| Basic Information | |
|---|---|
| Family ID | F070939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VTAASLLILVPWLVFAAGLVAIGLRLLILRRDRRRR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.60 % |
| % of genes near scaffold ends (potentially truncated) | 17.21 % |
| % of genes from short scaffolds (< 2000 bps) | 77.87 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.230 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.049 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.197 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 36.07 |
| PF00486 | Trans_reg_C | 12.30 |
| PF08044 | DUF1707 | 6.56 |
| PF12697 | Abhydrolase_6 | 3.28 |
| PF00126 | HTH_1 | 2.46 |
| PF00248 | Aldo_ket_red | 1.64 |
| PF00672 | HAMP | 1.64 |
| PF02934 | GatB_N | 0.82 |
| PF07690 | MFS_1 | 0.82 |
| PF03435 | Sacchrp_dh_NADP | 0.82 |
| PF03466 | LysR_substrate | 0.82 |
| PF00903 | Glyoxalase | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF00067 | p450 | 0.82 |
| PF01738 | DLH | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.82 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.28 % |
| Unclassified | root | N/A | 46.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10042848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2808 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100657096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10377713 | Not Available | 576 | Open in IMG/M |
| 3300005534|Ga0070735_10000968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 28725 | Open in IMG/M |
| 3300005537|Ga0070730_10065315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2581 | Open in IMG/M |
| 3300005541|Ga0070733_10461936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 848 | Open in IMG/M |
| 3300005591|Ga0070761_10002709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10785 | Open in IMG/M |
| 3300005610|Ga0070763_10371272 | Not Available | 799 | Open in IMG/M |
| 3300005921|Ga0070766_10047507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2401 | Open in IMG/M |
| 3300006893|Ga0073928_10035171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4732 | Open in IMG/M |
| 3300009520|Ga0116214_1000326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 19901 | Open in IMG/M |
| 3300009523|Ga0116221_1249428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300009525|Ga0116220_10296935 | Not Available | 711 | Open in IMG/M |
| 3300010048|Ga0126373_10357152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1475 | Open in IMG/M |
| 3300010048|Ga0126373_10585021 | Not Available | 1167 | Open in IMG/M |
| 3300010343|Ga0074044_10651406 | Not Available | 687 | Open in IMG/M |
| 3300010366|Ga0126379_12032390 | Not Available | 677 | Open in IMG/M |
| 3300010376|Ga0126381_105071105 | Not Available | 505 | Open in IMG/M |
| 3300010379|Ga0136449_100597729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1882 | Open in IMG/M |
| 3300010867|Ga0126347_1281228 | Not Available | 1031 | Open in IMG/M |
| 3300010880|Ga0126350_10119031 | Not Available | 800 | Open in IMG/M |
| 3300012181|Ga0153922_1091998 | Not Available | 687 | Open in IMG/M |
| 3300012923|Ga0137359_11236244 | Not Available | 635 | Open in IMG/M |
| 3300016319|Ga0182033_11503263 | Not Available | 608 | Open in IMG/M |
| 3300016387|Ga0182040_11295533 | Not Available | 615 | Open in IMG/M |
| 3300017821|Ga0187812_1015226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2656 | Open in IMG/M |
| 3300017821|Ga0187812_1030744 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300017821|Ga0187812_1127673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 823 | Open in IMG/M |
| 3300017822|Ga0187802_10239042 | Not Available | 702 | Open in IMG/M |
| 3300017822|Ga0187802_10318447 | Not Available | 608 | Open in IMG/M |
| 3300017823|Ga0187818_10228097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 813 | Open in IMG/M |
| 3300017823|Ga0187818_10419935 | Not Available | 595 | Open in IMG/M |
| 3300017924|Ga0187820_1017832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
| 3300017926|Ga0187807_1031512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1642 | Open in IMG/M |
| 3300017926|Ga0187807_1261871 | Not Available | 568 | Open in IMG/M |
| 3300017928|Ga0187806_1098674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
| 3300017928|Ga0187806_1364750 | Not Available | 518 | Open in IMG/M |
| 3300017928|Ga0187806_1368849 | Not Available | 515 | Open in IMG/M |
| 3300017942|Ga0187808_10289636 | Not Available | 737 | Open in IMG/M |
| 3300017942|Ga0187808_10434695 | Not Available | 603 | Open in IMG/M |
| 3300017955|Ga0187817_10721571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300017955|Ga0187817_10891357 | Not Available | 569 | Open in IMG/M |
| 3300017959|Ga0187779_10090493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1832 | Open in IMG/M |
| 3300017970|Ga0187783_10086333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2312 | Open in IMG/M |
| 3300017970|Ga0187783_10324102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1122 | Open in IMG/M |
| 3300017972|Ga0187781_10002508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13933 | Open in IMG/M |
| 3300018034|Ga0187863_10820327 | Not Available | 528 | Open in IMG/M |
| 3300018058|Ga0187766_10212070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300018058|Ga0187766_10468003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 844 | Open in IMG/M |
| 3300020579|Ga0210407_10108527 | Not Available | 2114 | Open in IMG/M |
| 3300020580|Ga0210403_10465864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
| 3300020580|Ga0210403_10864832 | Not Available | 715 | Open in IMG/M |
| 3300020581|Ga0210399_10659953 | Not Available | 862 | Open in IMG/M |
| 3300020582|Ga0210395_10054021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2943 | Open in IMG/M |
| 3300020582|Ga0210395_10494257 | Not Available | 920 | Open in IMG/M |
| 3300021088|Ga0210404_10177002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300021171|Ga0210405_10046462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3443 | Open in IMG/M |
| 3300021402|Ga0210385_10030959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3463 | Open in IMG/M |
| 3300021406|Ga0210386_10576087 | Not Available | 972 | Open in IMG/M |
| 3300021478|Ga0210402_10870621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 827 | Open in IMG/M |
| 3300021560|Ga0126371_10070766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3393 | Open in IMG/M |
| 3300021560|Ga0126371_11332737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 850 | Open in IMG/M |
| 3300022515|Ga0224546_1026754 | Not Available | 544 | Open in IMG/M |
| 3300022557|Ga0212123_10160756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1719 | Open in IMG/M |
| 3300026481|Ga0257155_1050907 | Not Available | 647 | Open in IMG/M |
| 3300026508|Ga0257161_1036898 | Not Available | 970 | Open in IMG/M |
| 3300027080|Ga0208237_1040138 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 703 | Open in IMG/M |
| 3300027096|Ga0208099_1051760 | Not Available | 586 | Open in IMG/M |
| 3300027110|Ga0208488_1014529 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300027497|Ga0208199_1026081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300027497|Ga0208199_1097720 | Not Available | 608 | Open in IMG/M |
| 3300027545|Ga0209008_1067561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 807 | Open in IMG/M |
| 3300027575|Ga0209525_1064452 | Not Available | 885 | Open in IMG/M |
| 3300027575|Ga0209525_1080894 | Not Available | 777 | Open in IMG/M |
| 3300027696|Ga0208696_1224802 | Not Available | 589 | Open in IMG/M |
| 3300027783|Ga0209448_10003642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4769 | Open in IMG/M |
| 3300027826|Ga0209060_10068800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
| 3300027829|Ga0209773_10006908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4275 | Open in IMG/M |
| 3300027853|Ga0209274_10122620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
| 3300027867|Ga0209167_10270505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300027908|Ga0209006_10453572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300027915|Ga0209069_10389087 | Not Available | 761 | Open in IMG/M |
| 3300027986|Ga0209168_10005606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8079 | Open in IMG/M |
| 3300028906|Ga0308309_10559352 | Not Available | 991 | Open in IMG/M |
| 3300028906|Ga0308309_11516950 | Not Available | 572 | Open in IMG/M |
| 3300030617|Ga0311356_10936459 | Not Available | 813 | Open in IMG/M |
| 3300030730|Ga0307482_1216323 | Not Available | 589 | Open in IMG/M |
| 3300031543|Ga0318516_10001815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8505 | Open in IMG/M |
| 3300031543|Ga0318516_10354535 | Not Available | 846 | Open in IMG/M |
| 3300031544|Ga0318534_10150689 | Not Available | 1342 | Open in IMG/M |
| 3300031544|Ga0318534_10495806 | Not Available | 698 | Open in IMG/M |
| 3300031544|Ga0318534_10652247 | Not Available | 596 | Open in IMG/M |
| 3300031564|Ga0318573_10000928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9912 | Open in IMG/M |
| 3300031679|Ga0318561_10682337 | Not Available | 565 | Open in IMG/M |
| 3300031680|Ga0318574_10013617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3786 | Open in IMG/M |
| 3300031681|Ga0318572_10744663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300031708|Ga0310686_103799003 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
| 3300031708|Ga0310686_107371595 | Not Available | 1121 | Open in IMG/M |
| 3300031708|Ga0310686_109446961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15853 | Open in IMG/M |
| 3300031708|Ga0310686_115980471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1960 | Open in IMG/M |
| 3300031713|Ga0318496_10175675 | Not Available | 1174 | Open in IMG/M |
| 3300031713|Ga0318496_10520281 | Not Available | 658 | Open in IMG/M |
| 3300031715|Ga0307476_10549054 | Not Available | 856 | Open in IMG/M |
| 3300031723|Ga0318493_10228205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 990 | Open in IMG/M |
| 3300031724|Ga0318500_10724598 | Not Available | 508 | Open in IMG/M |
| 3300031782|Ga0318552_10235805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
| 3300031782|Ga0318552_10742889 | Not Available | 501 | Open in IMG/M |
| 3300031799|Ga0318565_10115666 | Not Available | 1292 | Open in IMG/M |
| 3300031860|Ga0318495_10516073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300031890|Ga0306925_10781165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 3300031912|Ga0306921_11102379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 890 | Open in IMG/M |
| 3300031941|Ga0310912_10565464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
| 3300032039|Ga0318559_10274678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300032076|Ga0306924_11399717 | Not Available | 746 | Open in IMG/M |
| 3300032892|Ga0335081_10041935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7257 | Open in IMG/M |
| 3300032892|Ga0335081_10409697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1740 | Open in IMG/M |
| 3300032895|Ga0335074_10001558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 31070 | Open in IMG/M |
| 3300032895|Ga0335074_10095741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3925 | Open in IMG/M |
| 3300032895|Ga0335074_10662834 | Not Available | 1018 | Open in IMG/M |
| 3300032895|Ga0335074_10940630 | Not Available | 775 | Open in IMG/M |
| 3300032896|Ga0335075_10526183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1198 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 13.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.64% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.64% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.82% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100428483 | 3300001356 | Peatlands Soil | VSVDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIRRDRRHR* |
| JGIcombinedJ26739_1006570962 | 3300002245 | Forest Soil | VTAASLLILVPWLVFAVGLIAIGLRLLIIRRDRRRQ* |
| JGIcombinedJ51221_103777131 | 3300003505 | Forest Soil | VSAGTTWEANVTATSLLILLPWLIFAAALVVIGLRLLVIRRDRRRR* |
| Ga0070735_1000096810 | 3300005534 | Surface Soil | VTAASLLILVPWVVFAAGLMAIGLRLLILRRERRRR* |
| Ga0070730_100653154 | 3300005537 | Surface Soil | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHRRRR* |
| Ga0070733_104619362 | 3300005541 | Surface Soil | VTAASLLILVPWLVFAAGLMAIGLRLLILRRERRRR* |
| Ga0070761_1000270911 | 3300005591 | Soil | VTAASLLILLPWLAFAVGLVAIGVRLLVVRRNRRRR* |
| Ga0070763_103712721 | 3300005610 | Soil | VTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRR* |
| Ga0070766_100475073 | 3300005921 | Soil | VTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRW* |
| Ga0073928_100351714 | 3300006893 | Iron-Sulfur Acid Spring | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHQRRR* |
| Ga0116214_10003262 | 3300009520 | Peatlands Soil | VTAASVLILVPWLVFAAGLVAIGVRLLVIRRDRRHR* |
| Ga0116221_12494282 | 3300009523 | Peatlands Soil | VDTTGGEANVTATSVLILVPWLVFAAALVAIGVRLLVIRRDRRHR* |
| Ga0116220_102969351 | 3300009525 | Peatlands Soil | VDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIRRDRRHR* |
| Ga0126373_103571522 | 3300010048 | Tropical Forest Soil | VTAASLLILLPWLVFAAGLVVIGLRLLLIRRDRRRR* |
| Ga0126373_105850213 | 3300010048 | Tropical Forest Soil | VTGASLLILLPWLVFAAGLIAISLRLLLIRRGRRRR* |
| Ga0074044_106514062 | 3300010343 | Bog Forest Soil | VTAASLIILVPWLVFAAGLLAIGLRLLILRRDRRRR* |
| Ga0126379_120323901 | 3300010366 | Tropical Forest Soil | VTGASLLILLPWLVFAAGLVLIGLRLLLNRRRGRRR |
| Ga0126381_1050711051 | 3300010376 | Tropical Forest Soil | VTGASLLILLPWLVFAAGLISIGLRLLLIRRGRRRR* |
| Ga0136449_1005977291 | 3300010379 | Peatlands Soil | VTAASVLILVPWLVFAAALVAIGVRLLVIRRDRRHR* |
| Ga0126347_12812282 | 3300010867 | Boreal Forest Soil | VTAASLLILVPWLVFAVGLIAIGLRLLILRRDRRRR* |
| Ga0126350_101190312 | 3300010880 | Boreal Forest Soil | VTAASLLILVPWLVFAVGLMAIGLRLLILRRHRRRR* |
| Ga0153922_10919981 | 3300012181 | Attine Ant Fungus Gardens | MTAATLLILVPWLVFAVGLVAIGLRLLILRRDRRGR* |
| Ga0137359_112362441 | 3300012923 | Vadose Zone Soil | GQAREATVTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRR* |
| Ga0182033_115032632 | 3300016319 | Soil | VNATAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRRGT |
| Ga0182040_112955332 | 3300016387 | Soil | VTAASLLILLPWLVFAAGLLVIGLRLLLISRDRRRG |
| Ga0187812_10152262 | 3300017821 | Freshwater Sediment | VSVDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIHRDRRHR |
| Ga0187812_10307443 | 3300017821 | Freshwater Sediment | VTAAGLLILVPWLVFAAGLVAIGLRLLIIRRYRRRR |
| Ga0187812_11276732 | 3300017821 | Freshwater Sediment | VREANVTAASVLILVPWLVFAAGLAAIGVRLLLIRRDRRHR |
| Ga0187802_102390421 | 3300017822 | Freshwater Sediment | VREANVTAASVLILVPWLVFAACLAAIGVRLLVIRRDRRHR |
| Ga0187802_103184471 | 3300017822 | Freshwater Sediment | VDTAGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIHRDRRHR |
| Ga0187818_102280972 | 3300017823 | Freshwater Sediment | VDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIHRDRRHR |
| Ga0187818_104199351 | 3300017823 | Freshwater Sediment | VTAAGLLILVPWLVFAAGLMVIGLRLLLIRRDRRRR |
| Ga0187820_10178322 | 3300017924 | Freshwater Sediment | VTAVTLLILIPWLVFAAGLVTIGLRLLVIRRDRRRR |
| Ga0187807_10315122 | 3300017926 | Freshwater Sediment | VTAASVLILVPWLVFAAGLAAIGVRLLLIRRDRRHR |
| Ga0187807_12618711 | 3300017926 | Freshwater Sediment | VTGASLLILLPWLVFAAGLVAIGVRLLVIRRGRRHR |
| Ga0187806_10986741 | 3300017928 | Freshwater Sediment | VREANVTAASVLILVPWLVFAAGLAAIGVRLLVIRRDRRHR |
| Ga0187806_13647501 | 3300017928 | Freshwater Sediment | VTAASVLILVPWLVFAACLAAIGVRLLVIRRDRRHR |
| Ga0187806_13688492 | 3300017928 | Freshwater Sediment | VTGASLLILLPWLVFAAGLVAIGVRLLVIRRGLRHR |
| Ga0187808_102896362 | 3300017942 | Freshwater Sediment | VTAVTLLILIPWLVFAAGLVTIGLRLLIIRRDRRHR |
| Ga0187808_104346951 | 3300017942 | Freshwater Sediment | VTAACLLILVPWLVFAAGLVAIGLRLLVIRRYRQRR |
| Ga0187817_107215712 | 3300017955 | Freshwater Sediment | NVTAVSLLILVPWLVFAAGLVAIGVRLLVIRRDRRRQ |
| Ga0187817_108913571 | 3300017955 | Freshwater Sediment | MIVTAASLLILLPWLVFAAGLVAIGLRLLFIRRYRRRR |
| Ga0187779_100904932 | 3300017959 | Tropical Peatland | VTAACLLILVPWLVFAASLVAIGLRLLVIRRYRQRR |
| Ga0187783_100863333 | 3300017970 | Tropical Peatland | VTAASLLILVPWLVFAAGVVAIGVRLLVIQRSRRRR |
| Ga0187783_103241023 | 3300017970 | Tropical Peatland | MEVNVTAASLLILVPWLVFAAGLVAIGVRLLVIRRHRRGR |
| Ga0187781_100025086 | 3300017972 | Tropical Peatland | VTFANVDPTGREANVTAAGLLILLPWLVFAAGLAAIGLRLLVIRRCRRRR |
| Ga0187863_108203272 | 3300018034 | Peatland | AADLLILIPWLVFAAGLAVIGWRLLVVRRRRRDKK |
| Ga0187766_102120702 | 3300018058 | Tropical Peatland | VTAASLLIVIPWLVFAVGLVAIGLRLLIIRRYRRRR |
| Ga0187766_104680031 | 3300018058 | Tropical Peatland | VTAACLLILVPWLVFAVGLVAIGLRLLFIRRYGQRR |
| Ga0210407_101085272 | 3300020579 | Soil | VTAASLLILVPWLVFAAGLTAIGLRLLILRRDRRRR |
| Ga0210403_104658643 | 3300020580 | Soil | VTAVTLLILVPWLVFAAGLVAIGLRLLIIRRGRRRR |
| Ga0210403_108648321 | 3300020580 | Soil | VTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRR |
| Ga0210399_106599531 | 3300020581 | Soil | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHRRRR |
| Ga0210395_100540211 | 3300020582 | Soil | VTAASLLILVPWLVFAAGLVAIGLRLLILRRDRRRR |
| Ga0210395_104942572 | 3300020582 | Soil | VTAASLLILVPWLVFAAGLTAIGLRLLMLRRHRRRR |
| Ga0210404_101770022 | 3300021088 | Soil | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHRRRP |
| Ga0210405_100464624 | 3300021171 | Soil | VTAVSLLILIPWLVFAAGLVTIGLRLLVIRRDRRRR |
| Ga0210385_100309594 | 3300021402 | Soil | VTATSLLILLPWLIFAAALVVIGLRLLVIRRDRRRR |
| Ga0210386_105760872 | 3300021406 | Soil | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHRRRQ |
| Ga0210402_108706212 | 3300021478 | Soil | VTAVSLLILIPWLVFAAGLVTIGLRLLVIRRDRWRR |
| Ga0126371_100707662 | 3300021560 | Tropical Forest Soil | VTAASLLILLPWLVFAAGLVVIGLRLLLIRRDRRRR |
| Ga0126371_113327371 | 3300021560 | Tropical Forest Soil | VTGASLLILLPWLVFAAGLISIGLRLLLIRRGRRRR |
| Ga0224546_10267542 | 3300022515 | Soil | GDGKVTAADLLILIPWLVFAAGLAVIGWRLLVVRRRRRDRK |
| Ga0212123_101607563 | 3300022557 | Iron-Sulfur Acid Spring | VTAASLLILVPWLVFAAGLTAIGLRLLILRRHQRRR |
| Ga0257155_10509072 | 3300026481 | Soil | VTAASLLILVPWLVFAVGLAAIGLRLLILRRDRRRR |
| Ga0257161_10368981 | 3300026508 | Soil | VTAASLLILVPWLVFAAGLMAIGLRLLILRRHRRRR |
| Ga0208237_10401382 | 3300027080 | Forest Soil | VSAGTTWEANVTATSLLILLPWLIFAVALVVIGLRLLVIRRDRRRR |
| Ga0208099_10517602 | 3300027096 | Forest Soil | VSAGTTWEANVTATSLLILLPWLIFAAALVVIGLRLLVIRRDRRRR |
| Ga0208488_10145293 | 3300027110 | Forest Soil | PKMTAADLLVLVPWLVFAAGLAVIGWRLLVVRRRRRDGH |
| Ga0208199_10260812 | 3300027497 | Peatlands Soil | VSVDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIRRDRRHR |
| Ga0208199_10977201 | 3300027497 | Peatlands Soil | VTAASVLILVPWLVFAAGLVAIGVRLLVIRRDRRHR |
| Ga0209008_10675612 | 3300027545 | Forest Soil | VTAASLLILVPWLVFAVGLIAIGLRLLIIRRDRRRQ |
| Ga0209525_10644521 | 3300027575 | Forest Soil | VTAASLLILVPWLVFAVGLIAIGLRLLILRRDRRRR |
| Ga0209525_10808942 | 3300027575 | Forest Soil | EASVTAASLLILVPWLVFAVGLIAIGLRLLIIRRDRRRQ |
| Ga0208696_12248022 | 3300027696 | Peatlands Soil | VDTTGGEANVTATSVLILLPWLVFAAGLAAIGVRLLVIRRDRRHR |
| Ga0209448_100036423 | 3300027783 | Bog Forest Soil | VTAASLLILVPWLAFAAGLMVIGLRLLILRRDRRRR |
| Ga0209060_100688002 | 3300027826 | Surface Soil | VTAASLLILVPWLVFAAGLMVIGLRLLILRRERRRR |
| Ga0209773_100069081 | 3300027829 | Bog Forest Soil | VTAASLIILVPWLVFAAGLLAIGLRLLILRRDRRRR |
| Ga0209274_101226202 | 3300027853 | Soil | VTAASLLILLPWLAFAVGLVAIGVRLLVVRRNRRRR |
| Ga0209167_102705052 | 3300027867 | Surface Soil | VTAASLLILVPWLVFAAGLMAIGLRLLILRRERRRR |
| Ga0209006_104535722 | 3300027908 | Forest Soil | VTAASLLILVPWLVFAAGLIAIGLRLLILRRDRRRR |
| Ga0209069_103890872 | 3300027915 | Watersheds | VTAVTLLILVPWLVFAAGLVAIGVRLLVIRRDRRRQ |
| Ga0209168_100056068 | 3300027986 | Surface Soil | VTAASLLILVPWVVFAAGLMAIGLRLLILRRERRRR |
| Ga0302226_103920491 | 3300028801 | Palsa | AADLLVLVPWLVFAAGLAVIGWRLLVARRRRHDRHRDRH |
| Ga0308309_105593521 | 3300028906 | Soil | VTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRW |
| Ga0308309_115169501 | 3300028906 | Soil | REATVTAASLLILVPWLVFAVGLVAIGLRLLILRRDRRRR |
| Ga0311356_109364591 | 3300030617 | Palsa | VKSKVTTADLLVLVPWLVFAAGVAVIGWRLLVVRR |
| Ga0307482_12163231 | 3300030730 | Hardwood Forest Soil | VTAASLLFLVPWLVFAVGLMAIGLRLLILRRDRRRR |
| Ga0318516_100018153 | 3300031543 | Soil | VNATAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRR |
| Ga0318516_103545352 | 3300031543 | Soil | MTGEREVSVTAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRR |
| Ga0318534_101506891 | 3300031544 | Soil | VTAASLLILVPWLVFAAGLVAIGLRLLLIRRGRRRG |
| Ga0318534_104958062 | 3300031544 | Soil | MEANVTAVDLLILITWLVFAAGLVAIGLRLLLIRRDRRRR |
| Ga0318534_106522471 | 3300031544 | Soil | VTAASLLILLPWLVFAAGLVVIGLRLLFIRRDRRRR |
| Ga0318573_100009288 | 3300031564 | Soil | VNATAASLLILLPWLVFAAGLVAIGLRLLFIRRSRRRR |
| Ga0318561_106823372 | 3300031679 | Soil | MEANVTAVDLLILITWLVFAAGLVAIGLRLLIIRRDRRRR |
| Ga0318574_100136173 | 3300031680 | Soil | EREVSVTAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRR |
| Ga0318572_107446632 | 3300031681 | Soil | VTGASLLILLPWLVFAAGLIAIGLRLLLIRRGRRRR |
| Ga0310686_1037990033 | 3300031708 | Soil | VTGTSLLILVPWLVFAVGLVAIGVRLLVLHRARRRR |
| Ga0310686_1073715953 | 3300031708 | Soil | VTAASLIILVPWLVFAAGLVAIGLRLLILRRDRRRR |
| Ga0310686_1094469617 | 3300031708 | Soil | VTAVSLLILVPWLVFAAGLVTIGLRLLIIRRGRRRR |
| Ga0310686_1159804712 | 3300031708 | Soil | VTAASLLILVPWLVFAAGLMAIGLRLLILRRGRRHR |
| Ga0318496_101756752 | 3300031713 | Soil | VTAASLLILVPWLVFAAGLMTIGLRLLLIRRGRRRR |
| Ga0318496_105202811 | 3300031713 | Soil | MEANVTAVDLLILITWLVFAAGLVAIGLRLLLIRRDRRR |
| Ga0307476_105490542 | 3300031715 | Hardwood Forest Soil | VTAASLLILVPWVVFAAGLTAIGLRLLILRRHRRRR |
| Ga0318493_102282052 | 3300031723 | Soil | VTAASLLILLPWLVFAAGLVVIGLRLLLIRRNRRRR |
| Ga0318500_107245982 | 3300031724 | Soil | RAREANVTAAGLLILVPWLVFAAGLVVIGLRLLLLRRRR |
| Ga0318552_102358051 | 3300031782 | Soil | AREANVTAAGLLILVPWLVFAAGLVVIGLRLLLLRRRR |
| Ga0318552_107428892 | 3300031782 | Soil | VNATAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRSR |
| Ga0318565_101156663 | 3300031799 | Soil | VTAASLLILVPWLVFAAGLVAIGLRLLLIRRGRRRR |
| Ga0318495_105160731 | 3300031860 | Soil | MEANVTAVDLLILITWLVFAAGLVAIGLRLLIIRRDRR |
| Ga0306925_107811651 | 3300031890 | Soil | ANVTAASLLILLPWLVFAAGLVVIGLRLLLIRRDRRRR |
| Ga0306921_111023792 | 3300031912 | Soil | VTGASLLILLPWLVFAVGLIAIGLRLLLIRRGRRRR |
| Ga0310912_105654642 | 3300031941 | Soil | TAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRR |
| Ga0318559_102746781 | 3300032039 | Soil | ATAASLLILLPWLVFAAGLVAIGLRLLFIRRDRRRR |
| Ga0306924_113997172 | 3300032076 | Soil | VTAASLLILLPWLVFAAGLVVIGLRLLFIRRNRRRR |
| Ga0335081_100419357 | 3300032892 | Soil | VTAASLLILVPWLVFAVGLVAIGVRLLVIQRARRRR |
| Ga0335081_104096971 | 3300032892 | Soil | VDTTGEANVTAASVLVLVPWLVFAAGLVAIGVRLLVIRRYRRHR |
| Ga0335074_1000155812 | 3300032895 | Soil | VTAASLLILVPWLVFAAGLVAIGLRLLVIQRARRRR |
| Ga0335074_100957413 | 3300032895 | Soil | VTATGLLILIPWLVFAAGLAAIGLRLLIIRRNRGRR |
| Ga0335074_106628341 | 3300032895 | Soil | VTGTSLLILLPWLVFAAGLAVIGLRLLVIRRRARRRR |
| Ga0335074_109406301 | 3300032895 | Soil | MSVTVTSLLILVPWLVFAAGLVAIGLRLLVIRRDRRRR |
| Ga0335075_105261833 | 3300032896 | Soil | VTATSLLILIPWLVFAAGLAAIGLRLLIIRRNRGRR |
| ⦗Top⦘ |