lake | DAGQGSSGWDGGSGVVVIAYPNTYPALTIGGGLTYNEPSRSGYRVYRFTAGSGTITF |
| Ga0214919_102624811 | 3300023184 | Freshwater | VVIAYPDTYRALTSISGGLTYDQPSRTGYRVYRFTAGTGTITF |
| Ga0255147_10608161 | 3300024289 | Freshwater | SSAGAAGVVIIAYPDSRPALTVPGTLTYNQPTRAGYRVYRFTAGSGTVTF |
| Ga0244775_100089951 | 3300024346 | Estuarine | VVIIAYPDTIPPITNIPGTLTYNQPSRSGYRVYRFTAGSGTITF |
| Ga0256330_10973082 | 3300024481 | Freshwater | GIRDVGSSGNGASGVVILAYPDTFAAPRNIPGTLTYDTPTRSGYRVYRFTAGSGTVTV |
| Ga0256332_11452472 | 3300024484 | Freshwater | SGNGASGVVILAYPDTFAAPRNIPGTLTYDTPTRSGYRVYRFTGGTGTITI |
| Ga0255143_10776622 | 3300024500 | Freshwater | AGSGVNDTSVFSKGGNGAGGVVIIAYPNTYPTLNISAGLTYDQPVRSGYRVYRFTAGSGTVSIN |
| Ga0255271_10979052 | 3300024864 | Freshwater | NGSAGVVVIAYPNTLPALSNIPGTLTYDQPTRSGYRVYRFTAGTGTITF |
| Ga0247568_10624181 | 3300026462 | Seawater | GMLIIAYPDADPHLTITGTLSYTQPTRSGYKVYEFTSGSGTISIDS |
| Ga0247605_10908482 | 3300026503 | Seawater | MLIIAYPDADPDLTITGTLSYTQPTRSGYKVYEFTSGSGTISIDS |
| Ga0255064_10697782 | 3300027138 | Freshwater | VIISYPNTKPALSNIPGTLTYDQPTRSGYRVYRFTAGSGTVTF |
| Ga0255154_10721852 | 3300027467 | Freshwater | GGDGGSGVLIIAYPDTISPITIGSGLTYDQPTRAGYRVYRITGGSGNITT |
| Ga0208975_10436561 | 3300027659 | Freshwater Lentic | GGEGNNPQYIGGTGSDGVVVIAYSNTYPALTVGAGLTYTQPTRSGYRVYQFTAGTGTVNW |
| Ga0208975_11543393 | 3300027659 | Freshwater Lentic | SGIVVLAYPDTFAPLTTIGGTLVYDQPTRSGYRVYRFTAGTGTVTV |
| Ga0209499_10189921 | 3300027712 | Freshwater Lake | NGSGGTAGQGGSGVVIIAYPDTYLPLASINGGLGYDQPTRSGYRVYRFTAGTGPISW |
| Ga0209499_11056311 | 3300027712 | Freshwater Lake | IAYPNTYNALSSISAGLTYDQPTRSGYRVYRFTAGTGPISW |
| Ga0209617_102732431 | 3300027720 | Freshwater And Sediment | GVVVIAYPDSSPAISSIAGTLTYDQPTRSGYRVYRFTAGTGSVTV |
| Ga0209085_10145067 | 3300027741 | Freshwater Lake | SGVVIIAYPNTYLAPTSISGGLSYDQPSRSGYRVYRFTAGTGTITW |
| Ga0209085_10757214 | 3300027741 | Freshwater Lake | SGIVVIAYADTFPALSSIGAGLTYSQPTRTGYRVYKFTAGTGAVSF |
| Ga0209597_12751771 | 3300027746 | Freshwater Lake | VISYLNTYPPIRIIDAGLTYDQPTVAGYRVYRFLAGTGTIIF |
| Ga0209596_13520381 | 3300027754 | Freshwater Lake | GIVVIAYPNTYPALTTIGGGLTYDQPSRSGYRVYRFTAGTGTVTV |
| Ga0209500_100877361 | 3300027782 | Freshwater Lake | GGDGAAGVVVIAYPNTLPAIASIPGTLTYNQPTRTGYRVYRFTAGTGTITL |
| Ga0209972_104018051 | 3300027793 | Freshwater Lake | GSGVVIIAYPNTFPALTSTTGNLTYDQPTRSGYRVYRFTGGTGTVTF |
| Ga0209107_100362482 | 3300027797 | Freshwater And Sediment | GGGYAAAYYASGAGGSGVVIIAYADTFPAIATIPGTLTYNQPTRAGYRVYRFTAGTGTIT |
| Ga0209229_101296093 | 3300027805 | Freshwater And Sediment | GAGGSGVVIIAYPNTKPALSNIPGTLTYDQPTRAGYRVYRFTAGTGTVTV |
| Ga0209354_101148511 | 3300027808 | Freshwater Lake | GYGSRTAGQGSSGWDGGSGVVVIAYPNTYPALTIGGGLTYNEPSRSGYRVYRFTAGSGTITF |
| Ga0209990_103250483 | 3300027816 | Freshwater Lake | GGSGVVIIAYSNSYPAPYLISAGLTYDTPSRAGYRVYRFTAGTGTIQF |
| Ga0209401_11036562 | 3300027971 | Freshwater Lake | GVMIIAYPDTYAPIASISGGLGYDQPGRSGYRVYRFYSGTGTITW |
| Ga0209401_11751712 | 3300027971 | Freshwater Lake | VVIIAYPNTFLPLSSISGGLSYDQPTRSGYRVYRFTGGTGTISW |
| Ga0209298_101619791 | 3300027973 | Freshwater Lake | NGGNGGSGVVIIAYPDSYNALSSISGGLSYDQPTRSGYRVYRFTGGTGTISW |
| Ga0209299_11600001 | 3300027974 | Freshwater Lake | GNGGSGGSGVVIIAYPSTYLPLASIGGGLSYDQPTRSDYRVYRFTNGTGTISW |
| Ga0247723_11498221 | 3300028025 | Deep Subsurface Sediment | PNTSPAITTIPGTLTYDQPTRSGYRVYRFTAGTGTVIF |
| Ga0247723_11501562 | 3300028025 | Deep Subsurface Sediment | NTYPALTIGGGLTYDQPSRSGYRVYRFTAGTGTITF |
| Ga0247722_100238781 | 3300028027 | Deep Subsurface Sediment | VVGYYGFGANGTGPVGVSGNPGAVIIAYPNTLPPITTIPGTLTYDQPTRAGYRVYRFTAGSGTITF |
| Ga0247722_100552231 | 3300028027 | Deep Subsurface Sediment | PDTDPAAVIPGTLTYDTPTRAGYRVYRFTAGSGTVTW |
| Ga0304730_10416382 | 3300028394 | Freshwater Lake | GNNGGTGGSGVVIIAYPSNYLALSSIDGGLSYDQPSRSGYRVYRFTGGTGTISW |
| Ga0304730_10568411 | 3300028394 | Freshwater Lake | AGGSGSSGVVIIAYPNTFLPLSSISGGLSYDQPSRSGYRVYRFTAGTGPISW |
| Ga0304730_12086273 | 3300028394 | Freshwater Lake | NNPSTGGSGVVILAYPDTFSALSSISGGLTYNQPTVAGFRVYRFTAGTGNITI |
| (restricted) Ga0247843_12608493 | 3300028569 | Freshwater | GANGGSGVVVIAYPDTFPPITSIGGTLVYDQPSRSGYRVYRFTAGTGTVTV |
| Ga0315907_110560232 | 3300031758 | Freshwater | AYPNTFPALPSIGAGLTYDQPTRTGYRVYRFTAGSGSITF |
| Ga0315906_108772861 | 3300032050 | Freshwater | GIVVIAYPDTYDAITYIAPGLTYDQPSRSGYRVYRFTAGTGTINW |
| Ga0316616_1032194591 | 3300033521 | Soil | GGSGGSGIVIVAYPNTFSAPTSITGTYDNPTRSGYRVYRFYSSGSITF |
| Ga0334978_0228205_773_904 | 3300033979 | Freshwater | VIIAYPDTYPAPTTIGAGLTYDQPTRAGFRVYRFTAGTGTIVW |
| Ga0334982_0142140_268_399 | 3300033981 | Freshwater | MVIAYPDVYPAPTTIGAGLTYDQPTRAGFRVYRFTAGTGTIVW |
| Ga0334982_0428012_354_482 | 3300033981 | Freshwater | MVIAYPSNFAAPTISAGLTYDTPTRSGYRVYRFTAGTGTVTF |
| Ga0334991_0302634_3_128 | 3300034013 | Freshwater | IAYPNTKPAITTIPGTLSYDQPTRAGYRVYRFTAGSGTITF |
| Ga0310127_193156_1_162 | 3300034072 | Fracking Water | FSKGGNGAGGVVIIAYPDIYPVLSISAGLTYDQPTRAGYRVYRFTAGTGTITI |
| Ga0310130_0001822_790_948 | 3300034073 | Fracking Water | MGSAGGSGVVVLAYPDIYPALSTISAGLTYDQPTRSGYRVYRFTAGSGTISW |
| Ga0335020_0458553_231_365 | 3300034082 | Freshwater | MVIIAYPDTFAELTTIGGTLVYDQPTRSGYRVYRFTAGTGTVTF |
| Ga0335068_0312186_235_372 | 3300034116 | Freshwater | VVIAYSTTIPAISNIPGGLTYTIDTATRPGYRVYKFTSGTGTITF |
| Ga0335060_0629071_311_511 | 3300034122 | Freshwater | VVGYYGFGANGTGPSGVQANPGVVIIAYPDTIPAITTIPGTLTYDQPSRSGYRVYRFTAGSGTVTF |
| Ga0335007_0825775_3_143 | 3300034283 | Freshwater | MSSASGGSGIVIIAYPDSFPAPTSISGLTYNQPSRAGYRVYRFTAG |
| Ga0335048_0162527_1_138 | 3300034356 | Freshwater | GVVIISYPDTYAVPTSISNGLTYDTPIRSGYRVYRFTAGTGTVTW |
| Ga0335048_0255985_791_931 | 3300034356 | Freshwater | SGIIVIAYPDTFRAITTIPGTLTYDQPTRAGYRVYRFTAGSGTITF |
| ⦗Top⦘ |