| Basic Information | |
|---|---|
| Family ID | F071022 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GYNWDLQLGASLAGVSDIYTLGVRTVSGATTGDGVGSISFYDLTQ |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 98.36 % |
| % of genes from short scaffolds (< 2000 bps) | 77.87 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.754 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (21.311 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.869 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (40.164 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.92% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 1.64 |
| PF00271 | Helicase_C | 1.64 |
| PF00534 | Glycos_transf_1 | 1.64 |
| PF13245 | AAA_19 | 0.82 |
| PF13946 | DUF4214 | 0.82 |
| PF13578 | Methyltransf_24 | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF06048 | DUF927 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.75 % |
| All Organisms | root | All Organisms | 35.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10139815 | Not Available | 600 | Open in IMG/M |
| 3300002092|JGI24218J26658_1005584 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300002835|B570J40625_100168028 | Not Available | 2455 | Open in IMG/M |
| 3300004240|Ga0007787_10088487 | Not Available | 1434 | Open in IMG/M |
| 3300004481|Ga0069718_15687969 | Not Available | 508 | Open in IMG/M |
| 3300005527|Ga0068876_10216373 | Not Available | 1107 | Open in IMG/M |
| 3300005527|Ga0068876_10561327 | Not Available | 622 | Open in IMG/M |
| 3300005584|Ga0049082_10294814 | Not Available | 542 | Open in IMG/M |
| 3300006030|Ga0075470_10209272 | Not Available | 557 | Open in IMG/M |
| 3300006802|Ga0070749_10099657 | Not Available | 1718 | Open in IMG/M |
| 3300006802|Ga0070749_10197154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1155 | Open in IMG/M |
| 3300006802|Ga0070749_10340379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300006802|Ga0070749_10386193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300006805|Ga0075464_10756191 | Not Available | 603 | Open in IMG/M |
| 3300006875|Ga0075473_10053028 | Not Available | 1571 | Open in IMG/M |
| 3300006875|Ga0075473_10149148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 939 | Open in IMG/M |
| 3300006875|Ga0075473_10283904 | Not Available | 670 | Open in IMG/M |
| 3300007177|Ga0102978_1053056 | Not Available | 8222 | Open in IMG/M |
| 3300007276|Ga0070747_1324557 | Not Available | 527 | Open in IMG/M |
| 3300007541|Ga0099848_1275658 | Not Available | 582 | Open in IMG/M |
| 3300008055|Ga0108970_10893020 | Not Available | 512 | Open in IMG/M |
| 3300008107|Ga0114340_1002929 | Not Available | 14644 | Open in IMG/M |
| 3300008110|Ga0114343_1000851 | Not Available | 19694 | Open in IMG/M |
| 3300008110|Ga0114343_1010397 | Not Available | 12019 | Open in IMG/M |
| 3300008110|Ga0114343_1199009 | Not Available | 581 | Open in IMG/M |
| 3300008116|Ga0114350_1065051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
| 3300008116|Ga0114350_1088841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300008116|Ga0114350_1136578 | Not Available | 710 | Open in IMG/M |
| 3300008120|Ga0114355_1006841 | Not Available | 16172 | Open in IMG/M |
| 3300008259|Ga0114841_1003794 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 9837 | Open in IMG/M |
| 3300008266|Ga0114363_1050735 | Not Available | 1652 | Open in IMG/M |
| 3300008266|Ga0114363_1073994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
| 3300008266|Ga0114363_1138274 | Not Available | 823 | Open in IMG/M |
| 3300008266|Ga0114363_1194267 | Not Available | 630 | Open in IMG/M |
| 3300008266|Ga0114363_1217241 | Not Available | 570 | Open in IMG/M |
| 3300008267|Ga0114364_1166847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300008448|Ga0114876_1200824 | Not Available | 673 | Open in IMG/M |
| 3300009111|Ga0115026_11302448 | Not Available | 596 | Open in IMG/M |
| 3300009183|Ga0114974_10599264 | Not Available | 608 | Open in IMG/M |
| 3300010354|Ga0129333_10073678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3171 | Open in IMG/M |
| 3300010354|Ga0129333_10144883 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300010354|Ga0129333_10358414 | Not Available | 1296 | Open in IMG/M |
| 3300010354|Ga0129333_11285667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300010354|Ga0129333_11375563 | Not Available | 581 | Open in IMG/M |
| 3300010354|Ga0129333_11491306 | Not Available | 554 | Open in IMG/M |
| 3300010354|Ga0129333_11722467 | Not Available | 509 | Open in IMG/M |
| 3300010370|Ga0129336_10129464 | Not Available | 1467 | Open in IMG/M |
| 3300010370|Ga0129336_10275223 | Not Available | 941 | Open in IMG/M |
| 3300010370|Ga0129336_10406993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300010370|Ga0129336_10648735 | Not Available | 561 | Open in IMG/M |
| 3300010370|Ga0129336_10693327 | Not Available | 539 | Open in IMG/M |
| 3300010885|Ga0133913_10256282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4644 | Open in IMG/M |
| 3300011984|Ga0119931_1043958 | Not Available | 541 | Open in IMG/M |
| 3300014811|Ga0119960_1050895 | Not Available | 685 | Open in IMG/M |
| 3300017716|Ga0181350_1140697 | Not Available | 568 | Open in IMG/M |
| 3300017747|Ga0181352_1048175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1245 | Open in IMG/M |
| 3300017747|Ga0181352_1049635 | Not Available | 1223 | Open in IMG/M |
| 3300017747|Ga0181352_1111141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300017747|Ga0181352_1123276 | Not Available | 697 | Open in IMG/M |
| 3300017747|Ga0181352_1126380 | Not Available | 687 | Open in IMG/M |
| 3300017747|Ga0181352_1174493 | Not Available | 560 | Open in IMG/M |
| 3300017766|Ga0181343_1135728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300019784|Ga0181359_1000960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 7207 | Open in IMG/M |
| 3300021956|Ga0213922_1106264 | Not Available | 563 | Open in IMG/M |
| 3300021962|Ga0222713_10045156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3412 | Open in IMG/M |
| 3300021963|Ga0222712_10079438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2348 | Open in IMG/M |
| 3300022407|Ga0181351_1001094 | All Organisms → cellular organisms → Bacteria | 8561 | Open in IMG/M |
| 3300022752|Ga0214917_10150804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
| 3300024289|Ga0255147_1003541 | Not Available | 3650 | Open in IMG/M |
| 3300024298|Ga0255178_1079148 | Not Available | 615 | Open in IMG/M |
| 3300024352|Ga0255142_1001830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4138 | Open in IMG/M |
| 3300024490|Ga0255185_1028595 | Not Available | 787 | Open in IMG/M |
| 3300024505|Ga0255150_1040371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300024515|Ga0255183_1059881 | Not Available | 813 | Open in IMG/M |
| 3300025445|Ga0208424_1052183 | Not Available | 513 | Open in IMG/M |
| 3300025635|Ga0208147_1122629 | Not Available | 619 | Open in IMG/M |
| 3300025646|Ga0208161_1115683 | Not Available | 716 | Open in IMG/M |
| 3300025732|Ga0208784_1006580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4104 | Open in IMG/M |
| 3300025732|Ga0208784_1153289 | Not Available | 680 | Open in IMG/M |
| 3300025769|Ga0208767_1236019 | Not Available | 584 | Open in IMG/M |
| 3300025848|Ga0208005_1003916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4642 | Open in IMG/M |
| 3300025889|Ga0208644_1170695 | Not Available | 975 | Open in IMG/M |
| 3300025889|Ga0208644_1390065 | Not Available | 516 | Open in IMG/M |
| 3300027380|Ga0208432_1010580 | Not Available | 1720 | Open in IMG/M |
| 3300027793|Ga0209972_10158494 | Not Available | 1079 | Open in IMG/M |
| 3300027804|Ga0209358_10136623 | Not Available | 1323 | Open in IMG/M |
| 3300031758|Ga0315907_10109673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2362 | Open in IMG/M |
| 3300031758|Ga0315907_10198479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
| 3300031758|Ga0315907_10733682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300031787|Ga0315900_10608563 | Not Available | 797 | Open in IMG/M |
| 3300031787|Ga0315900_11089689 | Not Available | 516 | Open in IMG/M |
| 3300031857|Ga0315909_10035427 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4779 | Open in IMG/M |
| 3300031857|Ga0315909_10241101 | Not Available | 1396 | Open in IMG/M |
| 3300031857|Ga0315909_10300759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300031857|Ga0315909_10304992 | Not Available | 1188 | Open in IMG/M |
| 3300031857|Ga0315909_10787871 | Not Available | 603 | Open in IMG/M |
| 3300031857|Ga0315909_10870817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300031857|Ga0315909_10906450 | Not Available | 543 | Open in IMG/M |
| 3300031951|Ga0315904_10388575 | Not Available | 1269 | Open in IMG/M |
| 3300031963|Ga0315901_10006791 | All Organisms → cellular organisms → Bacteria | 13652 | Open in IMG/M |
| 3300031963|Ga0315901_10421131 | Not Available | 1064 | Open in IMG/M |
| 3300031963|Ga0315901_10441269 | Not Available | 1031 | Open in IMG/M |
| 3300031963|Ga0315901_11224464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300032050|Ga0315906_10029592 | Not Available | 5944 | Open in IMG/M |
| 3300032050|Ga0315906_10635367 | Not Available | 871 | Open in IMG/M |
| 3300032093|Ga0315902_10009971 | Not Available | 12615 | Open in IMG/M |
| 3300032093|Ga0315902_10420628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300032093|Ga0315902_10794071 | Not Available | 749 | Open in IMG/M |
| 3300032116|Ga0315903_10012969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9661 | Open in IMG/M |
| 3300032116|Ga0315903_10188075 | Not Available | 1849 | Open in IMG/M |
| 3300032116|Ga0315903_10306356 | Not Available | 1339 | Open in IMG/M |
| 3300032116|Ga0315903_11184484 | Not Available | 517 | Open in IMG/M |
| 3300033418|Ga0316625_101073461 | Not Available | 725 | Open in IMG/M |
| 3300033557|Ga0316617_102640659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300033980|Ga0334981_0369668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300034019|Ga0334998_0495049 | Not Available | 683 | Open in IMG/M |
| 3300034061|Ga0334987_0458260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300034061|Ga0334987_0596638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034063|Ga0335000_0737100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300034104|Ga0335031_0742422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300034111|Ga0335063_0016434 | Not Available | 4757 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 21.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.39% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 13.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.30% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.82% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.82% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.82% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.82% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.82% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.82% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027380 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_101398153 | 3300001851 | Marine Plankton | ASLASVSDIYTLGVRTVSGATKGDGVGTLTFYDLTQ* |
| JGI24218J26658_10055841 | 3300002092 | Lentic | KTGRSIISSGTGYQWDLQLGASLAGVSDVLTLVARTVTTGGAATGGGAGQISFYDLTQ* |
| B570J40625_1001680284 | 3300002835 | Freshwater | LQLGATIAGVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0007787_100884873 | 3300004240 | Freshwater Lake | WDLQLGVSLAGVSDIYTLAVRTVSGATTGDGLGSISFYDLTQ* |
| Ga0069718_156879692 | 3300004481 | Sediment | GYNFAYQLGTSLAGVSDTFTLGIRTVSGATTGDAIGSISFYDLTV* |
| Ga0068876_102163731 | 3300005527 | Freshwater Lake | TSFANAYNFDLQLGATIAGVSDIYTVGIRTVSGATTGDAVGSLSFFDLTQ* |
| Ga0068876_105613272 | 3300005527 | Freshwater Lake | GFNWDQQLGVSLTNVSDIYTLGVRTISGATTGDGVGSITFYDLTQ* |
| Ga0049082_102948142 | 3300005584 | Freshwater Lentic | GRSILSPSTGYNWDLQLGASIAGVSDTLTLVARTVTTGGAAAGGGIGALSFYDLTQ* |
| Ga0075470_102092723 | 3300006030 | Aqueous | YNFDLQLGASIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ* |
| Ga0070749_100996571 | 3300006802 | Aqueous | VQNTSAATGYNWDLQLGATIAGVSDIYTLAIRTVSGATTGDAVGSISFYDLTQ* |
| Ga0070749_101971544 | 3300006802 | Aqueous | QLGTSLAGVSDTFTLGIRVVSGATTGDAFGSISFYDLTV* |
| Ga0070749_103403793 | 3300006802 | Aqueous | DPAGYNWALQPGVSLAGVSDIISIQIRTVSGATTGDAVGSLSFWDLTA* |
| Ga0070749_103861931 | 3300006802 | Aqueous | PNEYNWDLQLGASLAGVSDIYTLAVRTVDGATKGSGVGSISFYDLTQ* |
| Ga0075464_107561911 | 3300006805 | Aqueous | ILAAPTGYNFAFQLGTSLAGVSDTFTLGIRTVSGATTGDAIGSISFYDLTV* |
| Ga0075473_100530283 | 3300006875 | Aqueous | NWDLQLGVSLAGVSDIYTLAVRTVSGATTGDGLGSISFYDLTQ* |
| Ga0075473_101491481 | 3300006875 | Aqueous | PTGYNLDLQLGSSLTGVSDIYTLAVRTVSGATKGSGVGSLSFYDLTQ* |
| Ga0075473_102839041 | 3300006875 | Aqueous | QADTLSPTGFNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0102978_10530561 | 3300007177 | Freshwater Lake | QLGASLAGVSDVFTLAIRTVSGAPTGEAIGAIDFLDLTD* |
| Ga0070747_13245571 | 3300007276 | Aqueous | TSAATGYNWDLQLGASLAGVSDTYTLGVRTVSGATTGDGLGSISFYDLTQ* |
| Ga0099848_12756581 | 3300007541 | Aqueous | LGASLAGVSDIYTLAVRTVSGATKGSGVGSLSFYDLTQ* |
| Ga0108970_108930202 | 3300008055 | Estuary | PNDYNWDLQLGASIAGVSDIFTVAIRTVSGATTGDALGSLSFFDLTQ* |
| Ga0114340_100292910 | 3300008107 | Freshwater, Plankton | TGYVASSGGGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ* |
| Ga0114343_10008511 | 3300008110 | Freshwater, Plankton | SSGGGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ* |
| Ga0114343_10103971 | 3300008110 | Freshwater, Plankton | SSGGGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTISGATTGDGVGSITFYDLTQ* |
| Ga0114343_11990091 | 3300008110 | Freshwater, Plankton | QSSGNLSAPTGYNFDLQLGVSIAGTSDVYTLAVRTMSGSGGSVYGSMSFYDLA* |
| Ga0114346_12853303 | 3300008113 | Freshwater, Plankton | TGSGYNWDLQLGVSLAAVSDIYTLAARTISGTGGGIGSLTFYDLT* |
| Ga0114350_10650511 | 3300008116 | Freshwater, Plankton | GGGQADTTAPTGFNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0114350_10888412 | 3300008116 | Freshwater, Plankton | WDTQLGVSLANVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0114350_11365782 | 3300008116 | Freshwater, Plankton | TANTSVATGYNWDLQLGASIAGVSDIYTLAVRTVSGATNGSGVGSLSFYDLTQ* |
| Ga0114355_10068411 | 3300008120 | Freshwater, Plankton | GYVASSGGGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ* |
| Ga0114841_10037947 | 3300008259 | Freshwater, Plankton | TTAPTGFNWDQQLGVSLTDVSDIYTLGVRAISGSTTGDGVGSISFYDLTQ* |
| Ga0114363_10507351 | 3300008266 | Freshwater, Plankton | TIAPTGFNWDEQLGVSLTGVSDIYTLGVRTISGATKGDGVGSISFYDLTQ* |
| Ga0114363_10739941 | 3300008266 | Freshwater, Plankton | TGYNFDLQLGATIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ* |
| Ga0114363_11382742 | 3300008266 | Freshwater, Plankton | SLAGTSDIYTVAVRTVDGATKGSGVGSLSFWDLTQ* |
| Ga0114363_11942671 | 3300008266 | Freshwater, Plankton | DLQLGASLAGVSDIYTLGVRTVSGATTGDGVGSISFYDLTQ* |
| Ga0114363_12172411 | 3300008266 | Freshwater, Plankton | VSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0114364_11668472 | 3300008267 | Freshwater, Plankton | GYNWDLQLGASLAGVSDIYTLGVRTVSGATTGDGVGSISFYDLTQ* |
| Ga0114876_12008242 | 3300008448 | Freshwater Lake | FNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ* |
| Ga0115026_113024481 | 3300009111 | Wetland | TNVISDSPGYKWDLQLGASIAGVSDVYTVMIRTVSGATTGDAFGTITFYDLTQ* |
| Ga0114974_105992642 | 3300009183 | Freshwater Lake | VSLAGVSDVLTLVARTVTTGGAATGGGAGQISFYDLTQ* |
| Ga0129333_100736781 | 3300010354 | Freshwater To Marine Saline Gradient | AGVSDIYTIAIRVVNTPPTGDAVGSLSFWDLTNGT* |
| Ga0129333_101448831 | 3300010354 | Freshwater To Marine Saline Gradient | TWDLQLGASIAGTSDILTVAIRTVSGATTGDAVGSLSFYDLTQ* |
| Ga0129333_103584144 | 3300010354 | Freshwater To Marine Saline Gradient | FAFQLGTSLAGVSDTFTLGIRVVSGATTGDAVGSISFYDLTV* |
| Ga0129333_112856672 | 3300010354 | Freshwater To Marine Saline Gradient | NWDQQLGVSLTGVSDIYTLGVRTISGATTGDGVGSLTFWDLTQ* |
| Ga0129333_113755632 | 3300010354 | Freshwater To Marine Saline Gradient | VSLSSVSDIYTLAVRTVSGATKGEGVGSIAFYDLTQ* |
| Ga0129333_114913061 | 3300010354 | Freshwater To Marine Saline Gradient | LQLGASIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ* |
| Ga0129333_117224671 | 3300010354 | Freshwater To Marine Saline Gradient | IAGVSDIYTLAVRTVDGATKGSGVGSISFYDLTQ* |
| Ga0129336_101294642 | 3300010370 | Freshwater To Marine Saline Gradient | GPTGFNWDLQLGVSLSSVSDIYTLAVRTVSGATKGEGVGSISFYDLTQ* |
| Ga0129336_102752231 | 3300010370 | Freshwater To Marine Saline Gradient | ASIAGTSDIYTLAVRTVSGATTGDAVGSLSFYDLTV* |
| Ga0129336_104069932 | 3300010370 | Freshwater To Marine Saline Gradient | GIISAPTGYNFDLQLGVSLANVSDTMTVAIRTVSGATTGDAVGSLSFYDLTQ* |
| Ga0129336_106487352 | 3300010370 | Freshwater To Marine Saline Gradient | SPTGFNWDQQLGVSLAGVSDVYTLGVRTISGATTGDGVGSITFYDLTQ* |
| Ga0129336_106933271 | 3300010370 | Freshwater To Marine Saline Gradient | GASLAGVSDIYTLAVRTVSGATKGSGVGSLSFYDLTQ* |
| Ga0133913_102562824 | 3300010885 | Freshwater Lake | GAGYNWDMQLGASIAGVSDTLTLVARTVTTGGATTGGGIGAISFYDLTQ* |
| Ga0119931_10439581 | 3300011984 | Drinking Water Treatment Plant | VVPLSAATGYNWDLQLGVSLAGVSDIYTLAVRVINTPPTGDAVGMISFYDLTY* |
| Ga0119960_10508953 | 3300014811 | Aquatic | LGVSLAGVSDVLTLVARTVTTGGAATGGGAGQISFYDLTQ* |
| Ga0181350_11406971 | 3300017716 | Freshwater Lake | TGYNFAYQLGTSLAGVSDTFTLGIRTVSGATTGDAVGSISFYDLTV |
| Ga0181352_10481752 | 3300017747 | Freshwater Lake | GGGGQADTISPTGFNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0181352_10496353 | 3300017747 | Freshwater Lake | QLGVSLAGVSDIYTLAVRTVSGATTGDGLGSISFYDLTQ |
| Ga0181352_11111411 | 3300017747 | Freshwater Lake | LGASIAGVSDIYTIAIRTVSGATTGDAVGSLSFYDLTQ |
| Ga0181352_11232763 | 3300017747 | Freshwater Lake | APTGYNFDLQLGVSIAGVSDVYTLAVRTVSGSGGSVYAAMSFYDLT |
| Ga0181352_11263801 | 3300017747 | Freshwater Lake | GYNWDLQLGTSLAGTSDIYTVAVRTVDGATKGSGVGSLSFWDLTQ |
| Ga0181352_11744932 | 3300017747 | Freshwater Lake | SLDGSYNWDLQLGASLAGVSDIYTLAARVVTTGGSGSGGGVGSLSFYDLTQ |
| Ga0181343_11357282 | 3300017766 | Freshwater Lake | GAGYNWDMQLGASIAGVSDTLTLVARTVTTGGAATGGGIGAISFYDLTQ |
| Ga0181359_10009609 | 3300019784 | Freshwater Lake | SADGYNFDLQLGVSIAGVSDVYTLAIRTVSGATTGDAFGSLSFYDLT |
| Ga0213922_11062643 | 3300021956 | Freshwater | VSLAGVSDVLTVAIRTVDGATTGDAYGALTFYDLT |
| Ga0222713_100451561 | 3300021962 | Estuarine Water | QQLGVSLTGVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ |
| Ga0222712_100794381 | 3300021963 | Estuarine Water | SLANVSDIYTLGVRTISGATKGDGVGSISFYDLTY |
| Ga0181351_10010945 | 3300022407 | Freshwater Lake | IAGVSDVYTLAARVVTTGGAGSGGGIGSMSFYDLTTQ |
| Ga0214917_101508043 | 3300022752 | Freshwater | AGVSETSLPNGYNFDLQLGATIAGVSDIYTLAVRTVDGATKGSGVGSISFYDLTQ |
| Ga0255147_10035411 | 3300024289 | Freshwater | GYNWDLQLGVSLTSVSDIYTLAVRTVDGATKGSGLGSISFYDLTQ |
| Ga0255178_10791481 | 3300024298 | Freshwater | EPTGYNWDLQLGASLAGVSDIYTLAVRTVSGATTGDGVGSISFYDLTQ |
| Ga0255142_10018304 | 3300024352 | Freshwater | TVNTASTVSYNWDLQLGATISGTSDVYTLGVRTVSGATKGDGVGSISFYDLTQ |
| Ga0255185_10285954 | 3300024490 | Freshwater | TGYNFAYQLGTSLAGVSDTFTLGIRTISGATTGDAVGSISFYDLTV |
| Ga0255150_10403711 | 3300024505 | Freshwater | QLGASLTNVSDIYTLAVRTVSGATKGDGFGSISFYDLTQ |
| Ga0255183_10598811 | 3300024515 | Freshwater | LGATISGTSDVYTLGVRTVSGATKGDGVGSISFYDLTQ |
| Ga0208424_10521832 | 3300025445 | Aqueous | GSGGTANTSVPTGYNLDLQLGSSLAGVSDIYTLAVRTVSGATSGSGVGSLSFYDLTQ |
| Ga0208147_11226292 | 3300025635 | Aqueous | GTVSVPTGYNWDLQLGVSLTSVSDIYTIQIRTVSGATTGDAFGTLSFYDLTQ |
| Ga0208161_11156831 | 3300025646 | Aqueous | VLAAPTGYNFAYQLGTSLGGVSDTFTLGIRTVSGATTGDAVGSISFYDLTV |
| Ga0208784_10065803 | 3300025732 | Aqueous | GMSLAGVSDIITIQIRTVSGATTGDAVGSLSFWDLTA |
| Ga0208784_11532892 | 3300025732 | Aqueous | GQADTLSPTGFNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0208767_12360191 | 3300025769 | Aqueous | FDLQLGVSLAGVSDIYTVAIRTVSGATTGDALGTLAFIDLTD |
| Ga0208005_10039161 | 3300025848 | Aqueous | SLAGVSDIITIQIRTVSGATTGDAVGSLSFWDLTA |
| Ga0208644_11706951 | 3300025889 | Aqueous | FDLQLGATIAGVSDIYTVAVRTVSGATTGDAVGSLSFFDLTQ |
| Ga0208644_13900652 | 3300025889 | Aqueous | TGFNWDLQLGATISGTSDIYTLGVRTVSGATKGDGVGSISFYDLTQ |
| Ga0208432_10105801 | 3300027380 | Deep Subsurface | VLAAPTGYNFAYQLGTSLAGVSDTFTLGIRVVSGATTGDALGSISFYDLTV |
| Ga0209972_101584941 | 3300027793 | Freshwater Lake | ASLAGVSDIYTLGVRTVSGATTGDGVGSISFYDLTQ |
| Ga0209358_101366231 | 3300027804 | Freshwater Lake | SAGVSETSVPTGYNWDLQLGVSLAGVSDIYTLAVRTVSGATTGDGLGSISFYDLTQ |
| Ga0315907_101096734 | 3300031758 | Freshwater | SLAGVSDIYTIAIRVVSTPPTGDAVGSLTFWDLTNGT |
| Ga0315907_101984792 | 3300031758 | Freshwater | PTGYNWDLQLGATIGGTSDIYTVAVRTVDGATSGSGVGSLSFYDLTQ |
| Ga0315907_107336821 | 3300031758 | Freshwater | GFNWDQQLGVSLTNVSDIFTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0315900_106085632 | 3300031787 | Freshwater | QLGASLAGVSDIYTLAVRTVSGATLGDGVGSISFYDLTQ |
| Ga0315900_110896892 | 3300031787 | Freshwater | LQLGATISGTSDTYTLGVRTVSGATKGDGVGSISFYDLTQ |
| Ga0315909_100354275 | 3300031857 | Freshwater | GGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ |
| Ga0315909_102411011 | 3300031857 | Freshwater | LGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ |
| Ga0315909_103007592 | 3300031857 | Freshwater | NFDLQLGASIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ |
| Ga0315909_103049922 | 3300031857 | Freshwater | ADTSAPTGFNWDQQLGVSLTDVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0315909_107878711 | 3300031857 | Freshwater | SIAGVSDIFTVAIRTVSGATTGDALGSLSFFDLTQ |
| Ga0315909_108708171 | 3300031857 | Freshwater | ISQNSLPNDYNWDLQLGTSIAGVSDVYTVAIRTVSGATTGDAVGSLSFFDLTQ |
| Ga0315909_109064501 | 3300031857 | Freshwater | GVSNTSLLSAYNFDLQLGASIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ |
| Ga0315904_103885752 | 3300031951 | Freshwater | TAPTGFNWDQQLGVSLTNVSDIYTLGVRTISGATTGDGVGSITFYDLTQ |
| Ga0315901_100067911 | 3300031963 | Freshwater | TGYNWDTQLGVSLANVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0315901_104211311 | 3300031963 | Freshwater | PTGFNWDQQLGVSLTNVSDIYTLGVRTISGATTGDGVGSITFYDLTQ |
| Ga0315901_104412692 | 3300031963 | Freshwater | STVSPTGYNWDTQLGVSLANVSDIYTLGVRTISGATTGDGVGAISFYDLTQ |
| Ga0315901_112244642 | 3300031963 | Freshwater | PTGYNWDLQLGATIAGVSDIYTVAIRTVSGATTGDAVGSLSFYDLTQ |
| Ga0315906_100295921 | 3300032050 | Freshwater | TSFTNDYNFDLQLGASIAGVSDIYTVAVRTVSGATTGDALGSLSFFDLTQ |
| Ga0315906_106353671 | 3300032050 | Freshwater | TGYNFDLQLGASIAGVSDIYTVAVRTVSGATTGDVVGSLSFYDLTQ |
| Ga0315902_100099719 | 3300032093 | Freshwater | YVASSGGGGQADTTAPTGFNWDQQLGVSLTNVSDIYTLGVRTIAGATTGDGVGCITFYDLTQ |
| Ga0315902_104206281 | 3300032093 | Freshwater | DYNFDLQLGASIAGVSDIYTVAVRTVSGATTGDALGSLSFFDLTQ |
| Ga0315902_107940711 | 3300032093 | Freshwater | LASNTAGGTGSTSFANAYNFDLQLGASIAGVSDIYTVAIRTVSGATTGDALGSLSFFDLT |
| Ga0315903_100129691 | 3300032116 | Freshwater | GFNWDQQLGVSLTNVSDIYTLGVRTISGATTGDGVGSITFYDLTQ |
| Ga0315903_101880752 | 3300032116 | Freshwater | TGFNWDQQLGVSLTGVSDIYTLGVRAISGSTTGDGVGSIAFYDLTQ |
| Ga0315903_103063562 | 3300032116 | Freshwater | PTGYNWDLQLGASISGTSDVYTLAVRTVDGATKGSGVGSLSFYDLTQ |
| Ga0315903_111844842 | 3300032116 | Freshwater | TQLGSSLAGVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0316625_1010734611 | 3300033418 | Soil | DLQLGVSLAGVSDIYTVAVRTVSGATLGDGVGSLSFYDLTQ |
| Ga0316617_1026406592 | 3300033557 | Soil | GSGGVGILDSPTGYNWDLQLGVSLTNVSDIYTIQIRTVSGATTGDAVATLSFYDLTQ |
| Ga0334981_0369668_2_163 | 3300033980 | Freshwater | VGNTSAATGYNFDLQLGASIAGVSDIYTVAVRTVSGATTGDVVGSLSFYDLTQ |
| Ga0334998_0495049_3_143 | 3300034019 | Freshwater | YNWDLQLGASLASVSDTFTLAARVVTTGGAGSGGGIGSISFYDLTQ |
| Ga0334987_0458260_3_137 | 3300034061 | Freshwater | FNWDQQLGVSLTGVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0334987_0596638_3_110 | 3300034061 | Freshwater | SLAGVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| Ga0335000_0737100_1_117 | 3300034063 | Freshwater | LGATISGTSDIYTVAVRTVSGATTGDVVGSLSFYDLTQ |
| Ga0335031_0742422_1_120 | 3300034104 | Freshwater | GASLAGVSDIYTLAARVVTTGGAGSGGGIGSLSFYDLTQ |
| Ga0335063_0016434_2_181 | 3300034111 | Freshwater | GTCGGGQASTLAPTGFNWDTQLGASLAGVSDIYTLGVRTISGATTGDGVGSISFYDLTQ |
| ⦗Top⦘ |