| Basic Information | |
|---|---|
| Family ID | F071115 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 48 residues |
| Representative Sequence | LAVSAAVLLVTSYVGGGLAAGLITAFVACVFGLLWFAFPLARRR |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.00 % |
| % of genes near scaffold ends (potentially truncated) | 88.52 % |
| % of genes from short scaffolds (< 2000 bps) | 89.34 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.574 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.295 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.770 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.820 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF13466 | STAS_2 | 18.85 |
| PF01740 | STAS | 4.92 |
| PF03631 | Virul_fac_BrkB | 4.10 |
| PF00355 | Rieske | 3.28 |
| PF00881 | Nitroreductase | 3.28 |
| PF01068 | DNA_ligase_A_M | 2.46 |
| PF00723 | Glyco_hydro_15 | 1.64 |
| PF13185 | GAF_2 | 1.64 |
| PF12277 | DUF3618 | 1.64 |
| PF13378 | MR_MLE_C | 1.64 |
| PF00171 | Aldedh | 1.64 |
| PF01904 | DUF72 | 1.64 |
| PF07859 | Abhydrolase_3 | 1.64 |
| PF02775 | TPP_enzyme_C | 1.64 |
| PF04261 | Dyp_perox | 1.64 |
| PF07228 | SpoIIE | 1.64 |
| PF03320 | FBPase_glpX | 1.64 |
| PF02585 | PIG-L | 1.64 |
| PF11239 | DUF3040 | 0.82 |
| PF07332 | Phage_holin_3_6 | 0.82 |
| PF01590 | GAF | 0.82 |
| PF00248 | Aldo_ket_red | 0.82 |
| PF03965 | Penicillinase_R | 0.82 |
| PF00296 | Bac_luciferase | 0.82 |
| PF04672 | Methyltransf_19 | 0.82 |
| PF13751 | DDE_Tnp_1_6 | 0.82 |
| PF04679 | DNA_ligase_A_C | 0.82 |
| PF00487 | FA_desaturase | 0.82 |
| PF08386 | Abhydrolase_4 | 0.82 |
| PF07311 | Dodecin | 0.82 |
| PF13193 | AMP-binding_C | 0.82 |
| PF13377 | Peripla_BP_3 | 0.82 |
| PF02826 | 2-Hacid_dh_C | 0.82 |
| PF00230 | MIP | 0.82 |
| PF05199 | GMC_oxred_C | 0.82 |
| PF00270 | DEAD | 0.82 |
| PF11253 | DUF3052 | 0.82 |
| PF12833 | HTH_18 | 0.82 |
| PF00440 | TetR_N | 0.82 |
| PF12802 | MarR_2 | 0.82 |
| PF00456 | Transketolase_N | 0.82 |
| PF00196 | GerE | 0.82 |
| PF06441 | EHN | 0.82 |
| PF00501 | AMP-binding | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 4.10 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 3.28 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.46 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.64 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.64 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.64 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 1.64 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.64 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.64 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 1.64 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.64 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.64 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.82 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.82 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.82 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.82 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.82 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.82 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.82 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.82 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.57 % |
| Unclassified | root | N/A | 34.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig15290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 831 | Open in IMG/M |
| 2189573004|GZGWRS402HCH4A | Not Available | 507 | Open in IMG/M |
| 3300005178|Ga0066688_10758646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300005330|Ga0070690_100620481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300005434|Ga0070709_11704227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300005436|Ga0070713_100669307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 989 | Open in IMG/M |
| 3300005530|Ga0070679_101671002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300005537|Ga0070730_10861916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300005578|Ga0068854_102029684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300005610|Ga0070763_10065741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1761 | Open in IMG/M |
| 3300005614|Ga0068856_101101317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
| 3300006028|Ga0070717_10174579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1870 | Open in IMG/M |
| 3300006028|Ga0070717_11541918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300006028|Ga0070717_12015175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300006059|Ga0075017_100587816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300006755|Ga0079222_10098221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1530 | Open in IMG/M |
| 3300006796|Ga0066665_11013213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300006804|Ga0079221_10250667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1006 | Open in IMG/M |
| 3300006854|Ga0075425_101598876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300006893|Ga0073928_10644632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300006954|Ga0079219_10737184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300009148|Ga0105243_10784407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 937 | Open in IMG/M |
| 3300009176|Ga0105242_12130066 | Not Available | 605 | Open in IMG/M |
| 3300009700|Ga0116217_10933612 | Not Available | 532 | Open in IMG/M |
| 3300010329|Ga0134111_10464273 | Not Available | 551 | Open in IMG/M |
| 3300010373|Ga0134128_12734219 | Not Available | 544 | Open in IMG/M |
| 3300010379|Ga0136449_100934306 | Not Available | 1407 | Open in IMG/M |
| 3300010379|Ga0136449_101210004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1189 | Open in IMG/M |
| 3300010379|Ga0136449_103375220 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010396|Ga0134126_10282654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1953 | Open in IMG/M |
| 3300010397|Ga0134124_11332361 | Not Available | 742 | Open in IMG/M |
| 3300010861|Ga0126349_1205708 | Not Available | 989 | Open in IMG/M |
| 3300010876|Ga0126361_10092463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300010880|Ga0126350_10332046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 612 | Open in IMG/M |
| 3300010880|Ga0126350_11199290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300010880|Ga0126350_11290656 | Not Available | 983 | Open in IMG/M |
| 3300012189|Ga0137388_10607484 | Not Available | 1017 | Open in IMG/M |
| 3300012199|Ga0137383_10002363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11523 | Open in IMG/M |
| 3300012285|Ga0137370_10674959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300012361|Ga0137360_11626871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 551 | Open in IMG/M |
| 3300012363|Ga0137390_10750213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 936 | Open in IMG/M |
| 3300012944|Ga0137410_10970177 | Not Available | 722 | Open in IMG/M |
| 3300012955|Ga0164298_10046796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2054 | Open in IMG/M |
| 3300012961|Ga0164302_10084359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1704 | Open in IMG/M |
| 3300012971|Ga0126369_13180815 | Not Available | 538 | Open in IMG/M |
| 3300013104|Ga0157370_10791927 | Not Available | 863 | Open in IMG/M |
| 3300013307|Ga0157372_13308196 | Not Available | 513 | Open in IMG/M |
| 3300015356|Ga0134073_10335348 | Not Available | 551 | Open in IMG/M |
| 3300015371|Ga0132258_10680730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2588 | Open in IMG/M |
| 3300017657|Ga0134074_1270072 | Not Available | 615 | Open in IMG/M |
| 3300017928|Ga0187806_1147070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300017933|Ga0187801_10152668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
| 3300017942|Ga0187808_10044188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1873 | Open in IMG/M |
| 3300017946|Ga0187879_10304869 | Not Available | 885 | Open in IMG/M |
| 3300017959|Ga0187779_10579799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300017974|Ga0187777_10437635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300018046|Ga0187851_10857433 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300019887|Ga0193729_1199381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300020581|Ga0210399_10177661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300021171|Ga0210405_11440497 | Not Available | 500 | Open in IMG/M |
| 3300021180|Ga0210396_10293818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300021374|Ga0213881_10061893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1593 | Open in IMG/M |
| 3300021402|Ga0210385_10918132 | Not Available | 672 | Open in IMG/M |
| 3300021403|Ga0210397_10681551 | Not Available | 789 | Open in IMG/M |
| 3300021403|Ga0210397_10933995 | Not Available | 672 | Open in IMG/M |
| 3300021407|Ga0210383_10812670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300021420|Ga0210394_11197108 | Not Available | 652 | Open in IMG/M |
| 3300021433|Ga0210391_10608572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300021477|Ga0210398_10432826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
| 3300021478|Ga0210402_10378118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
| 3300021560|Ga0126371_13533216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300024225|Ga0224572_1039189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| 3300024288|Ga0179589_10436864 | Not Available | 603 | Open in IMG/M |
| 3300025906|Ga0207699_11483237 | Not Available | 502 | Open in IMG/M |
| 3300025937|Ga0207669_10298767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
| 3300026557|Ga0179587_10877920 | Not Available | 591 | Open in IMG/M |
| 3300027575|Ga0209525_1041260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1132 | Open in IMG/M |
| 3300027692|Ga0209530_1194571 | Not Available | 560 | Open in IMG/M |
| 3300027812|Ga0209656_10518933 | Not Available | 519 | Open in IMG/M |
| 3300027855|Ga0209693_10377267 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027869|Ga0209579_10471296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300027879|Ga0209169_10488492 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300027905|Ga0209415_10060033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4696 | Open in IMG/M |
| 3300027905|Ga0209415_10218701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300028072|Ga0247675_1008236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300028787|Ga0307323_10040980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1624 | Open in IMG/M |
| 3300028789|Ga0302232_10236526 | Not Available | 906 | Open in IMG/M |
| 3300028881|Ga0307277_10462505 | Not Available | 569 | Open in IMG/M |
| 3300029951|Ga0311371_10367580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1979 | Open in IMG/M |
| 3300029993|Ga0302304_10341798 | Not Available | 545 | Open in IMG/M |
| 3300029999|Ga0311339_10821272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
| 3300030494|Ga0310037_10191413 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300030580|Ga0311355_10250098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1814 | Open in IMG/M |
| 3300030617|Ga0311356_10179870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
| 3300031234|Ga0302325_12141072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 683 | Open in IMG/M |
| 3300031241|Ga0265325_10259489 | Not Available | 785 | Open in IMG/M |
| 3300031708|Ga0310686_104724743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-5024 | 4291 | Open in IMG/M |
| 3300031708|Ga0310686_111849231 | Not Available | 708 | Open in IMG/M |
| 3300031708|Ga0310686_113476613 | Not Available | 534 | Open in IMG/M |
| 3300031715|Ga0307476_11125993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 576 | Open in IMG/M |
| 3300031718|Ga0307474_10825716 | Not Available | 733 | Open in IMG/M |
| 3300031793|Ga0318548_10658944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300031954|Ga0306926_11266608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora takensis | 863 | Open in IMG/M |
| 3300032067|Ga0318524_10783013 | Not Available | 504 | Open in IMG/M |
| 3300032089|Ga0318525_10265607 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300032160|Ga0311301_11425722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300032770|Ga0335085_10048801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5741 | Open in IMG/M |
| 3300032770|Ga0335085_12372966 | Not Available | 529 | Open in IMG/M |
| 3300032782|Ga0335082_10017624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7724 | Open in IMG/M |
| 3300032783|Ga0335079_10613086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1147 | Open in IMG/M |
| 3300032805|Ga0335078_12257474 | Not Available | 571 | Open in IMG/M |
| 3300032829|Ga0335070_10778049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 891 | Open in IMG/M |
| 3300032895|Ga0335074_10002974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 23070 | Open in IMG/M |
| 3300032898|Ga0335072_10002061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 31724 | Open in IMG/M |
| 3300032955|Ga0335076_10528003 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300033134|Ga0335073_10950392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 897 | Open in IMG/M |
| 3300033134|Ga0335073_11058486 | Not Available | 832 | Open in IMG/M |
| 3300033158|Ga0335077_10175388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2433 | Open in IMG/M |
| 3300033158|Ga0335077_11686610 | Not Available | 600 | Open in IMG/M |
| 3300034065|Ga0334827_229885 | Not Available | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 4.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.82% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00063290 | 2166559006 | Grass Soil | LLVTGYVSSGLTAGLITAFVTLLFAGLWFALPLARRR |
| FG2_08144120 | 2189573004 | Grass Soil | MAITGLITVGLAVSAAVLLVTGYVTSALPAALITAFVTSVFGLLWFAFPLTRRR |
| Ga0066688_107586461 | 3300005178 | Soil | AVSAGVLLVTGYVSSGLTAGLITAFVTSVFAGLWFAFPLAHRR* |
| Ga0070690_1006204811 | 3300005330 | Switchgrass Rhizosphere | AAVGLAVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR* |
| Ga0070709_117042271 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LATVGLAVSAAVLLVTDYVSSGLTAGLITAFVTIMFAGLWFAFPLAHRR* |
| Ga0070713_1006693071 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVSAAVLLVTGYVTSTLPAALITAFVTGVFGLLWFALPLARRH* |
| Ga0070679_1016710021 | 3300005530 | Corn Rhizosphere | VGLAVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARHR* |
| Ga0070730_108619162 | 3300005537 | Surface Soil | LAVSAAVLLVTGFVASGVTAAVITVLVFMLFGLLWFAFPLTRRRRTPGG* |
| Ga0068854_1020296841 | 3300005578 | Corn Rhizosphere | LVTDFVSSGLTAGLITAFVTCLFAGLWFALPLAHRR* |
| Ga0070763_100657411 | 3300005610 | Soil | LAVSAAVLLVTSYVGGGLAAGLITAFVACVFGLLWFAFPLARRR* |
| Ga0068856_1011013171 | 3300005614 | Corn Rhizosphere | LATVGLAVSSAVLLVTGFVASGLSAIVITVLVVLMFGLLWFAFPLAHRRS* |
| Ga0070717_101745791 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GLATVGLAVSAAVLLVTDYVASGLTAGLITAFVTCLFAGLWFALPLAHRR* |
| Ga0070717_115419181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIAGLAAVGLAVSAAVLLVTSFVASGLATILVSAFVFLLLGVLWFAFPLARRRERR* |
| Ga0070717_120151751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AVGLAVSAAVLLVLSYVEKGLPAVLITAFIVCLFAGLWFALPLARRRRYRS* |
| Ga0075017_1005878161 | 3300006059 | Watersheds | VGLAVSAAVLLVTSYVTSALAAGLITVFVTCMFGMLWFAFPLARRR* |
| Ga0079222_100982211 | 3300006755 | Agricultural Soil | IGGLVAVALAVSAAILLVTGYVDHGLPSVLITAFTVCLFAGLWFALPLARREKEKR* |
| Ga0066665_110132132 | 3300006796 | Soil | SAAVLLVTEYVSSGLTAGLITAFVTIVFAGLWFAFPLAHRR* |
| Ga0079221_102506673 | 3300006804 | Agricultural Soil | VGLAVSSAVLLVTGFVASGLPAIVLTVLVVLMFGLLWFALPLAHRRS* |
| Ga0075425_1015988761 | 3300006854 | Populus Rhizosphere | GLATVGLAVSAAILLVTDFVSSGLTAGLITAFVACLFAGLWFALPLAHRR* |
| Ga0073928_106446322 | 3300006893 | Iron-Sulfur Acid Spring | VSAAVLLVTSYVGGGLAAGLISAFVAVMFGVLWFAFPLTRRR* |
| Ga0079219_107371842 | 3300006954 | Agricultural Soil | AILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR* |
| Ga0105243_107844073 | 3300009148 | Miscanthus Rhizosphere | AVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR* |
| Ga0105242_121300661 | 3300009176 | Miscanthus Rhizosphere | AGLAAVGLAVSAAILLVTDYVSSGLTAALITAFVTVLFAGLWFALPLARRR* |
| Ga0116217_109336121 | 3300009700 | Peatlands Soil | RAASVMAIGGLAAVGLAVSAAVLLVTSYVGGGLAAGLIPAFVACLSGLLSFVCRLVNGH* |
| Ga0123357_107745902 | 3300009784 | Termite Gut | RQQKENLVRAANMMAIAGLGTVGLAVSASILLVTSYVANGLAGGLITAFVAALFAALWFAFPLIRRR* |
| Ga0134111_104642731 | 3300010329 | Grasslands Soil | TVGLAVSAAILLVTDFVSSGLTAGLITAFVTCLFAGLWFVLPLTRRR* |
| Ga0134128_127342191 | 3300010373 | Terrestrial Soil | LAVSAAVLLVTWFVAGGLVGILIAVLVVLMFGLLWFAFPLMNRRR* |
| Ga0136449_1009343061 | 3300010379 | Peatlands Soil | MIQAVAAVGLAVSAAVLLVTSYVGGGLAAGLITAFVACLFGLLWFVFPLAGRH* |
| Ga0136449_1012100042 | 3300010379 | Peatlands Soil | VLLVTSYVAGRLAAGLITAFVAGLLAVVWFAFPLARRR* |
| Ga0136449_1033752201 | 3300010379 | Peatlands Soil | AVSAAVLLVTGFVASGLPAVLITVFVVCTFGILWFAFPLARRR* |
| Ga0134126_102826544 | 3300010396 | Terrestrial Soil | LAAVGLAVSAAILLVTDFVSSGLTAGLITAFVTCLFAGLWFALPLAHRR* |
| Ga0134124_113323611 | 3300010397 | Terrestrial Soil | GLATVGLAVSAAVLLVTGFVASGLPAILITVLVVLMFGLLWFAFPLVHRRR* |
| Ga0126349_12057081 | 3300010861 | Boreal Forest Soil | TVGLAVSAAVLLVTDYVSSGLTAGLITAFVTCMFAGLWFVFPLARRR* |
| Ga0126361_100924632 | 3300010876 | Boreal Forest Soil | SAAVLLVTSYVGGGLAAGLISAFVAVMFGLLWFAFPLTRR* |
| Ga0126350_103320462 | 3300010880 | Boreal Forest Soil | SAAVLLVTSYVAGPLTAALITALIFCSFAGLWFAFPLARRR* |
| Ga0126350_111992902 | 3300010880 | Boreal Forest Soil | ASVMAIAGLVTVALAVSAAVLLVTSFVTRGPAAVLISVLVACVFGLLWFAYPLTRR* |
| Ga0126350_112906561 | 3300010880 | Boreal Forest Soil | LVTVGLAVSAAVLLVTSFVVSALPAALITAFTACTFTLLWFAFPLARRS* |
| Ga0137388_106074843 | 3300012189 | Vadose Zone Soil | LAVSAAVLLVTSYVAKGWPAVLISAFVVCVFGGLWFAFPLVRREG* |
| Ga0137383_1000236313 | 3300012199 | Vadose Zone Soil | MAVAGLAAVGLAVSAAVLLVTGYVTSVLPAGLITAFVTCMFGMLWVAFPLARSR* |
| Ga0137370_106749592 | 3300012285 | Vadose Zone Soil | CGLVAVGLAISAAVLLVTGYVDHGLPSVLITVFTVCLFAGLWFALPLARREKEKR* |
| Ga0137360_116268712 | 3300012361 | Vadose Zone Soil | GGLAAVGLAISAAVLLVTGYVDRGVPAILITVGTVAVFGGLWFALPLAHRRQPDE* |
| Ga0137390_107502131 | 3300012363 | Vadose Zone Soil | GLAVSAAVLLVTGYVASGLAAALITAFVFGMFGGLWFAFPLARRH* |
| Ga0137410_109701771 | 3300012944 | Vadose Zone Soil | AIAGLATVGLAVSAAILLVTDFVSSGLTAGLITAFVACLFAGLWFALPLAHRR* |
| Ga0164298_100467961 | 3300012955 | Soil | TDYVSSGLTAALITAFVTLLFAGLWFALPLARRR* |
| Ga0164302_100843593 | 3300012961 | Soil | VSADIWVVTDYVSSGLTAALLTAFVTLLFAGLWFALPLARRR* |
| Ga0126369_131808152 | 3300012971 | Tropical Forest Soil | LAVSAAVLLVTGYVTSAVPAALITAFVTCMFGLLWFAFPLARRR* |
| Ga0157370_107919272 | 3300013104 | Corn Rhizosphere | VGLAVSAAILLVTDFVSSGLTAGLITAFVTCLFAGLWFALPLAHRR* |
| Ga0157372_133081961 | 3300013307 | Corn Rhizosphere | AVGLAVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR* |
| Ga0134073_103353481 | 3300015356 | Grasslands Soil | VSAAILLVTDYVSSGLTAALITTFVTVLFAGLWFALPLARRR* |
| Ga0132258_106807305 | 3300015371 | Arabidopsis Rhizosphere | LAVSAAILLVTDYVSSGLTAALITAFVTVLFAGLWFALPLARRR* |
| Ga0134074_12700722 | 3300017657 | Grasslands Soil | YVSSGLTAALITAFVTCLFAGLWFVLPLTRRRLDIWR |
| Ga0187806_11470702 | 3300017928 | Freshwater Sediment | MDLRAVGGLAAAGLAVSAAVLLVTSHVGGGLAAGLITAFVACLFGLLWFVFPLARRR |
| Ga0187801_101526682 | 3300017933 | Freshwater Sediment | VGLAAVGLAVSAAVLLVTSYVGGGLAAGLITASIACLFGLLWFAFPLARRH |
| Ga0187808_100441881 | 3300017942 | Freshwater Sediment | GLAVSAAVLLVTGYVGGGLAAGVITAFVAGLFGLLWFVFPLARRR |
| Ga0187879_103048692 | 3300017946 | Peatland | AVSVAVLLVASFVTSSTAAGLITALIACMFGLLWFAFPLTRR |
| Ga0187779_105797992 | 3300017959 | Tropical Peatland | VTSYVADGLPAVLITASVTGAFTLLWFAFPLTRRR |
| Ga0187777_104376351 | 3300017974 | Tropical Peatland | LRVAGLVVVGLAVSAAVRLVTGYVASVVPAILITVFVACAFGLLWFAFPLARRR |
| Ga0187851_108574331 | 3300018046 | Peatland | VIAIAGLLTVGLAVSAAVLLVASFVVGGLAAGLITALGACMFGLLWFAFPLTRH |
| Ga0193729_11993812 | 3300019887 | Soil | AAVLLVTGYVDRGVPAILITVGTVAVFGGLWFALPLAHRRQPDE |
| Ga0210399_101776613 | 3300020581 | Soil | SASVMAILGLACVGLAVSAAVLLVTGYVASGFAAALITTFIFCVFAVLWFAYPLARRR |
| Ga0210405_114404972 | 3300021171 | Soil | AVSAAVLLVTGYVTSTLPAVLITVFVTSMFGLLWFAFPLAQRH |
| Ga0210396_102938181 | 3300021180 | Soil | VLLVTSYVGGGLAAGLITAFVACVFGLLWFAFPLARRR |
| Ga0213881_100618931 | 3300021374 | Exposed Rock | AVLLVTGYVASGVPAIVITVFVACTFGLLWFAFPLARRR |
| Ga0210385_109181322 | 3300021402 | Soil | LAVSAAVLLVTGYVTSTLPAVLITVFVTCMFGLLWFAFPLAHRH |
| Ga0210397_106815512 | 3300021403 | Soil | NVMAVAGLAAVGLAVSAAVLLVTGYVTSALPAALITAFVTCMFGLLWFAFPLAHRR |
| Ga0210397_109339951 | 3300021403 | Soil | RLVRAANVMAIAGLAAVGLAVSAAVLLVTGYVTSTLPAVLITVFVTCMFGLLWFAFPLAHRH |
| Ga0210383_108126701 | 3300021407 | Soil | AVALAVSAAVLLVTSYVGGGLAAGLITAFVACLFGLLWFVFPLARRR |
| Ga0210394_111971081 | 3300021420 | Soil | LLVTGYVTSTLPAALITAFVTGVFGLLWFALPLTRRR |
| Ga0210391_106085721 | 3300021433 | Soil | LAAVGLAVSAAVLLVTGYVTSTLPAVLITVFVTCMFGLLWFAFPLAHRH |
| Ga0210398_104328261 | 3300021477 | Soil | AAVLLVTGYVTSTLPAVLITVFVTCMFGLLWFAFPLAYRR |
| Ga0210402_103781182 | 3300021478 | Soil | QKESLVRSASVMAILGLACVGLAVSAAVLLVTGYVASGFAAALITTFIFCVFAVLWFAYPLARRR |
| Ga0126371_135332161 | 3300021560 | Tropical Forest Soil | TANIMAICGLVAVGLAISAAVLLVTGYVDHALPSVLITAFTVCLFAGLWFALPLARREKR |
| Ga0224572_10391893 | 3300024225 | Rhizosphere | VLLVASFVTGGLAAGLITAPIACMLGLLWFAFPLTRC |
| Ga0179589_104368643 | 3300024288 | Vadose Zone Soil | ILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR |
| Ga0207699_114832371 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIAGLATVGLAVSAAVLLVTDYVSSGLTAGLITAFVTIMFAGLWFAFPLAHRR |
| Ga0207669_102987673 | 3300025937 | Miscanthus Rhizosphere | LVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR |
| Ga0179587_108779202 | 3300026557 | Vadose Zone Soil | GLATVGLAVSAAVLLVTDFVSSGLTAGLITAFVTCLFAGLWFALPLAQRR |
| Ga0209525_10412601 | 3300027575 | Forest Soil | AAVLLVTSYVGGGLAAGLITGFVAILFGLLWFAFPLTRRR |
| Ga0209530_11945711 | 3300027692 | Forest Soil | LAVSAAVLLVTSYVASGLAAALITAFVVVTFGTLWFAFPLARRS |
| Ga0209656_105189331 | 3300027812 | Bog Forest Soil | AAVLLVTSYVAGPVTAALTTAFVFCAFAGLWFAFPLTRRR |
| Ga0209693_103772671 | 3300027855 | Soil | SAMAIAGLVTVGLAVSAAVLLVASFVTGGLAAGLITALIACMFGLLWFAFPLTRR |
| Ga0209579_104712962 | 3300027869 | Surface Soil | AIIGLAAVGLAVSAAVLLVTSYVGGGLAAGLITAFVACLFGLLWFAFPLARRH |
| Ga0209169_104884922 | 3300027879 | Soil | AVSAAVLLVASFVTGGLAAGLITALVACMFGLLWFAFPLTRR |
| Ga0209415_100600336 | 3300027905 | Peatlands Soil | GLAVSAAVLLVTSYVGGGLAAGLITAFVACLFGLLWFAFPLVRRH |
| Ga0209415_102187015 | 3300027905 | Peatlands Soil | GLAVSAAVLLVTSYVGGGLAAGLITAFVACLFGLLWFAFPLARRH |
| Ga0247675_10082363 | 3300028072 | Soil | AAVGLAVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR |
| Ga0265336_100250321 | 3300028666 | Rhizosphere | KERLVRAANVMAILGLAAVGLAVSSAVLLVTSYVARGWPAALITAFVACLYAVLWFAFPLGHREE |
| Ga0307323_100409801 | 3300028787 | Soil | GLAVSAAILLVTDYVSSGLTAALITAFVTLLFAGLWFALPLARRR |
| Ga0302232_102365261 | 3300028789 | Palsa | AAVGLAVSAAVLLVTSYVASGLAAALITAFVVATFGTLWFAFPLARRS |
| Ga0307277_104625052 | 3300028881 | Soil | VGLAVSAAILLVTDYVSSGLTAALITAFVTALFAGLWFALPLARRR |
| Ga0311371_103675803 | 3300029951 | Palsa | LLSLPFTNRVDKLSPAQRDLYLASLVLAAVGLAVSAAVLLVTSYVASGLAAALITAFVVVTFGTLWFAFPLARRS |
| Ga0302304_103417981 | 3300029993 | Palsa | AVGLAVSAAVLLVTSYVASGLAAALITAFVVATFGTLWFAFPLARRS |
| Ga0311339_108212722 | 3300029999 | Palsa | LLVASFVASGLAAGLITALIACMFGLLWFAFPLTRR |
| Ga0310037_101914131 | 3300030494 | Peatlands Soil | GLAVSAAVLLVTSYVTSALQAGLITAFVTCMFGMLWFAFPLARRR |
| Ga0311355_102500983 | 3300030580 | Palsa | VSAAVLLVASFVTGGLAAGLITALIALMFGLLWFAFPLTRR |
| Ga0311356_101798703 | 3300030617 | Palsa | AHRDLYLASLVLAAVGLAVSAAVLLVTSYVASGLAAALITAFVVVTFGTLWFAFPLARRS |
| Ga0302325_121410722 | 3300031234 | Palsa | TALLVGPVGGLAAVGLAVSAAVLLVTGFVASGLTAAVITVFTFCVFGIVWFAFPLTRRH |
| Ga0265325_102594893 | 3300031241 | Rhizosphere | AILGLAAVGLAVSAAVLLVTSYVARGWPAALITAFVACLYAVLWFAFPLGHREE |
| Ga0310686_1047247431 | 3300031708 | Soil | ASVMAIAGLVTVGLAVSAAVLLVASFVTGGLAAGLITALIACMFGLLWFAFPLTRR |
| Ga0310686_1118492313 | 3300031708 | Soil | AIAGLAAVGLAVSTAVLLVTSYVASGLAAGLITAFVAGLFAVVWFAFPLTRRR |
| Ga0310686_1134766132 | 3300031708 | Soil | RLVRAANVMALLGLAATGLAVSAAVLLVTSYVVRGVPAIVISACVVCLFGSLWFAFPLARRGE |
| Ga0307476_111259931 | 3300031715 | Hardwood Forest Soil | AAVLLVTSYVGGGLAAGLITAFVACVFGLLWFAFPLARRR |
| Ga0307474_108257162 | 3300031718 | Hardwood Forest Soil | AAVALAVSAAVLLVTSYVGGDLAAGLITAFVACLFGLLWFAFPLARRR |
| Ga0318548_106589441 | 3300031793 | Soil | AVLLVTGYVTSALPAALITAFVTGVFGLLWFALPLARRR |
| Ga0306926_112666082 | 3300031954 | Soil | VGLAVSAAVLLVLSYVVKGLPAVIITVCVACLFAGLWFGLPLARRRRYSS |
| Ga0318524_107830131 | 3300032067 | Soil | ERLVRAASVMAVAGLVTVGLAVSASVLLVTGYVASGVPAILITVLVACAFGLLWFAFPLA |
| Ga0318525_102656071 | 3300032089 | Soil | LAVSAAVLLVTSYVGGGLAAGLITAFVAGLFGLLWFVFPLARRR |
| Ga0311301_114257221 | 3300032160 | Peatlands Soil | AIAGLATVGLAVSAAVLLVTSYVAGRLAAGLITAFVAGLLAVVWFAFPLARRR |
| Ga0335085_100488014 | 3300032770 | Soil | MAIGGLITAGLAVSAAVLLVTGYVTSTLPAALITAFITGVFGLLWFALPLARRR |
| Ga0335085_123729661 | 3300032770 | Soil | VRAASVMAISGLATVGLAVSAAVLLVTGFVASPLPAALITAFVTCMFGALWFAFPLARR |
| Ga0335082_100176247 | 3300032782 | Soil | VVGLAVSAAVLLVTGYVTSALPAALITAFVTCVFTGLWFELPLTRRR |
| Ga0335079_106130865 | 3300032783 | Soil | SVMAISGLATVGLAVSAAVLLVTGFVASPLPAALITAFVTCMFGALWFAFPLTRRR |
| Ga0335078_122574742 | 3300032805 | Soil | AVLLVTGFVASGLTAVLISVFVVCVFGILWFAFPLTRRR |
| Ga0335070_107780492 | 3300032829 | Soil | GQAVSAAVLLVTWIVAGGLAGILITVFVVLMFGLLWFALPLMDRRR |
| Ga0335074_100029741 | 3300032895 | Soil | DLLVTGFVASAVPAALITAFVAGTFGLLWFASPSARRC |
| Ga0335072_1000206112 | 3300032898 | Soil | VTGFVASAVPAALITAFVAGTFGLLWFASPSARRC |
| Ga0335076_105280032 | 3300032955 | Soil | SASILLVTSYVAGGLAGGLVTAFVAGMFALLWFAFPLARRR |
| Ga0335073_109503922 | 3300033134 | Soil | SVMAISGLAVVGLDISVAVLLVTGFVASGLTAVLISVFVVCVFGILWFAFPLTRRR |
| Ga0335073_110584861 | 3300033134 | Soil | GLAAVGLAVSAAVLLVTGYVTSAVPAALITAFVTCMFGLLWFALPLARRR |
| Ga0335077_101753881 | 3300033158 | Soil | VLLVTGYVTSVVPAALITAFVTCMFGMLWFAFPLARR |
| Ga0335077_116866102 | 3300033158 | Soil | LVVVGLAVSFAVLLVTSFVAGGLVAGLITALVACMFATLWFAFPLARRR |
| Ga0334827_229885_15_161 | 3300034065 | Soil | LVTVGLAVSVAVLLVASFVTSGLAAGLITALIACMFGLLWFAFPLTRR |
| ⦗Top⦘ |