Basic Information | |
---|---|
Family ID | F071016 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 44 residues |
Representative Sequence | HEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.72 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.820 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.492 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.656 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.754 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.88% β-sheet: 0.00% Coil/Unstructured: 65.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF00959 | Phage_lysozyme | 12.30 |
PF13482 | RNase_H_2 | 6.56 |
PF11753 | DUF3310 | 1.64 |
PF11351 | GTA_holin_3TM | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.82 % |
All Organisms | root | All Organisms | 49.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199905301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300003277|JGI25908J49247_10123140 | Not Available | 613 | Open in IMG/M |
3300003499|JGI25930J51415_1043128 | Not Available | 788 | Open in IMG/M |
3300004124|Ga0066178_10259536 | Not Available | 506 | Open in IMG/M |
3300004481|Ga0069718_15682671 | Not Available | 550 | Open in IMG/M |
3300004797|Ga0007764_11099183 | Not Available | 520 | Open in IMG/M |
3300005580|Ga0049083_10168593 | Not Available | 748 | Open in IMG/M |
3300005582|Ga0049080_10090930 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300005582|Ga0049080_10276150 | Not Available | 544 | Open in IMG/M |
3300005582|Ga0049080_10305588 | Not Available | 512 | Open in IMG/M |
3300005940|Ga0073913_10005358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1684 | Open in IMG/M |
3300006802|Ga0070749_10476630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300006802|Ga0070749_10596952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300006805|Ga0075464_10700661 | Not Available | 626 | Open in IMG/M |
3300006805|Ga0075464_10776054 | Not Available | 595 | Open in IMG/M |
3300006805|Ga0075464_10964087 | Not Available | 534 | Open in IMG/M |
3300006875|Ga0075473_10105839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1116 | Open in IMG/M |
3300007670|Ga0102862_1045085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1065 | Open in IMG/M |
3300007992|Ga0105748_10094369 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
3300008107|Ga0114340_1217787 | Not Available | 619 | Open in IMG/M |
3300008110|Ga0114343_1107238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 957 | Open in IMG/M |
3300008262|Ga0114337_1212027 | Not Available | 778 | Open in IMG/M |
3300008266|Ga0114363_1144596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300008448|Ga0114876_1052216 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
3300009051|Ga0102864_1179819 | Not Available | 578 | Open in IMG/M |
3300009081|Ga0105098_10211314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 900 | Open in IMG/M |
3300009081|Ga0105098_10741341 | Not Available | 525 | Open in IMG/M |
3300009155|Ga0114968_10110591 | Not Available | 1669 | Open in IMG/M |
3300009158|Ga0114977_10333768 | Not Available | 857 | Open in IMG/M |
3300009158|Ga0114977_10654577 | Not Available | 562 | Open in IMG/M |
3300009159|Ga0114978_10099353 | Not Available | 1924 | Open in IMG/M |
3300009164|Ga0114975_10194135 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
3300009164|Ga0114975_10705353 | Not Available | 533 | Open in IMG/M |
3300009180|Ga0114979_10659151 | Not Available | 595 | Open in IMG/M |
3300009181|Ga0114969_10485668 | Not Available | 693 | Open in IMG/M |
3300009181|Ga0114969_10666917 | Not Available | 563 | Open in IMG/M |
3300009183|Ga0114974_10015055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5541 | Open in IMG/M |
3300009183|Ga0114974_10734908 | Not Available | 534 | Open in IMG/M |
3300009184|Ga0114976_10202547 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
3300009185|Ga0114971_10826830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300010160|Ga0114967_10240314 | Not Available | 954 | Open in IMG/M |
3300010160|Ga0114967_10372297 | Not Available | 718 | Open in IMG/M |
3300010160|Ga0114967_10378539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
3300010388|Ga0136551_1025829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1124 | Open in IMG/M |
3300010885|Ga0133913_13334186 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
3300012013|Ga0153805_1046790 | Not Available | 734 | Open in IMG/M |
3300012663|Ga0157203_1059272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
(restricted) 3300013136|Ga0172370_10205958 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
3300017723|Ga0181362_1086158 | Not Available | 631 | Open in IMG/M |
3300017736|Ga0181365_1108719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300017736|Ga0181365_1118029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300017761|Ga0181356_1201348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300017766|Ga0181343_1182076 | Not Available | 579 | Open in IMG/M |
3300017778|Ga0181349_1287239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300017780|Ga0181346_1151194 | Not Available | 868 | Open in IMG/M |
3300017780|Ga0181346_1308285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300017784|Ga0181348_1107119 | Not Available | 1086 | Open in IMG/M |
3300017784|Ga0181348_1281521 | Not Available | 564 | Open in IMG/M |
3300017785|Ga0181355_1069615 | Not Available | 1479 | Open in IMG/M |
3300020159|Ga0211734_11062152 | Not Available | 680 | Open in IMG/M |
3300020160|Ga0211733_10533812 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
3300020161|Ga0211726_10926336 | Not Available | 803 | Open in IMG/M |
3300020205|Ga0211731_11489865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300020530|Ga0208235_1003616 | All Organisms → Viruses → Predicted Viral | 2263 | Open in IMG/M |
3300020551|Ga0208360_1005444 | Not Available | 1975 | Open in IMG/M |
3300021519|Ga0194048_10294252 | Not Available | 585 | Open in IMG/M |
3300021956|Ga0213922_1020123 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300021962|Ga0222713_10125626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1803 | Open in IMG/M |
3300021963|Ga0222712_10171567 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
3300021963|Ga0222712_10224732 | All Organisms → Viruses | 1215 | Open in IMG/M |
3300022190|Ga0181354_1072465 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
3300022190|Ga0181354_1196761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300023179|Ga0214923_10142280 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
3300025635|Ga0208147_1046092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1123 | Open in IMG/M |
3300026473|Ga0255166_1035941 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
3300027134|Ga0255069_1041908 | Not Available | 527 | Open in IMG/M |
3300027146|Ga0255104_1073166 | Not Available | 558 | Open in IMG/M |
3300027547|Ga0209864_1046334 | Not Available | 563 | Open in IMG/M |
3300027608|Ga0208974_1078023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 910 | Open in IMG/M |
3300027621|Ga0208951_1114657 | Not Available | 725 | Open in IMG/M |
3300027659|Ga0208975_1095589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300027659|Ga0208975_1152985 | Not Available | 642 | Open in IMG/M |
3300027710|Ga0209599_10004784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4843 | Open in IMG/M |
3300027710|Ga0209599_10122469 | Not Available | 687 | Open in IMG/M |
3300027734|Ga0209087_1141713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300027734|Ga0209087_1300660 | Not Available | 572 | Open in IMG/M |
3300027736|Ga0209190_1100692 | Not Available | 1333 | Open in IMG/M |
3300027772|Ga0209768_10407364 | Not Available | 539 | Open in IMG/M |
3300027782|Ga0209500_10124028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
3300027785|Ga0209246_10083810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1244 | Open in IMG/M |
3300027785|Ga0209246_10150657 | Not Available | 914 | Open in IMG/M |
3300027785|Ga0209246_10418379 | Not Available | 502 | Open in IMG/M |
3300027798|Ga0209353_10160947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300027892|Ga0209550_10416777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 827 | Open in IMG/M |
3300027969|Ga0209191_1345925 | Not Available | 538 | Open in IMG/M |
3300027971|Ga0209401_1315918 | Not Available | 537 | Open in IMG/M |
3300027972|Ga0209079_10138814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 833 | Open in IMG/M |
3300027974|Ga0209299_1285493 | Not Available | 579 | Open in IMG/M |
3300028025|Ga0247723_1004190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6923 | Open in IMG/M |
3300028103|Ga0255172_1036617 | Not Available | 917 | Open in IMG/M |
3300028394|Ga0304730_1249752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300031707|Ga0315291_11016275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300031772|Ga0315288_11502692 | Not Available | 556 | Open in IMG/M |
3300031857|Ga0315909_10582050 | Not Available | 752 | Open in IMG/M |
3300031873|Ga0315297_10723330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300031951|Ga0315904_11164818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300031999|Ga0315274_11515816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300032046|Ga0315289_10743872 | Not Available | 877 | Open in IMG/M |
3300032050|Ga0315906_10813105 | Not Available | 731 | Open in IMG/M |
3300032050|Ga0315906_11328894 | Not Available | 510 | Open in IMG/M |
3300032143|Ga0315292_11719649 | Not Available | 503 | Open in IMG/M |
3300032156|Ga0315295_11369538 | Not Available | 687 | Open in IMG/M |
3300032156|Ga0315295_11830966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300032275|Ga0315270_10522724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300033557|Ga0316617_101682704 | Not Available | 645 | Open in IMG/M |
3300033995|Ga0335003_0185296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1009 | Open in IMG/M |
3300034021|Ga0335004_0458362 | Not Available | 707 | Open in IMG/M |
3300034062|Ga0334995_0287310 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300034092|Ga0335010_0222768 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300034101|Ga0335027_0283723 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
3300034111|Ga0335063_0378292 | Not Available | 723 | Open in IMG/M |
3300034116|Ga0335068_0167110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1177 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.49% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.38% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.38% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.56% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.74% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.28% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.28% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.28% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.28% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.46% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.46% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.64% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.64% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.64% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.82% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.82% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.82% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200083970 | 2199352004 | Freshwater | VYLDSPKTDTYTSHKGLFLKLQKRVAKMYGFDPKEL |
JGI25908J49247_101231402 | 3300003277 | Freshwater Lake | ITLCHEILHMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
JGI25930J51415_10431283 | 3300003499 | Freshwater Lake | LYPVLITLCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0066178_102595361 | 3300004124 | Freshwater Lake | HEIIHMCVFLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0069718_156826711 | 3300004481 | Sediment | HMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0007764_110991831 | 3300004797 | Freshwater Lake | EILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0049083_101685933 | 3300005580 | Freshwater Lentic | CVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0049080_100909301 | 3300005582 | Freshwater Lentic | AVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0049080_102761502 | 3300005582 | Freshwater Lentic | LDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0049080_103055882 | 3300005582 | Freshwater Lentic | LMTLAHEIIHMCVYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0073913_100053585 | 3300005940 | Sand | LYPVLMTLCHEIIHMIVYITSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0070749_104766304 | 3300006802 | Aqueous | EIIHMICYLESPKTDKYTSHKGLFLKLQKRVANTLGYDPKEL* |
Ga0070749_105969521 | 3300006802 | Aqueous | LESPKTEKYATHRGLFSKLQKRVANSLGYDPKEL* |
Ga0075464_107006611 | 3300006805 | Aqueous | IIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0075464_107760542 | 3300006805 | Aqueous | YLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0075464_109640872 | 3300006805 | Aqueous | CHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0075473_101058393 | 3300006875 | Aqueous | HEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0102862_10450853 | 3300007670 | Estuarine | PVLITLCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0105748_100943691 | 3300007992 | Estuary Water | VLMTLCHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0114340_12177871 | 3300008107 | Freshwater, Plankton | EIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0114343_11072383 | 3300008110 | Freshwater, Plankton | CVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0114337_12120273 | 3300008262 | Freshwater, Plankton | IHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0114363_11445964 | 3300008266 | Freshwater, Plankton | MICYLESPKTEKYTSHKGLFLKLQKRVANTLGYDPKEL* |
Ga0114876_10522166 | 3300008448 | Freshwater Lake | IHMICYLESPKTDKYTSHKGLFLKLQKRVANTLGYDPTEL* |
Ga0102864_11798192 | 3300009051 | Estuarine | EILHMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0105098_102113143 | 3300009081 | Freshwater Sediment | VYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0105098_107413412 | 3300009081 | Freshwater Sediment | CHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0114968_101105915 | 3300009155 | Freshwater Lake | EIIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114977_103337683 | 3300009158 | Freshwater Lake | PVLMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114977_106545771 | 3300009158 | Freshwater Lake | VLMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114978_100993536 | 3300009159 | Freshwater Lake | LAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114975_101941354 | 3300009164 | Freshwater Lake | TLCHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKTYGFDPKEL* |
Ga0114975_107053531 | 3300009164 | Freshwater Lake | EIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0114979_106591512 | 3300009180 | Freshwater Lake | HEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL* |
Ga0114969_104856681 | 3300009181 | Freshwater Lake | HMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114969_106669172 | 3300009181 | Freshwater Lake | LMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRLANHLGFDPKEL* |
Ga0114974_1001505511 | 3300009183 | Freshwater Lake | LITLCHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL* |
Ga0114974_107349081 | 3300009183 | Freshwater Lake | VMKTLCHEIIHMCIYLETPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114976_102025474 | 3300009184 | Freshwater Lake | LMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114971_108268301 | 3300009185 | Freshwater Lake | YIEAPKTEKYCSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114967_102403141 | 3300010160 | Freshwater Lake | MKTLAHEIIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114967_103722971 | 3300010160 | Freshwater Lake | MICYIEAPKTEKYCSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0114967_103785393 | 3300010160 | Freshwater Lake | IIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0136551_10258293 | 3300010388 | Pond Fresh Water | PVLITLCHEIIHMCVYLDSPKTQQYVSHKGLFAKLQKRVAKMYGFDPKEL* |
Ga0133913_133341864 | 3300010885 | Freshwater Lake | AHEIIHMCVYLDSPKTEKYCSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0153805_10467901 | 3300012013 | Surface Ice | IHMCIYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL* |
Ga0157203_10592721 | 3300012663 | Freshwater | LYPVLMTLCHEIIHMCVYLDSPKTEKYASHKGLFLKLQKRVAKMYGFDPKEL* |
(restricted) Ga0172370_102059581 | 3300013136 | Freshwater | EIIHMICYLQSPKTQKYLSHKGLFLKLQKRVANTLGYDPKEL* |
Ga0181362_10861582 | 3300017723 | Freshwater Lake | MMTLAHEIIHMCVYLETPKTDRYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181365_11087191 | 3300017736 | Freshwater Lake | SHLYPVLMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0181365_11180291 | 3300017736 | Freshwater Lake | MTLCHEIIHMCVYIDSPKTTQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181356_12013481 | 3300017761 | Freshwater Lake | IVYMTSKKTDQYTSHKGLFLKLQKRVAIVYGFDPKEL |
Ga0181343_11820762 | 3300017766 | Freshwater Lake | LYPVLMTLCHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181349_12872392 | 3300017778 | Freshwater Lake | IHMCVYIDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181346_11511943 | 3300017780 | Freshwater Lake | AHLYSVLVTLCHEIIHMAVYTASKKTTQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181346_13082852 | 3300017780 | Freshwater Lake | IHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181348_11071194 | 3300017784 | Freshwater Lake | YMTSKKTDQYTSHKGLFLKLQKRVAKVYGFDPKEL |
Ga0181348_12815212 | 3300017784 | Freshwater Lake | YLESPKTDRYTSHKGLFLKLQKRVANHLGFDPREL |
Ga0181355_10696151 | 3300017785 | Freshwater Lake | VTLCHEIIHMAVYTASKKTTQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0211734_110621522 | 3300020159 | Freshwater | YISSPKTDDYVSHKGLFLKLQKRVAKEFGFDPKEL |
Ga0211733_105338124 | 3300020160 | Freshwater | HEIIHMCVYLESPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0211726_109263361 | 3300020161 | Freshwater | RHSHLYPVLITLCHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL |
Ga0211731_114898652 | 3300020205 | Freshwater | EIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0208235_10036167 | 3300020530 | Freshwater | YTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0208360_10054441 | 3300020551 | Freshwater | MCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0194048_102942522 | 3300021519 | Anoxic Zone Freshwater | TLCHEIIHMCVYLDSPKTEKYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0213922_10201235 | 3300021956 | Freshwater | DTVLKTLCHEIIHMICYLESPKTEKYTSHKGLFLKLQKRVANTLGYDPKEL |
Ga0222713_101256266 | 3300021962 | Estuarine Water | HMCVYLESPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0222712_101715671 | 3300021963 | Estuarine Water | ITLCHEILHMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0222712_102247321 | 3300021963 | Estuarine Water | VYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL |
Ga0181354_10724651 | 3300022190 | Freshwater Lake | DHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0181354_11967611 | 3300022190 | Freshwater Lake | YITSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0214923_101422805 | 3300023179 | Freshwater | MKTLAHEIIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0208147_10460923 | 3300025635 | Aqueous | HEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL |
Ga0255166_10359414 | 3300026473 | Freshwater | KTLCHEIIHMICYLESPKTEKYTSHKGLFLKLQKRVANTLGYDPKEL |
Ga0255069_10419081 | 3300027134 | Freshwater | LYPVLMTLTHEIIHMCVYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0255104_10731661 | 3300027146 | Freshwater | VYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209864_10463341 | 3300027547 | Sand | LYPVLMTLCHEIIHMIVYITSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0208974_10780233 | 3300027608 | Freshwater Lentic | AVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0208951_11146573 | 3300027621 | Freshwater Lentic | CVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0208975_10955891 | 3300027659 | Freshwater Lentic | VIKTICHEIIHMICYLESPKTEKYTSHKGLFLKLQKRVANTLGYDPKEL |
Ga0208975_11529851 | 3300027659 | Freshwater Lentic | HMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209599_1000478415 | 3300027710 | Deep Subsurface | LYPVLITLCHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209599_101224691 | 3300027710 | Deep Subsurface | YLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209087_11417134 | 3300027734 | Freshwater Lake | MTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209087_13006602 | 3300027734 | Freshwater Lake | HMICYLKSPKTENYTSHKGLFLKLQKRIANNLGFDPKEL |
Ga0209190_11006925 | 3300027736 | Freshwater Lake | YIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209768_104073642 | 3300027772 | Freshwater Lake | HLYSVLVTLCHEIIHMAVYTTSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209500_101240284 | 3300027782 | Freshwater Lake | YPVMMTLCHEIIHMCVYIDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209246_100838101 | 3300027785 | Freshwater Lake | SHLYPVLITLCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209246_101506571 | 3300027785 | Freshwater Lake | PVLMTLCHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209246_104183792 | 3300027785 | Freshwater Lake | HMCVYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209353_101609474 | 3300027798 | Freshwater Lake | HLYPVLMTLAHEIIHMCVYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209550_104167773 | 3300027892 | Freshwater Lake | LHMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209191_13459252 | 3300027969 | Freshwater Lake | CHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0209401_13159182 | 3300027971 | Freshwater Lake | YSVLVTLCHEIIHMCVYLDSPKTEQYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0209079_101388143 | 3300027972 | Freshwater Sediment | CHEIIHMICYLESPKTEKYVSHKGLFLKLQKRIANNLGYDPKEL |
Ga0209299_12854931 | 3300027974 | Freshwater Lake | LMTLAHEIIHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0247723_10041901 | 3300028025 | Deep Subsurface Sediment | CVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0255172_10366173 | 3300028103 | Freshwater | HSHLYPVLITLCHEIIHMICYLESPKTEKYTSHKGLFAKLQKRIAKELGFDPKEL |
Ga0304730_12497521 | 3300028394 | Freshwater Lake | IIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315291_110162753 | 3300031707 | Sediment | IHMCVYLESPKTDRYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315288_115026921 | 3300031772 | Sediment | RHSHLYPVLMTLCHEIIHMIVYMTSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0315909_105820503 | 3300031857 | Freshwater | TLCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0315297_107233303 | 3300031873 | Sediment | MTLTHEIIHMCVYLDSPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315904_111648183 | 3300031951 | Freshwater | ICYLESPKTDKYTSHKGLFLKLQKRVANTLGYDPKEL |
Ga0315274_115158161 | 3300031999 | Sediment | CVYLESPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315289_107438723 | 3300032046 | Sediment | IIHMCVYLESPKTDKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315906_108131053 | 3300032050 | Freshwater | TLCHEIIHMCVYLESPKTEKYTSHKGLFLKLQKRVAKEFGFDPKEL |
Ga0315906_113288942 | 3300032050 | Freshwater | TVIKTLCHEIIHMICYLESPKTEKYVSHKGLFLKLQKRIANNLGYDPKEL |
Ga0315292_117196492 | 3300032143 | Sediment | SHLYPVMMTLCHEIIHMIVYMTSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0315295_113695382 | 3300032156 | Sediment | VMKTLAHEIIHMICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315295_118309661 | 3300032156 | Sediment | MICYIEAPKTEKYTSHKGLFLKLQKRVANHLGFDPKEL |
Ga0315270_105227241 | 3300032275 | Sediment | LMTLCHEIIHMIVYITSKKTDQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0316617_1016827042 | 3300033557 | Soil | IHMICYLESPKTEKYVSHKGLFLKLQKRIANNLGYDPKEL |
Ga0335003_0185296_855_1007 | 3300033995 | Freshwater | PVLITLCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0335004_0458362_1_138 | 3300034021 | Freshwater | LCHEILHMAVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0334995_0287310_966_1085 | 3300034062 | Freshwater | HMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
Ga0335010_0222768_986_1132 | 3300034092 | Freshwater | LMTLCHEIIHMCVYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0335027_0283723_1016_1126 | 3300034101 | Freshwater | VYLDSPKTEQYASHKGLFLKLQKRVAKMYGFDPKEL |
Ga0335063_0378292_610_723 | 3300034111 | Freshwater | CVYLDSPKTEQYTSHKGLFLKLQKRVANTFGFDPKEL |
Ga0335068_0167110_3_164 | 3300034116 | Freshwater | HLYPVLITLCHEILHMCVYTVSPKTEQYTSHKGLFLKLQKRVAKMYGFDPKEL |
⦗Top⦘ |