NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071134

Metagenome Family F071134

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071134
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 69 residues
Representative Sequence MNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDTQLLPQLVEAILEVDPDLDCFLE
Number of Associated Samples 105
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 17.07 %
% of genes near scaffold ends (potentially truncated) 31.97 %
% of genes from short scaffolds (< 2000 bps) 85.25 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (71.311 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(30.328 % of family members)
Environment Ontology (ENVO) Unclassified
(77.049 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.443 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.00%    β-sheet: 34.00%    Coil/Unstructured: 47.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF04545Sigma70_r4 7.38
PF04542Sigma70_r2 2.46
PF05367Phage_endo_I 0.82
PF00004AAA 0.82
PF13385Laminin_G_3 0.82
PF13328HD_4 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.46
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.46
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.46
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A71.31 %
All OrganismsrootAll Organisms28.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10218722Not Available599Open in IMG/M
3300000117|DelMOWin2010_c10108938Not Available994Open in IMG/M
3300000117|DelMOWin2010_c10183335Not Available658Open in IMG/M
3300001952|GOS2224_1019131All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1422Open in IMG/M
3300002131|M2t2BS1_1285097Not Available7247Open in IMG/M
3300004097|Ga0055584_100203008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2013Open in IMG/M
3300006025|Ga0075474_10206594Not Available601Open in IMG/M
3300006025|Ga0075474_10238250Not Available550Open in IMG/M
3300006026|Ga0075478_10049742Not Available1375Open in IMG/M
3300006027|Ga0075462_10036645Not Available1573Open in IMG/M
3300006029|Ga0075466_1063765Not Available1056Open in IMG/M
3300006735|Ga0098038_1112863Not Available929Open in IMG/M
3300006735|Ga0098038_1236044Not Available581Open in IMG/M
3300006752|Ga0098048_1189254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300006802|Ga0070749_10000018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage74397Open in IMG/M
3300006810|Ga0070754_10126155Not Available1242Open in IMG/M
3300006867|Ga0075476_10058082Not Available1550Open in IMG/M
3300006867|Ga0075476_10107209Not Available1071Open in IMG/M
3300006874|Ga0075475_10033064All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2493Open in IMG/M
3300006916|Ga0070750_10497445Not Available500Open in IMG/M
3300006922|Ga0098045_1159565Not Available516Open in IMG/M
3300007229|Ga0075468_10152573Not Available699Open in IMG/M
3300007344|Ga0070745_1174841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300007345|Ga0070752_1114001Not Available1143Open in IMG/M
3300007345|Ga0070752_1251213Not Available687Open in IMG/M
3300007538|Ga0099851_1364143Not Available502Open in IMG/M
3300007539|Ga0099849_1006951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5131Open in IMG/M
3300007541|Ga0099848_1146035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300007640|Ga0070751_1022861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2970Open in IMG/M
3300007640|Ga0070751_1064894Not Available1565Open in IMG/M
3300007960|Ga0099850_1361527Not Available542Open in IMG/M
3300007963|Ga0110931_1205874Not Available587Open in IMG/M
3300008012|Ga0075480_10555359Not Available547Open in IMG/M
3300009550|Ga0115013_10122734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1498Open in IMG/M
3300010148|Ga0098043_1027060Not Available1816Open in IMG/M
3300010149|Ga0098049_1018118All Organisms → Viruses → Predicted Viral2334Open in IMG/M
3300010149|Ga0098049_1088888Not Available970Open in IMG/M
3300010153|Ga0098059_1408033Not Available513Open in IMG/M
3300010300|Ga0129351_1111697Not Available1093Open in IMG/M
3300012920|Ga0160423_11078150Not Available537Open in IMG/M
3300012928|Ga0163110_10896179Not Available702Open in IMG/M
3300017697|Ga0180120_10123294Not Available1113Open in IMG/M
3300017706|Ga0181377_1008555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2550Open in IMG/M
3300017708|Ga0181369_1016081Not Available1855Open in IMG/M
3300017708|Ga0181369_1053477Not Available898Open in IMG/M
3300017708|Ga0181369_1076573Not Available717Open in IMG/M
3300017709|Ga0181387_1041023Not Available915Open in IMG/M
3300017719|Ga0181390_1078678Not Available914Open in IMG/M
3300017721|Ga0181373_1027601Not Available1052Open in IMG/M
3300017721|Ga0181373_1063887Not Available661Open in IMG/M
3300017731|Ga0181416_1069676Not Available832Open in IMG/M
3300017732|Ga0181415_1079835Not Available738Open in IMG/M
3300017733|Ga0181426_1091677Not Available609Open in IMG/M
3300017740|Ga0181418_1049082Not Available1053Open in IMG/M
3300017748|Ga0181393_1140949Not Available604Open in IMG/M
3300017752|Ga0181400_1227271Not Available508Open in IMG/M
3300017753|Ga0181407_1080139Not Available834Open in IMG/M
3300017753|Ga0181407_1107501Not Available700Open in IMG/M
3300017758|Ga0181409_1044683Not Available1375Open in IMG/M
3300017759|Ga0181414_1054343Not Available1070Open in IMG/M
3300017762|Ga0181422_1087131Not Available982Open in IMG/M
3300017770|Ga0187217_1311300Not Available506Open in IMG/M
3300017949|Ga0181584_10608798Not Available661Open in IMG/M
3300017951|Ga0181577_10413588Not Available856Open in IMG/M
3300017952|Ga0181583_10277545Not Available1073Open in IMG/M
3300017956|Ga0181580_10439554Not Available862Open in IMG/M
3300017956|Ga0181580_10849696Not Available572Open in IMG/M
3300017957|Ga0181571_10561957Not Available692Open in IMG/M
3300017957|Ga0181571_10729418Not Available591Open in IMG/M
3300017962|Ga0181581_10228389Not Available1220Open in IMG/M
3300017967|Ga0181590_10444324Not Available913Open in IMG/M
3300017967|Ga0181590_10975040Not Available554Open in IMG/M
3300017968|Ga0181587_11025350Not Available504Open in IMG/M
3300018039|Ga0181579_10389753Not Available755Open in IMG/M
3300018413|Ga0181560_10457210Not Available582Open in IMG/M
3300018421|Ga0181592_10137308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1874Open in IMG/M
3300020178|Ga0181599_1238279Not Available706Open in IMG/M
3300020185|Ga0206131_10089137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1821Open in IMG/M
3300020282|Ga0211667_1019309Not Available1790Open in IMG/M
3300020284|Ga0211649_1035587Not Available617Open in IMG/M
3300020378|Ga0211527_10008523All Organisms → Viruses → Predicted Viral4004Open in IMG/M
3300020414|Ga0211523_10028528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2442Open in IMG/M
3300021356|Ga0213858_10374796Not Available671Open in IMG/M
3300021364|Ga0213859_10229397Not Available854Open in IMG/M
3300021365|Ga0206123_10219342Not Available838Open in IMG/M
3300022057|Ga0212025_1011589Not Available1327Open in IMG/M
3300022065|Ga0212024_1007675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1536Open in IMG/M
3300022068|Ga0212021_1011547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1518Open in IMG/M
3300022187|Ga0196899_1013738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3128Open in IMG/M
3300022198|Ga0196905_1007836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3634Open in IMG/M
3300022925|Ga0255773_10310209Not Available640Open in IMG/M
3300022929|Ga0255752_10270242Not Available741Open in IMG/M
(restricted) 3300023109|Ga0233432_10017815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5285Open in IMG/M
(restricted) 3300023112|Ga0233411_10075716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1064Open in IMG/M
3300023176|Ga0255772_10437743Not Available648Open in IMG/M
3300023176|Ga0255772_10538639Not Available553Open in IMG/M
(restricted) 3300023210|Ga0233412_10161127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage964Open in IMG/M
(restricted) 3300023210|Ga0233412_10317424Not Available690Open in IMG/M
(restricted) 3300024255|Ga0233438_10096777Not Available1357Open in IMG/M
3300024293|Ga0228651_1020927Not Available1644Open in IMG/M
3300025070|Ga0208667_1029214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300025086|Ga0208157_1016651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2305Open in IMG/M
3300025099|Ga0208669_1031903Not Available1280Open in IMG/M
3300025102|Ga0208666_1027430Not Available1749Open in IMG/M
3300025128|Ga0208919_1185666Not Available630Open in IMG/M
3300025128|Ga0208919_1221476Not Available559Open in IMG/M
3300025141|Ga0209756_1188906All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300025151|Ga0209645_1058824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1327Open in IMG/M
3300025508|Ga0208148_1045075Not Available1115Open in IMG/M
3300025610|Ga0208149_1012504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2552Open in IMG/M
3300025646|Ga0208161_1047186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1401Open in IMG/M
3300025674|Ga0208162_1067438Not Available1141Open in IMG/M
3300025815|Ga0208785_1120735Not Available627Open in IMG/M
3300025828|Ga0208547_1056078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1342Open in IMG/M
3300025840|Ga0208917_1128299Not Available901Open in IMG/M
3300025853|Ga0208645_1011722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5311Open in IMG/M
3300025870|Ga0209666_1084634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1587Open in IMG/M
3300025889|Ga0208644_1001763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes17834Open in IMG/M
3300028131|Ga0228642_1076764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage867Open in IMG/M
3300032073|Ga0315315_10376479Not Available1321Open in IMG/M
3300032277|Ga0316202_10017521All Organisms → Viruses → Predicted Viral3545Open in IMG/M
3300034418|Ga0348337_067867Not Available1314Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous30.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.67%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh15.57%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.10%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.28%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.28%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.46%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.64%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.64%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.64%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.64%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.82%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.82%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.82%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001952Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008EnvironmentalOpen in IMG/M
3300002131Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020282Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169)EnvironmentalOpen in IMG/M
3300020284Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556128-ERR598952)EnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1021872223300000116MarineMNNLVITSTRTFNEDSCIRVKGKVEIDNVKHKFEVETDEGGLIRVGGVDTQLLPQLVEAILEVDPDLDCFLE*
DelMOWin2010_1010893813300000117MarineMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFL
DelMOWin2010_1018333523300000117MarineMKNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFLE*
GOS2224_101913123300001952MarineMKNLVITSTRTFMEDSCIHIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFLG*
M2t2BS1_128509763300002131MarineMKNLVISSGRTFNEDSCIRIKGKVEVDNAKCKFVLETDSWGRIDIDGVSELLLPELVAAILEIDPDLDCYLE*
Ga0055584_10020300813300004097Pelagic MarineMKNLVITSTRTFNEDSCIRVKGKVEVNNVKHKFVVETDDYGPQVEGVDEQLLPQLIEAILEVDPDLDCFLY*
Ga0075474_1020659413300006025AqueousEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE*
Ga0075474_1023825023300006025AqueousMKNLVIKKTRTFNEDSCIRIKGTVEIDNVKHKFKLETDDYGVYVDGIDKQLVPQLVEAILEVDPDLDCYLED*
Ga0075478_1004974263300006026AqueousMNNLVIESTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE*
Ga0075462_1003664543300006027AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVKAILEVDPDLDCFLE*
Ga0075466_106376513300006029AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLMPQLVEAILEVDPDLDCFLE*
Ga0098038_111286323300006735MarineMTNLVITSTRTFNEDSCIRIKGKVEIDNVKHKFELETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLD*
Ga0098038_123604423300006735MarineMNNLVITSTRTFMEDSCIRIKGKVEIDNAKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE*
Ga0098048_118925413300006752MarineMNNLVIENTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGSLIHVDGVDTQLLPQLVKAILEVDPDLDCFLE*
Ga0070749_10000018963300006802AqueousMENLVIEKQYTFNEDSCIRIKGTVEVDNVKHKFELETDDYGAYVDGIDKQLLPQLIAAILEEDPDLDCFLEF*
Ga0070754_1012615513300006810AqueousMKNLVIKKTRTFNEDSCIRIKGTVEIDNVKHKFKLETDDYGVYVDGIDKQLVPQLVEAILEVDPDLDCFLEF*
Ga0075476_1005808253300006867AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE*
Ga0075476_1010720923300006867AqueousMKNLVIEKRYSFREDSCIRIAGTVENDNVKHNFDLKTDEMGFKYVEGIDKELVPQLVAILLEEDPDLDCYLED*
Ga0075475_1003306463300006874AqueousMKNLVIKKQRTFNEDSCIRIAGKVEIDNVKHNFKLETDDYGVYVDGIDKQLVPQLVEAILEVDPDLDCFLEF*
Ga0070750_1049744513300006916AqueousMENLVIEKQYTFNEDSCIRIKGTVEVDNVKHKFELETDDYGAYVDGIDKQLLPQLIAAI*
Ga0098045_115956513300006922MarineIKGKVEIDNVKHKFELETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLG*
Ga0075468_1015257313300007229AqueousMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFLE
Ga0070745_117484113300007344AqueousEDSCIRIKGTVEVDNVKHKFELETDDYGAYVDGIDKQLLPQLIAAILEEDPDLDCFLEF*
Ga0070752_111400123300007345AqueousMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE
Ga0070752_125121323300007345AqueousMKNLVIEKRYSFREDSCIRIAGTVEIDNVKHNFDLKTDEMGFKYVEGIDKQLVPQLVEAILEVDPDLDCYLED*
Ga0099851_136414323300007538AqueousMKNLVIKGTRTFNGDSCIRIKGTVEIDNVKHKFKLETDDYGAYVEGIEKKYLLQLIDAILEEDPDLDCFLEFQREVIAQWSDLD*
Ga0099849_100695183300007539AqueousMNNLVIEKQKTFNEDSCIRIKGTVEIDNVKHKFMLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD*
Ga0099848_114603523300007541AqueousMKNLVIKSTRTFNGDSCIRIKGTVEIDNVKHKFKLETDDYGAYVEGIEKKYLLQLIDAILEEDPDLDCFLEFQKEVIAQWSDLD*
Ga0070751_1022861103300007640AqueousEVDNVKHKFELETDDYGAYVDGIDKQLLPQLIAAIMEEDPDLDCFLEF*
Ga0070751_106489413300007640AqueousTVEIDNIKHKFNLETDDYGAYVEGVEKKYLLQLIDAILEEDPDLDCFLEFQKEVISQWSDLD*
Ga0099850_136152713300007960AqueousMKNLVIKGTRTFNGDSCIRIKGTVEIDNVKHKFKLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD*
Ga0110931_120587423300007963MarineMEDSCIRIKGKVEIDNVKHKFEVETDEGDLVNVKGVDTQLLPQLVEAILE
Ga0075480_1055535913300008012AqueousMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCF
Ga0115013_1012273413300009550MarineMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHIEGVDTFYYQRLIEEILEVDPDLDCFLE
Ga0098043_102706043300010148MarineMNNLVIKSTRTFMEDSCIRIKGTVEIDNVKHKFVLETDEGGLIHVEGVDTFYYHRLIEEILEVDPDLDCFLD*
Ga0098049_101811873300010149MarineFMEDSCIRIKGKVEIDNAKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE*
Ga0098049_108888833300010149MarineMEDSCIRIKGKVEIDNVKHKFVVETDEGSLIHVDGVDTQLLPQLLEAILEVDPDLDCFLY
Ga0098059_140803323300010153MarineMEDSCIRIKGKVEIDNVKHKFEVETDEGDLVNVKGVDTQLLPQLVEAILEVDPDLDCFLD
Ga0129351_111169743300010300Freshwater To Marine Saline GradientLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE*
Ga0160423_1107815023300012920Surface SeawaterMEDSCVRVKGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYNRLVEEILEVDPDLD
Ga0163110_1089617923300012928Surface SeawaterMEDSCIRIKGKVEIDNVKHKFEVETDEGDLVNVKGVDTQLLPQLVEAILEVDPDLDCFLG
Ga0180120_1012329423300017697Freshwater To Marine Saline GradientMNNLVIESTRTFMEDSCIRIKGTVEIDNVKRKFAVETDEGDLVNVEGVEGRLLPQLVEAILEVDPDLDCFLE
Ga0181377_100855563300017706MarineMNNLVITSTRTFNEDSCIRIKGKVEIDNVKHKFEVETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLG
Ga0181369_101608133300017708MarineMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFEVETDEGDLVNVKGVDTQLLPQLVEAILEVDPDLDCFLD
Ga0181369_105347713300017708MarineMNNLVITSTRTFLEDSCIRVKGKVEIDNVKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLG
Ga0181369_107657323300017708MarineMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVLETDEGGLIHVEGVDTFYYHRLIEEILEVDPD
Ga0181387_104102323300017709SeawaterMNNLVIASTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181390_107867833300017719SeawaterMNNLVIASTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181373_102760133300017721MarineMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVLETDEGGLILIKGVQGRLLPELVEAILEVDPDLDCFLG
Ga0181373_106388723300017721MarineMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFEVETDEGSLIHVEGVDIQLLPQLVEAILEVDPDLDCFLE
Ga0181416_106967623300017731SeawaterMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHLLLEEILEVDPDLDCFLE
Ga0181415_107983513300017732SeawaterMNNSVISSTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEE
Ga0181426_109167723300017733SeawaterMNNLVISSTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181418_104908213300017740SeawaterMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEAILEVDPDLDCFLE
Ga0181393_114094913300017748SeawaterTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181400_122727113300017752SeawaterMNNLVIASTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHLLLEEILEVDPDLDCFLE
Ga0181407_108013913300017753SeawaterMNNLVIASTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEADPDLDCFLE
Ga0181407_110750123300017753SeawaterMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDL
Ga0181409_104468313300017758SeawaterTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181414_105434313300017759SeawaterDMNNLVIASTRTFMEDSCIRIEGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0181422_108713123300017762SeawaterMNNLVIASTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVDTFYYHRLLEEILEVDPDLDCFLE
Ga0187217_131130023300017770SeawaterNLVIASTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHIEGVDTFYYHRLLEEILEADPDLDCFLE
Ga0181584_1060879813300017949Salt MarshMENLVIEKQYTFNEDSCIRIKGNVEVDNVKHKFNLETDDYGAYVEGIDKQLLPQLIAVILEEDPDL
Ga0181577_1041358813300017951Salt MarshMKNLVIEKRYSFREDSCIRIAGTVENDNVKHNFDLKTDEMGFKYVEGIDKELVPQLVAILLEEDPDLDCYLED
Ga0181583_1027754553300017952Salt MarshTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDAQLLPQLVEAILEVDPDLDCFLE
Ga0181580_1043955433300017956Salt MarshMENLVIEKQYTFNEDSCIRIKGNVEVDNVKHKFNLETDDYGVYVEGIDKELLPQLIAVILEEDPDLDCFLEF
Ga0181580_1084969613300017956Salt MarshVKGTVEIDNVKHKFVVETDEGSLIFVAGVNDTLLPQLVKAILEVDPDLDCFLG
Ga0181571_1056195713300017957Salt MarshRTFNEDSCIRIKGTVEIDNIKHKFNLETDDYGAYVEGVEKKYLLQLIDAILEEDPDLDCFLEFQKEVISQWSDLD
Ga0181571_1072941813300017957Salt MarshRTFNEDSCIRIAGKVEIDNVTHNFKLETDELGFKYVEGIDKELVPQLVAMLLEDDPDLDCYLED
Ga0181581_1022838943300017962Salt MarshMENLVIEKQYTFNEDSCIRIKGNVEVDNVKHNFDLQTDDYGVYVDGIDKQLLSQLIAVILEEDPDLDCFLEF
Ga0181590_1044432433300017967Salt MarshMKNLVIKSTRTFNEDSCIRIKGNVEIGGIKHKFELETDDYSAHVDGISEHLWPQLIAAILEEDPDLDCFLEF
Ga0181590_1097504013300017967Salt MarshMNNLVITSTRTFMEDSCIRIKGTVEIDNVKHKFKLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD
Ga0181587_1102535013300017968Salt MarshDRKMKNLVIEKQYTFNEDSCIRIKGNVEVDNVKHNFDLQTDDYGVYVDGIDKELLSQLIAIILEEDPDLDCFLEF
Ga0181579_1038975313300018039Salt MarshMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDTQLLPQLVEAILEVDPDLDCFLE
Ga0181560_1045721013300018413Salt MarshMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDTQLLPQLVEAILEV
Ga0181592_1013730843300018421Salt MarshMKNLVIEKQYTFNEDSCIRIKGNVEVDNVKHNFDLQTDDYGVYVDGIDKELLSQLIAIILEEDPDLDCFLEF
Ga0181599_123827913300020178Salt MarshMKNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFLE
Ga0206131_1008913753300020185SeawaterMNNLVIESTRTFMEDSCIRIKGKVEIDNVKRKFAVETDEGGLIHIEGVDAQLLPQLVEAILEVDPDLDCFLE
Ga0211667_101930943300020282MarineMNNLVIKSTRTFMEDSCIRIKGTVEIDNVKHKFVLETDEGGLIHVEGVDTFYYHRLIEEILEVDPDLDCFLG
Ga0211649_103558723300020284MarineMNNLVIKSTRTFMEDSCIRIKGTVEIDNVKHKFVLETDEGGLIHVEGVDTFYYHRLIEEILEVDPDLDCFLD
Ga0211527_1000852363300020378MarineMNNLVIKSTRTFMEDSCIRVKGTVEIDNVKRKFAVETDEGGLVNVEGVDTQLLPQLVEEILEVDPDLDCFLG
Ga0211523_1002852813300020414MarineMNNLVIKSTRTFMEDSCIRVKGTVEIDNVKRKFTVETDEGGLVHIEGVDTQLLPQLVEEILEVDPDLDCFLG
Ga0213858_1037479623300021356SeawaterMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDAQLLPQLVEAILEVDPDLDCFLE
Ga0213859_1022939733300021364SeawaterMNNLVIEKQKTFNEDSCIRIKGTVEIDNVKHKFKLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD
Ga0206123_1021934233300021365SeawaterMKNLVITSTRTFNEDSCIRVKGKVEVNNVKHKFVVETDDYGPQVEGVDEQLLPQLIEAILEVDPDLDCFLY
Ga0212025_101158933300022057AqueousMKNLVIKKTRTFNEDSCIRIKGTVEIDNVKHKFKLETDDYGVYVDGIDKQLVPQLVEAILEVDPDLDCFLEF
Ga0212024_100767523300022065AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVKAILEVDPDLDCFLE
Ga0212021_101154713300022068AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVKAILEVDP
Ga0196899_101373823300022187AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE
Ga0196905_100783653300022198AqueousMKNLVIKGTRTFNGDSCIRIKGTVEIDNVKHKFKLETDDYGAYVEGIEKKYLLQLIDAILEEDPDLDCFLEFQREVIAQWSDLD
Ga0255773_1031020913300022925Salt MarshMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDTQLLPQLVEA
Ga0255752_1027024213300022929Salt MarshIRIKGKVEIDNVKHKFVVETDEGGLIHTEGVDAQLLPQLVEAILEVDPDLDCFLE
(restricted) Ga0233432_1001781593300023109SeawaterMNNLVITSTRTFNEDSCIRVKGKVEIDNVKHKFEVETDEGGLIRVGGVDTQLLSQLVEAILEVDPDLDCFLE
(restricted) Ga0233411_1007571613300023112SeawaterMNNLVITSTRTFNEDSCIRVKGKVEIDNVKHKFEVETDEGGLIRVGGVDTQLLSQLVEA
Ga0255772_1043774323300023176Salt MarshMNNLVITSTRTFNEDSCIRIKGTVEIDNVKHKFKLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD
Ga0255772_1053863913300023176Salt MarshMKNLVIEKQYTFNEDSCIRIKGNVEVDNVKHKFNLETDDYGVYVEGIDKELLPQLIAVILEEDPDLDCFLEF
(restricted) Ga0233412_1016112713300023210SeawaterMRYMNNLVITSTRTFLEDSCIRVKGKVEINNIKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE
(restricted) Ga0233412_1031742413300023210SeawaterMNNLVITSTRTFLEDSCIRIKGKVEINNIKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE
(restricted) Ga0233438_1009677753300024255SeawaterMNNLVITSTRTFNEDSCIRVKGKVEIDNVKHKFEVETDEGGLIRVGGVDTQLLPQLVEAILEVDPDLDCFLE
Ga0228651_102092753300024293SeawaterMNNLVIASTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHIEGVDTFYYHRLLEAILEVDPDLDCFLE
Ga0208667_102921413300025070MarineMNNLVIENTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGSLIHVDGVDTQLLPQLVKAILEVDPDLDCFLE
Ga0208157_101665153300025086MarineMNNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFEVETDEGDLVNVKGVDTQLLPQLVEAILEVDPDLDCFLG
Ga0208669_103190353300025099MarineMNNLVITSTRTFNEDSCIRIKGKVEIDNVKHKFELETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLD
Ga0208666_102743053300025102MarineMTNLVITSTRTFNEDSCIRIKGKVEIDNVKHKFELETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLD
Ga0208919_118566613300025128MarineMRYMNNLVITSTRTFMEDSCIRIKGKVEIDNAKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE
Ga0208919_122147613300025128MarineKIRDMNNLVITSTRTFNEDSCIRIKGKVEIDNVKHKFELETDEGSLIRVGGVDNQLLPQLVEAILEVDPDLDCFLD
Ga0209756_118890613300025141MarineRVKGKVEVNDVKHKFVVETDDYGAQVEGVDEQLLPQLIEAILEVDPDLDCFLY
Ga0209645_105882443300025151MarineMNNLVIKSTRTFMEDSCIRIKGTVEIDNVKRKFTVETDEGDLVNVKGVDTQLLPQLVEAILEVDPDLDCFLD
Ga0208148_104507543300025508AqueousMNNLVIESTRTFMEDSCIRVKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLMPQLVEAILEVDPDLDCFLE
Ga0208149_1012504103300025610AqueousMNNLVIESTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE
Ga0208161_104718613300025646AqueousMKNLVIKSTRTFNGDSCIRIKGTVEIDNVKHKFKLEADDYGAYVEGIEKKYLLQLIDAILEEDPDLDCFLEFQKEVIAQWSDLD
Ga0208162_106743823300025674AqueousMNNLVIEKQKTFNEDSCIRIKGTVEIDNVKHKFMLETDDYGAYVKGIEKKYLLQLIDAILEEDPDLDCFLDFQREVIAQWSDLD
Ga0208785_112073513300025815AqueousIESTRTFMEDSCIRIKGTVEIDNVKHKFVVETDEGSLIHIEGVNDTLLPQLVEAILEVDPDLDCFLE
Ga0208547_105607843300025828AqueousMKNLIIKKTRTFNEDSCIRIKGTVEIDNIKHKFNLETDDYGAYVEGVEKKYLLQLIDAILEEDP
Ga0208917_112829923300025840AqueousMKNLVIKKQRTFNEDSCIRIAGKVEIDNVKHNFKLETDDYGVYVDGIDKQLVPQLVEAILEVDPDLDCFLEF
Ga0208645_1011722153300025853AqueousMKNLVITSTRTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCF
Ga0209666_108463423300025870MarineMNNLVITSTRTFLEDSCIRVKGKVEINNIKHKFVVETDEGSLIHVEGVDTQLLPQLVEAILEVDPDLDCFLE
Ga0208644_1001763383300025889AqueousMENLVIEKQYTFNEDSCIRIKGTVEVDNVKHKFELETDDYGAYVDGIDKQLLPQLIAAILEEDPDLDCFLEF
Ga0228642_107676413300028131SeawaterMNNLIIESTRTFMEDSCIRIKGTVEIDNAKHKFVVETDEGSLIHIEGVDTFYYHRLLEAILEVDPDLDCFLE
Ga0315315_1037647913300032073SeawaterTFMEDSCIRIKGKVEIDNVKHKFVVETDEGGLIHIEGVDTFYYHRLLEAILEVDPDLDCFLE
Ga0316202_1001752123300032277Microbial MatMKNLVITSTRTFMEDSCIHIKGKVEIDNVKHKFVVETDEGGLIYPEGVDAQLLPQLVEAILEVDPDLDCFLG
Ga0348337_067867_1118_13123300034418AqueousYSFREDSCIRIAGTVENDNVKHNFDLKTDEMGFKYVEGIDKELVPQLVAILLEEDPDLDCYLED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.