| Basic Information | |
|---|---|
| Family ID | F071148 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQVKELIEQLQYMDQEAEVHFSYNYGDHWRTEVAPKVDRVDEG |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.36 % |
| % of genes near scaffold ends (potentially truncated) | 96.72 % |
| % of genes from short scaffolds (< 2000 bps) | 90.16 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.836 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.492 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.869 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 0.00% Coil/Unstructured: 88.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01541 | GIY-YIG | 0.82 |
| PF14284 | PcfJ | 0.82 |
| PF11443 | DUF2828 | 0.82 |
| PF10765 | Phage_P22_NinX | 0.82 |
| PF03013 | Pyr_excise | 0.82 |
| PF13578 | Methyltransf_24 | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.84 % |
| All Organisms | root | All Organisms | 40.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c011944 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300000756|JGI12421J11937_10047246 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300003411|JGI25911J50253_10102448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| 3300003411|JGI25911J50253_10116434 | Not Available | 797 | Open in IMG/M |
| 3300003491|JGI25924J51412_1004155 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300003497|JGI25925J51416_10110761 | Not Available | 648 | Open in IMG/M |
| 3300004054|Ga0063232_10162670 | Not Available | 655 | Open in IMG/M |
| 3300004112|Ga0065166_10391541 | Not Available | 579 | Open in IMG/M |
| 3300004126|Ga0066179_10028177 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300004765|Ga0007745_1380935 | Not Available | 720 | Open in IMG/M |
| 3300004774|Ga0007794_10147185 | Not Available | 704 | Open in IMG/M |
| 3300005517|Ga0070374_10475386 | Not Available | 625 | Open in IMG/M |
| 3300005584|Ga0049082_10131061 | Not Available | 873 | Open in IMG/M |
| 3300006103|Ga0007813_1084715 | Not Available | 618 | Open in IMG/M |
| 3300006110|Ga0007871_1077417 | Not Available | 626 | Open in IMG/M |
| 3300006641|Ga0075471_10637823 | Not Available | 521 | Open in IMG/M |
| 3300006917|Ga0075472_10686703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Cbastvirus → Cellulophaga virus ST | 515 | Open in IMG/M |
| 3300007547|Ga0102875_1097584 | Not Available | 939 | Open in IMG/M |
| 3300007585|Ga0102916_1169046 | Not Available | 592 | Open in IMG/M |
| 3300008107|Ga0114340_1075735 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
| 3300008111|Ga0114344_1015699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6177 | Open in IMG/M |
| 3300008113|Ga0114346_1198854 | Not Available | 802 | Open in IMG/M |
| 3300009026|Ga0102829_1292149 | Not Available | 541 | Open in IMG/M |
| 3300009151|Ga0114962_10131144 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300009151|Ga0114962_10624921 | Not Available | 557 | Open in IMG/M |
| 3300009152|Ga0114980_10429428 | Not Available | 756 | Open in IMG/M |
| 3300009155|Ga0114968_10642603 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 559 | Open in IMG/M |
| 3300009159|Ga0114978_10098374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1935 | Open in IMG/M |
| 3300009161|Ga0114966_10758413 | Not Available | 526 | Open in IMG/M |
| 3300009180|Ga0114979_10418178 | Not Available | 783 | Open in IMG/M |
| 3300009182|Ga0114959_10391548 | Not Available | 681 | Open in IMG/M |
| 3300009182|Ga0114959_10504980 | Not Available | 583 | Open in IMG/M |
| 3300009187|Ga0114972_10486085 | Not Available | 701 | Open in IMG/M |
| 3300009684|Ga0114958_10174257 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300009684|Ga0114958_10418932 | Not Available | 647 | Open in IMG/M |
| 3300010157|Ga0114964_10319473 | Not Available | 735 | Open in IMG/M |
| 3300010354|Ga0129333_10992842 | Not Available | 706 | Open in IMG/M |
| 3300010374|Ga0114986_1082224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300012013|Ga0153805_1091473 | Not Available | 517 | Open in IMG/M |
| 3300012664|Ga0157497_1021686 | Not Available | 858 | Open in IMG/M |
| 3300013006|Ga0164294_10556981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300013006|Ga0164294_10633633 | Not Available | 724 | Open in IMG/M |
| 3300013006|Ga0164294_10998402 | Not Available | 562 | Open in IMG/M |
| 3300013094|Ga0164297_10022225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3878 | Open in IMG/M |
| 3300013285|Ga0136642_1173556 | Not Available | 529 | Open in IMG/M |
| 3300013286|Ga0136641_1056001 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300013295|Ga0170791_14404898 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
| 3300013372|Ga0177922_11232176 | Not Available | 763 | Open in IMG/M |
| 3300017722|Ga0181347_1101672 | Not Available | 819 | Open in IMG/M |
| 3300017761|Ga0181356_1118745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 846 | Open in IMG/M |
| 3300017784|Ga0181348_1015701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3252 | Open in IMG/M |
| 3300017785|Ga0181355_1300105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300018416|Ga0181553_10232506 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300018876|Ga0181564_10762681 | Not Available | 507 | Open in IMG/M |
| 3300020048|Ga0207193_1319399 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300020141|Ga0211732_1135661 | Not Available | 524 | Open in IMG/M |
| 3300020141|Ga0211732_1374284 | Not Available | 544 | Open in IMG/M |
| 3300020162|Ga0211735_10403472 | Not Available | 502 | Open in IMG/M |
| 3300020172|Ga0211729_11128025 | Not Available | 543 | Open in IMG/M |
| 3300020172|Ga0211729_11201917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2129 | Open in IMG/M |
| 3300020205|Ga0211731_10493864 | Not Available | 731 | Open in IMG/M |
| 3300020205|Ga0211731_10677201 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300020695|Ga0214190_1006488 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
| 3300020696|Ga0214181_1000542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8513 | Open in IMG/M |
| 3300020699|Ga0214221_1020553 | Not Available | 667 | Open in IMG/M |
| 3300021126|Ga0214187_1018506 | Not Available | 792 | Open in IMG/M |
| 3300021142|Ga0214192_1067511 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300021560|Ga0126371_10203251 | Not Available | 2077 | Open in IMG/M |
| 3300021956|Ga0213922_1035657 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300022848|Ga0222674_1043391 | Not Available | 736 | Open in IMG/M |
| 3300023184|Ga0214919_10524750 | Not Available | 721 | Open in IMG/M |
| 3300023184|Ga0214919_10650513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300023311|Ga0256681_10472221 | Not Available | 540 | Open in IMG/M |
| 3300024343|Ga0244777_10790559 | Not Available | 561 | Open in IMG/M |
| 3300024346|Ga0244775_10623045 | Not Available | 874 | Open in IMG/M |
| 3300024346|Ga0244775_11521533 | Not Available | 511 | Open in IMG/M |
| 3300025368|Ga0208620_1013967 | Not Available | 937 | Open in IMG/M |
| 3300025450|Ga0208744_1049604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300025598|Ga0208379_1091347 | Not Available | 735 | Open in IMG/M |
| 3300025723|Ga0208741_10021163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
| 3300025779|Ga0208869_1007343 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
| 3300027125|Ga0255106_1002720 | All Organisms → Viruses → Predicted Viral | 3286 | Open in IMG/M |
| 3300027136|Ga0255107_1021760 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300027286|Ga0255129_1027443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300027311|Ga0208812_1007091 | All Organisms → Viruses → Predicted Viral | 2420 | Open in IMG/M |
| 3300027563|Ga0209552_1044787 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300027608|Ga0208974_1032035 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300027621|Ga0208951_1105111 | Not Available | 767 | Open in IMG/M |
| 3300027708|Ga0209188_1250964 | Not Available | 611 | Open in IMG/M |
| 3300027746|Ga0209597_1355639 | Not Available | 545 | Open in IMG/M |
| 3300027756|Ga0209444_10183313 | Not Available | 773 | Open in IMG/M |
| 3300027756|Ga0209444_10262687 | Not Available | 597 | Open in IMG/M |
| 3300027759|Ga0209296_1023622 | Not Available | 3470 | Open in IMG/M |
| 3300027759|Ga0209296_1081501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
| 3300027763|Ga0209088_10412890 | Not Available | 518 | Open in IMG/M |
| 3300027764|Ga0209134_10087130 | Not Available | 1061 | Open in IMG/M |
| 3300027764|Ga0209134_10148484 | Not Available | 808 | Open in IMG/M |
| 3300027764|Ga0209134_10287418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300027772|Ga0209768_10225482 | Not Available | 827 | Open in IMG/M |
| 3300027793|Ga0209972_10269873 | Not Available | 761 | Open in IMG/M |
| 3300027798|Ga0209353_10144339 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300027816|Ga0209990_10275475 | Not Available | 759 | Open in IMG/M |
| 3300027892|Ga0209550_10312438 | Not Available | 1006 | Open in IMG/M |
| 3300027892|Ga0209550_10518097 | Not Available | 713 | Open in IMG/M |
| 3300027963|Ga0209400_1337021 | Not Available | 563 | Open in IMG/M |
| 3300027969|Ga0209191_1310604 | Not Available | 581 | Open in IMG/M |
| 3300027969|Ga0209191_1334668 | Not Available | 551 | Open in IMG/M |
| 3300027971|Ga0209401_1323205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300028393|Ga0304728_1089648 | Not Available | 1193 | Open in IMG/M |
| 3300028393|Ga0304728_1163848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300028393|Ga0304728_1206331 | Not Available | 679 | Open in IMG/M |
| 3300031758|Ga0315907_10709125 | Not Available | 764 | Open in IMG/M |
| 3300031784|Ga0315899_10108254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2857 | Open in IMG/M |
| 3300031784|Ga0315899_11500831 | Not Available | 565 | Open in IMG/M |
| 3300031787|Ga0315900_10495661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300032050|Ga0315906_10635322 | Not Available | 871 | Open in IMG/M |
| 3300032093|Ga0315902_10816952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300032116|Ga0315903_10146765 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300032256|Ga0315271_10853756 | Not Available | 785 | Open in IMG/M |
| 3300034093|Ga0335012_0120144 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300034117|Ga0335033_0349092 | Not Available | 743 | Open in IMG/M |
| 3300034283|Ga0335007_0206897 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.10% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.10% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.46% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.46% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.64% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.82% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.82% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.82% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020695 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300020696 | Freshwater microbial communities from Trout Bog Lake, WI - 05NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300020699 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021126 | Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022848 | Saline water microbial communities from Ace Lake, Antarctica - #866 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025779 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0119445 | 3300000176 | Freshwater | MKVAELIEQLQDMDPNADVHFSYNYGDHWRTQVAATIDR |
| JGI12421J11937_100472461 | 3300000756 | Freshwater And Sediment | MKVSELIEQLGYMNPEAEVHFSYGYGDHWRTQVAPR |
| JGI25911J50253_101024483 | 3300003411 | Freshwater Lake | MQVKELIEQLQDMNPESDVHFAYNYGDHWRTEVAPQVEPCG* |
| JGI25911J50253_101164343 | 3300003411 | Freshwater Lake | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAVSNIQQ |
| JGI25924J51412_100415510 | 3300003491 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFSYCYGDHWRTEVAPKIDRVDEGVV |
| JGI25925J51416_101107611 | 3300003497 | Freshwater Lake | MKVADLILELQDMNPEADVHFAYNYGDHWRTEVAPKATRVYTGKVQY |
| Ga0063232_101626703 | 3300004054 | Freshwater Lake | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAVSNIQQGVV |
| Ga0065166_103915411 | 3300004112 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFSYNYGDHWRTEVAPKVDRVDEGAVVYSEY |
| Ga0066179_100281771 | 3300004126 | Freshwater Lake | MKVKDLIEQLGYMDPEAEVHYSYNYGDHWRTQVAPSVGSVEE |
| Ga0007745_13809353 | 3300004765 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFAYNYGDHWRTEVAPKIDRVDEGVVE |
| Ga0007794_101471852 | 3300004774 | Freshwater | MKVHELINELSNYDSDLEVHFSYNFGDYWRTIVAPAVTEVE |
| Ga0070374_104753863 | 3300005517 | Freshwater Lake | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAV |
| Ga0049082_101310611 | 3300005584 | Freshwater Lentic | MQVKELIELLQDMNPESDVHFAYNYGDHWRTEVAPKLSRVDNGA |
| Ga0007813_10847152 | 3300006103 | Freshwater | MKVQELIERLKFANPEADVHFAYNYGDYWNTVVAPSV |
| Ga0007871_10774171 | 3300006110 | Freshwater | MQVKELIEQLQYMDQEAEVHFSYNYGDHWRTEVAPKVDRVDEG |
| Ga0075471_106378233 | 3300006641 | Aqueous | MRVEDLIAELQLMPQDAEVHFQYNYGDHWRTQVAPTVD |
| Ga0075472_106867032 | 3300006917 | Aqueous | MNVADLIEELKLMPQDAEVHFQYNYGDHWRTQVAPTVSEVY |
| Ga0102875_10975841 | 3300007547 | Estuarine | MKVSQLIEALQSMDPALDVHFSYCYGDHWRTEVAPA |
| Ga0102916_11690461 | 3300007585 | Estuarine | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAVSNITEGVVEFS |
| Ga0114340_10757351 | 3300008107 | Freshwater, Plankton | MLVKELIESLKYMDQDAEVHFAYNYGDHWRTEVAPKVSQVT |
| Ga0114344_10156997 | 3300008111 | Freshwater, Plankton | MKVADLIEALQGMDPTLDVHFAYGYGDHWRTDKEHT* |
| Ga0114346_11988541 | 3300008113 | Freshwater, Plankton | MKVADLIELLQMENPEAEVHFSYNYGDHWRTQVAPTVDSVENGYV |
| Ga0102829_12921492 | 3300009026 | Estuarine | MQVKDLIEKLQFMNPDAEVHFSYNYGDHWHTEVAPTVSSVDE |
| Ga0114962_101311445 | 3300009151 | Freshwater Lake | MQVKELIEQLQDMNPEAEVHFAYGYGDHWRTTVAPS |
| Ga0114962_106249211 | 3300009151 | Freshwater Lake | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPKVGSVLEGM |
| Ga0114980_104294281 | 3300009152 | Freshwater Lake | MLVRDLIELLEGYDADMEVHYAYNYGDHWRTEVAPKVGDVREGVVELASTTAWTK* |
| Ga0114968_106426032 | 3300009155 | Freshwater Lake | MKVRELIESLGYMNPDAEVHFSYNYGDHWRTEVAPAVNQVSEGIVEFSDY |
| Ga0114978_100983748 | 3300009159 | Freshwater Lake | MKVSKLIEELKSMDPEAEVHFEYNYGDHWRTQVAPE |
| Ga0114966_107584131 | 3300009161 | Freshwater Lake | MKVFQLIERLMDLDPNAEVHFSYNYGDHWHTEVAPT |
| Ga0114979_104181784 | 3300009180 | Freshwater Lake | MKVSELIELLQDMNEEAEVHVSYNYGDYWRTKVTSSVDEVFDGRVEY |
| Ga0114959_103915483 | 3300009182 | Freshwater Lake | MKVAELIESLQYMDKDAEVHFAYNYGDHWRTEVAPKVSRVDEGAVVYSE |
| Ga0114959_105049802 | 3300009182 | Freshwater Lake | MQVKELIEILKNYDQEADVHFAYGYGDHWRTQVAPAVCQVFDG |
| Ga0114972_104860853 | 3300009187 | Freshwater Lake | MLVRDLIELLEGYDADMEVHFAYGYGDHWRTTVAPR |
| Ga0114958_101742571 | 3300009684 | Freshwater Lake | MLVKELIESLQYLDQDAEVHFAYNYGDHWRTEVAPKVSQVTEGV |
| Ga0114958_104189322 | 3300009684 | Freshwater Lake | MQVKELIEMLQGLDPEAQVHYAYNYGDHWRTEVAPKV |
| Ga0114964_103194733 | 3300010157 | Freshwater Lake | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPKVGSVLEGMVKY |
| Ga0129333_109928422 | 3300010354 | Freshwater To Marine Saline Gradient | MKVHELIELLGDFDPEADVHIEYNYGDYWRTQVAPQVSSVGDGQVVYSEY |
| Ga0114986_10822243 | 3300010374 | Deep Subsurface | MKVKDLIEQLGYMDLEADVHFAYNYGDHWRTTVAPKVGSVEEGVVEHSA |
| Ga0153805_10914733 | 3300012013 | Surface Ice | MLVRDLIELLEGYDADMEVHFAYNYGDHWRSEVAPKASNVR |
| Ga0157497_10216861 | 3300012664 | Freshwater | MKVADLIELLQQESPDAEVHFSYNYGDHWRTQVAPT |
| Ga0164294_105569811 | 3300013006 | Freshwater | MQVYQLIEQLMDLDPNAEVHFTYNYGDYWRTKVAPKVSEVF |
| Ga0164294_106336331 | 3300013006 | Freshwater | MQVKELIEILGRYDQEADVHFAYGYGDYWRTQVAPAISQVFDGVV |
| Ga0164294_109984021 | 3300013006 | Freshwater | MQVFQLIEQLMDLDPNAEVHFSYNYGDYWRTEVAPK |
| Ga0164297_100222251 | 3300013094 | Freshwater | MQVKELIEQLQYMDQEAEVHFSYNYGDHWRTEVAPK |
| Ga0136642_11735563 | 3300013285 | Freshwater | MLVKELIESLKYMDQDAEVHYAYNYGDHWRTEVAPKVGRVDEGAVVYS |
| Ga0136641_10560013 | 3300013286 | Freshwater | MQVKELIEILGRYDQEADVHFAYGYGDHWRTEVAPAIS |
| Ga0170791_144048981 | 3300013295 | Freshwater | MQVKELIEILSRYDQEADVHFAYGYGDHWRTQVAPAISQVFDGVVEY |
| Ga0177922_112321761 | 3300013372 | Freshwater | MQVKELIEQLQDMNPESDVHFAYNYGDHWRTEVAPKLSRVDNGAVVY |
| Ga0181347_11016724 | 3300017722 | Freshwater Lake | MKVADLILELQDMNPEADVHFAYNYGDHWRTEVAPKATRVYTGKV |
| Ga0181356_11187454 | 3300017761 | Freshwater Lake | MTVQELIVQLLTLNPDAEVHLAYNYGDHWHTQVAPRVEEVS |
| Ga0181348_10157011 | 3300017784 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFAYNYGDHWRTEVAPKVSQVSEGVVEFS |
| Ga0181355_13001052 | 3300017785 | Freshwater Lake | MQVKELIEMLSYLDQNAEVHFSYNYGDHWQTQVAPSVDRVD |
| Ga0181553_102325064 | 3300018416 | Salt Marsh | MQVKELIELLKYYDQDAEVHFSYNYGDHWRTQVAPKVR |
| Ga0181564_107626811 | 3300018876 | Salt Marsh | MKVSELIEQLQDMNPDAEVHFAYNYNDHWRTHVAPTVDSVEEGIVKYSDYNRMPKVVEYD |
| Ga0207193_13193993 | 3300020048 | Freshwater Lake Sediment | MTVQELMEQLGYMNPEAEVHFAYNYGDHWRTQXXXXXXXX |
| Ga0211732_11356613 | 3300020141 | Freshwater | MLVRDLIELLEGYDADMEVHFAYNYGDHWRSEVAP |
| Ga0211732_13742841 | 3300020141 | Freshwater | MKVSELIDILGRYDQEADVHFSYGYGDHWRTEVAPAVCQ |
| Ga0211735_104034721 | 3300020162 | Freshwater | MKVSELIDILGRYDQDVEVHFSYNYGDHWRTEVAPAICQVS |
| Ga0211729_111280251 | 3300020172 | Freshwater | MKVSELIELLGYHSPDAEVHFSYGYGDHWRTEVAPAVSSVADGVVEYSD |
| Ga0211729_112019175 | 3300020172 | Freshwater | MQVFQLIEQLMELDPNAEVHFSYNYGDHWRTEVAPKVDSVLE |
| Ga0211731_104938641 | 3300020205 | Freshwater | MKVSELIEILGRYDQNVEVHFSYNYGDHWRTEVAP |
| Ga0211731_106772011 | 3300020205 | Freshwater | MKVSELIDILGRYDQDVEVHFSYNYGDHWRTEVAPAICQVSDG |
| Ga0214190_10064885 | 3300020695 | Freshwater | MKVAELIEQLQDMDPNADVHFSYNYGDHWRTQVAATIDRVDE |
| Ga0214181_10005421 | 3300020696 | Freshwater | MKVQELIERLKFANPEADVHFAYNYGDYWNTVVAPSVNSV |
| Ga0214221_10205531 | 3300020699 | Freshwater | MKVQELIERLKFANPEADVHFAYNYGDYWNTVVAPSVNSVEDGMV |
| Ga0214187_10185064 | 3300021126 | Freshwater | MKVSALIEMLRDFPEDAEVHFSYNYGDHWRTEVAPRVNQVFEG |
| Ga0214192_10675114 | 3300021142 | Freshwater | MKVKDLIEQLGYMDPEADVHYAYNYGDHWRTEVAPKVGRVDEGAV |
| Ga0126371_102032511 | 3300021560 | Tropical Forest Soil | VKVKQLIDWLHGEDQDAEVHIAYNYGDHHRTMVAPSVSR |
| Ga0213922_10356571 | 3300021956 | Freshwater | MKVQDLIELLQAENPEAEVHFSYNYGDHWRTQVAPK |
| Ga0222674_10433911 | 3300022848 | Saline Water | MKVAELIDMLGDFDPESEDRFSYNYGDYWRTTVAKNPMN |
| Ga0214919_105247501 | 3300023184 | Freshwater | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPKVGSVLEGMVKYSE |
| Ga0214919_106505131 | 3300023184 | Freshwater | MKVSKLIEELKSMDPEAEVHFEYNYGDHWRTQVAPEVTQVQEGIVK |
| Ga0256681_104722211 | 3300023311 | Freshwater | MKVHELIEELSNYDPNKEVHFSYNYGDHWRTIVAPAVTEVEDGK |
| Ga0244777_107905591 | 3300024343 | Estuarine | MLVKELIESLKYMDQDAEVHFSYCYGDHWRTEVAPK |
| Ga0244775_106230454 | 3300024346 | Estuarine | MKVSQLIAMLEGEDQEADVHFSYCYGDHWHTEVAPKLSNVTVGIV |
| Ga0244775_115215332 | 3300024346 | Estuarine | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWRTEVAPTVSNITEG |
| Ga0208620_10139672 | 3300025368 | Freshwater | MKVQELIERLKFANPEADVHFAYNYGDYWNTVVAPSVNSVEDGMVT |
| Ga0208744_10496041 | 3300025450 | Freshwater | MKVSALIEMLRDFPEDAEVHFSYNYGDHWRTEVAPRVNQVFEGIVKH |
| Ga0208379_10913473 | 3300025598 | Freshwater | MLVKELIEMLEGMNQDAEVHFAYNYGDHWRTEVAPK |
| Ga0208741_100211633 | 3300025723 | Freshwater | MKVQELIERLKFANPEADVHFAYNYGDYWNTVVAPSVNSVEDGMVTYSEY |
| Ga0208869_10073431 | 3300025779 | Freshwater | MLVRDLIELLEGYDADLEVHFAYNYGDHWRTQVAPSVDSVDM |
| Ga0255106_10027201 | 3300027125 | Freshwater | MTVQELIEQLGYMDPNANVHFAYNYGDHWRTQVAPSVGSV |
| Ga0255107_10217601 | 3300027136 | Freshwater | MLVKELIESLQYMDQDSEVHFAYGYGDHWRTEVAPK |
| Ga0255129_10274434 | 3300027286 | Freshwater | MTVQELIEQLGYMDPNANVHFAYNYGDHWRTQVAPSVGSVEEGV |
| Ga0208812_10070911 | 3300027311 | Estuarine | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAVSNITE |
| Ga0209552_10447875 | 3300027563 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFAYNYGDHWRTEVAPKVERVHQG |
| Ga0208974_10320351 | 3300027608 | Freshwater Lentic | MTVQELINTLQYMNPETEVHFSYGYGDHWRTEVAPRV |
| Ga0208951_11051111 | 3300027621 | Freshwater Lentic | MQVKELIEQLQDMNPESDVHFAYNYGDHWRTEVAPKLSRV |
| Ga0209188_12509643 | 3300027708 | Freshwater Lake | MLVRDLIELLEGYDADMEVHFAYDYGDRTHSQVAPKASNV |
| Ga0209597_13556392 | 3300027746 | Freshwater Lake | MQVYQLIEQLEYLDPNAEVHFSYNYGDHWHTQVAPTVDQVST |
| Ga0209444_101833133 | 3300027756 | Freshwater Lake | MQVKELIEMLQDMNPESDVHFAYNYGDHWRTEVAPKLSRVD |
| Ga0209444_102626872 | 3300027756 | Freshwater Lake | MQVKELIELLQDMNPESDVHFAYNYGDHWRTEVAPKLSRVD |
| Ga0209296_102362213 | 3300027759 | Freshwater Lake | MQVYQLIEQLEFMDPNSEVHFAYSYGDHWRTTVAPVVGSVKQGIVE |
| Ga0209296_10815013 | 3300027759 | Freshwater Lake | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPKVGSVLEGLV |
| Ga0209088_104128901 | 3300027763 | Freshwater Lake | MKVAELIEILGRYDQDVEVHFSYNYGDHWRTEVAPAICQVHD |
| Ga0209134_100871304 | 3300027764 | Freshwater Lake | MNVAQLIEQLQYLPQDADVHFAYGYGDHWRTTVAPKVSQVFEGVVERSD |
| Ga0209134_101484841 | 3300027764 | Freshwater Lake | MTVQELIEQLGYMDKDAEVHFAYNYGDHWRTQVAPKVRD |
| Ga0209134_102874181 | 3300027764 | Freshwater Lake | MTVQELIEQLGCMNPEAEVHFAYNYGDHWRTEVAPRVGRVDEGA |
| Ga0209768_102254824 | 3300027772 | Freshwater Lake | MQVKELIEQLQDMNPESDVHFAYNYGDHWRTEVAPKL |
| Ga0209972_102698731 | 3300027793 | Freshwater Lake | MLVKELIESLKYMDQDAEVHFAYNYGDHWRTEVAPKVSRVSEG |
| Ga0209353_101443391 | 3300027798 | Freshwater Lake | MTVQELIEQLGYMDKDAEVHFAYNYGDHWRTQVAP |
| Ga0209990_102754753 | 3300027816 | Freshwater Lake | MTVQELINTLQFMDMNAEVHFAYNYGDHWRTEVAPRISD |
| Ga0209550_103124381 | 3300027892 | Freshwater Lake | MKVSQLIEQLGYMDKDAEVHFSYNYGDHWHTEVAPAVSNIQQGVVEF |
| Ga0209550_105180973 | 3300027892 | Freshwater Lake | MQVKELIELLQDMNPESDVHFAYNYGDHWRTEVAPKLS |
| Ga0209400_13370211 | 3300027963 | Freshwater Lake | MKVAQLIEQLQDMDPNADVHFSYNYGDHWRTQVAATIDRVDEGYVEHS |
| Ga0209191_13106042 | 3300027969 | Freshwater Lake | MKVQELIEQLKSMNPNAEVHFSYNYGDHWRTQVAPSVDEV |
| Ga0209191_13346681 | 3300027969 | Freshwater Lake | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPKVGSVLEG |
| Ga0209401_13232053 | 3300027971 | Freshwater Lake | MKVSELIKLLQDMNEEAEVHFSYNYGDHWRTHVAPKVSQV |
| Ga0304728_10896481 | 3300028393 | Freshwater Lake | MLVRDLIELLESFDADMEVHFAYDYGDRTHSQVAPKISDV |
| Ga0304728_11638481 | 3300028393 | Freshwater Lake | MLVKDLIAELANMNPDAEVHFSYNYGDHWRTRVAPSVDQVFEGLVK |
| Ga0304728_12063313 | 3300028393 | Freshwater Lake | MQVFQLIEQLMDLDPNAEVHFSYNYGDHWRTEVAPK |
| Ga0315907_107091253 | 3300031758 | Freshwater | MKVADLIELLQMENPEAEVHFSYNYGDHWRTQVAPTV |
| Ga0315899_101082541 | 3300031784 | Freshwater | MKVSELIAKLEFMDPDAEVHFAYNYGDHWRTEVAPKVSQ |
| Ga0315899_115008311 | 3300031784 | Freshwater | MLVRDLIEMLEGCDADMEVHFAYNYGDHWRTEVAPK |
| Ga0315900_104956611 | 3300031787 | Freshwater | MKVAELIEQLRYLDQESEVHFSYNYGDHWRTEVAPRVSRVN |
| Ga0315906_106353223 | 3300032050 | Freshwater | MLVKELIESLQYMDQDSEVHFAYNYGDHWRTEVAPKVGRV |
| Ga0315902_108169523 | 3300032093 | Freshwater | MQVKELIEMLEGMNPEAEVHFSYNYGDYWRTEVAPAVGRVDEGAVVYSEYHRM |
| Ga0315903_101467651 | 3300032116 | Freshwater | MLVKELIESLQYMDQDSEVHFAYGYGDHWRTEVAPKVSRVDE |
| Ga0315271_108537561 | 3300032256 | Sediment | MQVFQLIERLMDLDPNAEVHFSYNYGDHWHTEVAP |
| Ga0335012_0120144_1_147 | 3300034093 | Freshwater | MKVSQLIEQLGYMDKDADVHFAYGYGDHWRTTVAPKVSQVFEGVVEFSD |
| Ga0335033_0349092_3_146 | 3300034117 | Freshwater | MQVKELIEMLQDMDQDADVHFAYNYGDHWRTEVAPKVGRVDEGAVVYS |
| Ga0335007_0206897_3_122 | 3300034283 | Freshwater | MLVRDLIELLEGYEADMEVHFAYDYGDRTHSQVAPRVNDV |
| ⦗Top⦘ |