| Basic Information | |
|---|---|
| Family ID | F070870 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 55.74 % |
| % of genes near scaffold ends (potentially truncated) | 9.02 % |
| % of genes from short scaffolds (< 2000 bps) | 64.75 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.574 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (39.344 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.410 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.770 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 19.67 |
| PF07235 | DUF1427 | 10.66 |
| PF09834 | DUF2061 | 8.20 |
| PF04820 | Trp_halogenase | 7.38 |
| PF01583 | APS_kinase | 2.46 |
| PF01370 | Epimerase | 1.64 |
| PF08241 | Methyltransf_11 | 0.82 |
| PF00011 | HSP20 | 0.82 |
| PF00565 | SNase | 0.82 |
| PF04973 | NMN_transporter | 0.82 |
| PF00534 | Glycos_transf_1 | 0.82 |
| PF13469 | Sulfotransfer_3 | 0.82 |
| PF16861 | Carbam_trans_C | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 10.66 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 2.46 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.57 % |
| All Organisms | root | All Organisms | 34.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109929335 | Not Available | 2993 | Open in IMG/M |
| 3300002408|B570J29032_109938656 | Not Available | 3535 | Open in IMG/M |
| 3300002408|B570J29032_109953110 | Not Available | 5988 | Open in IMG/M |
| 3300002835|B570J40625_100016647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12772 | Open in IMG/M |
| 3300002835|B570J40625_100069175 | Not Available | 4710 | Open in IMG/M |
| 3300002835|B570J40625_100083983 | Not Available | 4084 | Open in IMG/M |
| 3300002835|B570J40625_100248962 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300002835|B570J40625_100439299 | Not Available | 1251 | Open in IMG/M |
| 3300002835|B570J40625_101120615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300003277|JGI25908J49247_10011556 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300004369|Ga0065726_14778 | Not Available | 15884 | Open in IMG/M |
| 3300005527|Ga0068876_10175748 | Not Available | 1250 | Open in IMG/M |
| 3300005528|Ga0068872_10567521 | Not Available | 604 | Open in IMG/M |
| 3300005581|Ga0049081_10033729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1945 | Open in IMG/M |
| 3300005582|Ga0049080_10087260 | Not Available | 1066 | Open in IMG/M |
| 3300005582|Ga0049080_10263332 | Not Available | 560 | Open in IMG/M |
| 3300005584|Ga0049082_10163704 | Not Available | 769 | Open in IMG/M |
| 3300005585|Ga0049084_10030552 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300007974|Ga0105747_1181920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300008107|Ga0114340_1126828 | Not Available | 1668 | Open in IMG/M |
| 3300008116|Ga0114350_1004811 | Not Available | 6765 | Open in IMG/M |
| 3300008116|Ga0114350_1017714 | Not Available | 3012 | Open in IMG/M |
| 3300008116|Ga0114350_1024676 | Not Available | 2448 | Open in IMG/M |
| 3300008117|Ga0114351_1343099 | Not Available | 676 | Open in IMG/M |
| 3300008120|Ga0114355_1132533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2288 | Open in IMG/M |
| 3300008120|Ga0114355_1232667 | Not Available | 557 | Open in IMG/M |
| 3300009160|Ga0114981_10409198 | Not Available | 730 | Open in IMG/M |
| 3300009161|Ga0114966_10522263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300013004|Ga0164293_10577663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300013004|Ga0164293_10869573 | Not Available | 568 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10089249 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10586908 | Not Available | 600 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10037275 | Not Available | 4493 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10038203 | Not Available | 4411 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10053898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3428 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10035124 | Not Available | 5230 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10420479 | Not Available | 907 | Open in IMG/M |
| 3300013372|Ga0177922_10438746 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10208867 | Not Available | 1234 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10713903 | Not Available | 541 | Open in IMG/M |
| 3300014819|Ga0119954_1007195 | Not Available | 2734 | Open in IMG/M |
| 3300017788|Ga0169931_10006544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17539 | Open in IMG/M |
| 3300017788|Ga0169931_10140490 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300017788|Ga0169931_10895589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300020151|Ga0211736_10230306 | Not Available | 3654 | Open in IMG/M |
| 3300020151|Ga0211736_10270315 | Not Available | 972 | Open in IMG/M |
| 3300020159|Ga0211734_10227574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300020159|Ga0211734_11364582 | Not Available | 814 | Open in IMG/M |
| 3300020160|Ga0211733_10329155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300020160|Ga0211733_11234951 | Not Available | 775 | Open in IMG/M |
| 3300020161|Ga0211726_10104144 | Not Available | 5125 | Open in IMG/M |
| 3300020161|Ga0211726_10856158 | Not Available | 1172 | Open in IMG/M |
| 3300020161|Ga0211726_11055961 | Not Available | 1254 | Open in IMG/M |
| 3300020172|Ga0211729_10678665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300020172|Ga0211729_10767868 | Not Available | 2754 | Open in IMG/M |
| 3300020172|Ga0211729_11438225 | Not Available | 857 | Open in IMG/M |
| 3300020513|Ga0208090_1010165 | Not Available | 1505 | Open in IMG/M |
| 3300020514|Ga0208202_1007984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1446 | Open in IMG/M |
| 3300020524|Ga0208858_1044296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300020527|Ga0208232_1002354 | Not Available | 3358 | Open in IMG/M |
| 3300020532|Ga0208601_1050181 | Not Available | 581 | Open in IMG/M |
| 3300020533|Ga0208364_1030841 | Not Available | 728 | Open in IMG/M |
| 3300020542|Ga0208857_1050433 | Not Available | 632 | Open in IMG/M |
| 3300020543|Ga0208089_1010026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1540 | Open in IMG/M |
| 3300020554|Ga0208599_1053592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300020557|Ga0208231_1018826 | Not Available | 1200 | Open in IMG/M |
| 3300020568|Ga0208598_1002659 | Not Available | 3908 | Open in IMG/M |
| 3300021376|Ga0194130_10121567 | Not Available | 1659 | Open in IMG/M |
| 3300027608|Ga0208974_1062198 | Not Available | 1050 | Open in IMG/M |
| 3300027608|Ga0208974_1098563 | Not Available | 782 | Open in IMG/M |
| 3300027608|Ga0208974_1149260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300027649|Ga0208960_1028996 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300027707|Ga0209443_1164600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1019829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5079 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1018776 | Not Available | 5287 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1081150 | Not Available | 1525 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1103807 | Not Available | 1250 | Open in IMG/M |
| 3300027756|Ga0209444_10064068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1610 | Open in IMG/M |
| 3300027770|Ga0209086_10312863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300027797|Ga0209107_10348312 | Not Available | 685 | Open in IMG/M |
| 3300027974|Ga0209299_1224768 | Not Available | 678 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1009235 | Not Available | 9583 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1117283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1148102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1085579 | Not Available | 1562 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1357717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1045941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2365 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1080213 | Not Available | 1501 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1009323 | Not Available | 10965 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1093408 | Not Available | 1398 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1006437 | Not Available | 14055 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10536746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300031758|Ga0315907_10061832 | Not Available | 3263 | Open in IMG/M |
| 3300031787|Ga0315900_11012781 | Not Available | 544 | Open in IMG/M |
| 3300031857|Ga0315909_10003848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18070 | Open in IMG/M |
| 3300031857|Ga0315909_10014659 | Not Available | 8092 | Open in IMG/M |
| 3300031857|Ga0315909_10030867 | Not Available | 5203 | Open in IMG/M |
| 3300031857|Ga0315909_10039822 | Not Available | 4459 | Open in IMG/M |
| 3300031857|Ga0315909_10106181 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300031857|Ga0315909_10715516 | Not Available | 647 | Open in IMG/M |
| 3300031951|Ga0315904_10429484 | Not Available | 1188 | Open in IMG/M |
| 3300031951|Ga0315904_11423157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300032116|Ga0315903_10299180 | Not Available | 1361 | Open in IMG/M |
| 3300033816|Ga0334980_0001624 | Not Available | 10366 | Open in IMG/M |
| 3300033816|Ga0334980_0258442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300033981|Ga0334982_0356357 | Not Available | 675 | Open in IMG/M |
| 3300034012|Ga0334986_0159317 | Not Available | 1295 | Open in IMG/M |
| 3300034021|Ga0335004_0214291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300034062|Ga0334995_0054069 | Not Available | 3261 | Open in IMG/M |
| 3300034062|Ga0334995_0361561 | Not Available | 924 | Open in IMG/M |
| 3300034062|Ga0334995_0700885 | Not Available | 570 | Open in IMG/M |
| 3300034064|Ga0335001_0365846 | Not Available | 779 | Open in IMG/M |
| 3300034066|Ga0335019_0222819 | Not Available | 1211 | Open in IMG/M |
| 3300034071|Ga0335028_0349563 | Not Available | 861 | Open in IMG/M |
| 3300034071|Ga0335028_0430426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300034093|Ga0335012_0071521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1972 | Open in IMG/M |
| 3300034101|Ga0335027_0270790 | Not Available | 1163 | Open in IMG/M |
| 3300034103|Ga0335030_0185803 | Not Available | 1457 | Open in IMG/M |
| 3300034116|Ga0335068_0047834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2515 | Open in IMG/M |
| 3300034118|Ga0335053_0630296 | Not Available | 613 | Open in IMG/M |
| 3300034283|Ga0335007_0038339 | Not Available | 3743 | Open in IMG/M |
| 3300034284|Ga0335013_0521747 | Not Available | 707 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 39.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 13.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.02% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.38% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.28% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.82% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.82% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020568 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1099293359 | 3300002408 | Freshwater | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEEN* |
| B570J29032_1099386561 | 3300002408 | Freshwater | MKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED* |
| B570J29032_1099531105 | 3300002408 | Freshwater | MKKKTKVLVLIILSFLTAISLWAASNFKKMSNLDIFNIEED* |
| B570J40625_10001664712 | 3300002835 | Freshwater | MKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED* |
| B570J40625_10006917510 | 3300002835 | Freshwater | MKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFNIEED* |
| B570J40625_1000839838 | 3300002835 | Freshwater | MKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED* |
| B570J40625_1002489621 | 3300002835 | Freshwater | MKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN* |
| B570J40625_1004392993 | 3300002835 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED* |
| B570J40625_1011206153 | 3300002835 | Freshwater | MKKKTKILILISLSISTATTLWIASNLKKISDLDFFDIEKD* |
| JGI25908J49247_100115565 | 3300003277 | Freshwater Lake | MKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD* |
| Ga0065726_1477827 | 3300004369 | Saline | MKKKTKVLVLMVLSLLIAISLWAASNFKKIYDLDIFDVEED* |
| Ga0068876_101757484 | 3300005527 | Freshwater Lake | MWNNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN* |
| Ga0068872_105675212 | 3300005528 | Freshwater Lake | NNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN* |
| Ga0049081_100337297 | 3300005581 | Freshwater Lentic | MKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD* |
| Ga0049080_100872603 | 3300005582 | Freshwater Lentic | MFKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED* |
| Ga0049080_102633322 | 3300005582 | Freshwater Lentic | MWSNDSNMKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD* |
| Ga0049082_101637044 | 3300005584 | Freshwater Lentic | MSKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED* |
| Ga0049084_100305524 | 3300005585 | Freshwater Lentic | MKKKTKIVILIVLSFLTAVSLWTAANFKKISDLDIFDIEED* |
| Ga0105747_11819203 | 3300007974 | Estuary Water | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEKD* |
| Ga0114340_11268282 | 3300008107 | Freshwater, Plankton | MWSNNNKMKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED* |
| Ga0114350_100481114 | 3300008116 | Freshwater, Plankton | MKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED* |
| Ga0114350_10177144 | 3300008116 | Freshwater, Plankton | MWNNNNKMKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD* |
| Ga0114350_10246766 | 3300008116 | Freshwater, Plankton | MKKKTKVLVLIVLSLLTAVSLWAASNFKKISDLDIFDIEED* |
| Ga0114351_13430991 | 3300008117 | Freshwater, Plankton | MYKMWSNDSNMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED* |
| Ga0114355_11325332 | 3300008120 | Freshwater, Plankton | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED* |
| Ga0114355_12326672 | 3300008120 | Freshwater, Plankton | KKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED* |
| Ga0114981_104091983 | 3300009160 | Freshwater Lake | MKKKTKIIVLIILSFLTAVSLWAAANFKKMSDLNIFDVEDD* |
| Ga0114966_105222632 | 3300009161 | Freshwater Lake | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLNIFDIEED* |
| Ga0164293_105776631 | 3300013004 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDVEED* |
| Ga0164293_108695733 | 3300013004 | Freshwater | MKKKTKIIILIVLFFLTAVSLWTAANFKKISDLNLFNIEED* |
| (restricted) Ga0172367_100892496 | 3300013126 | Freshwater | MKKKTKILILVILSFLTALSLWVASNLKELSDLDIFDIDKE* |
| (restricted) Ga0172367_105869081 | 3300013126 | Freshwater | KMWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNVEED* |
| (restricted) Ga0172373_100372755 | 3300013131 | Freshwater | MKKKTKILILIILSFLTALSLWIASNLKGLSDLDIFDIDEE* |
| (restricted) Ga0172373_100382032 | 3300013131 | Freshwater | MKKKTKILILIALSFLTAVTLWAASNLKKISDLDIFNVEED* |
| (restricted) Ga0172373_100538986 | 3300013131 | Freshwater | MKKNTKILVLLFLSFFIATALWVASNLKQLSDLDVFNIEED* |
| (restricted) Ga0172372_100351247 | 3300013132 | Freshwater | MKKKTKILILVILSFLTALSLWIASNLKGLSDLDIFDIDEE* |
| (restricted) Ga0172372_104204793 | 3300013132 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNVEED* |
| Ga0177922_104387462 | 3300013372 | Freshwater | MWSNNNKMKNKIKITILIVLFFLTAVSLWTAANFKKMSDLDIFNIEED* |
| (restricted) Ga0172376_102088673 | 3300014720 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNIEED* |
| (restricted) Ga0172376_107139032 | 3300014720 | Freshwater | MKKKTKILILVALSFLTALTLWVASNLNKLSDLDIFDIDEE* |
| Ga0119954_10071953 | 3300014819 | Freshwater | MWSNDSNMKKKTKILTLVVLSFLTALSLWVASNLKGLSDLDIFDIDEE* |
| Ga0169931_1000654428 | 3300017788 | Freshwater | MKKTKILVLIVLSFLTAISLWAASNFKKISDLDIFDIEED |
| Ga0169931_101404902 | 3300017788 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFNIEED |
| Ga0169931_108955893 | 3300017788 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDVFNIEE |
| Ga0211736_102303062 | 3300020151 | Freshwater | MKKKTKIIILIFLSFLTAVSLWTAANFKKISDLDIFNIEED |
| Ga0211736_102703152 | 3300020151 | Freshwater | MKKQTKILIVMVLSFLTASTLWAASNFKKMSDLDIFNIEED |
| Ga0211734_102275742 | 3300020159 | Freshwater | MWSNDSNMKKKTKILILIILSFLTAVTLWVASNLKKISDLDVFNIEED |
| Ga0211734_113645822 | 3300020159 | Freshwater | VWNNDSDMKKNTKILILITLSFLTAVTLWTASNLKKISDLDIFNVEED |
| Ga0211733_103291554 | 3300020160 | Freshwater | MKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEED |
| Ga0211733_112349512 | 3300020160 | Freshwater | MWSNNNKMKKKTKIIILIVLSFLTAISLWTAANFKKISDLDIFDIEED |
| Ga0211726_1010414412 | 3300020161 | Freshwater | MKKKTKIIILIVLSFLTAISLWTAANFKKISDLDIFDIEED |
| Ga0211726_108561582 | 3300020161 | Freshwater | MKNKTKIIILIVLSFLTAVSLWTATNFKKISDLDIFDIEED |
| Ga0211726_110559615 | 3300020161 | Freshwater | MKKNTKILILLILSFLTAVTLWAASNLKRISDLDIFDVEED |
| Ga0211729_106786654 | 3300020172 | Freshwater | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Ga0211729_107678683 | 3300020172 | Freshwater | MKKKTKIIILIFLSFLTAISLWTAANFKKISDLDIFNIEED |
| Ga0211729_114382252 | 3300020172 | Freshwater | MSKMWSNNNKMKNKTKIIILIVLSFLTAVSLWTATNFKKISDLDIFDIEED |
| Ga0208090_10101653 | 3300020513 | Freshwater | MKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0208202_10079844 | 3300020514 | Freshwater | MKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN |
| Ga0208858_10442961 | 3300020524 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWTASNLKRISDLDIFDVEED |
| Ga0208232_10023542 | 3300020527 | Freshwater | MKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED |
| Ga0208601_10501811 | 3300020532 | Freshwater | MWSNDSNMKKKTKVLVLIILSFLTAISLWAASNFKKMSNLDIFNIEED |
| Ga0208364_10308411 | 3300020533 | Freshwater | NMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0208857_10504333 | 3300020542 | Freshwater | MKKKTKILILITLSFLTAVTLWTASNLKRISDLDIFDVEED |
| Ga0208089_10100262 | 3300020543 | Freshwater | MWSNDSNMKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0208599_10535922 | 3300020554 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDVEED |
| Ga0208231_10188262 | 3300020557 | Freshwater | MKKKTKLLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0208598_10026596 | 3300020568 | Freshwater | MKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0194130_101215677 | 3300021376 | Freshwater Lake | MKKKTKILILVILSFLTALSLWVASNLKELSDLDIFDIDKE |
| Ga0208974_10621984 | 3300027608 | Freshwater Lentic | MKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED |
| Ga0208974_10985633 | 3300027608 | Freshwater Lentic | MKKNTKILILVILSFLTAVTLWAASNLKKISDLDIFDVEDD |
| Ga0208974_11492601 | 3300027608 | Freshwater Lentic | MFKMWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Ga0208960_10289965 | 3300027649 | Freshwater Lentic | MKKKTKIVILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Ga0209443_11646003 | 3300027707 | Freshwater Lake | MKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD |
| (restricted) Ga0247836_10198296 | 3300027728 | Freshwater | MKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEND |
| (restricted) Ga0247833_10187761 | 3300027730 | Freshwater | MKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEDD |
| (restricted) Ga0247833_10811501 | 3300027730 | Freshwater | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEND |
| (restricted) Ga0247833_11038072 | 3300027730 | Freshwater | MKKKTKILILITLSFLTAVTLWAAANLKRISDLDIFDVEED |
| Ga0209444_100640682 | 3300027756 | Freshwater Lake | MSKMWSNHNKMKKKTKIIILIVLSFLTAVSLWTAANFKKMSDLDIFDIEKD |
| Ga0209086_103128633 | 3300027770 | Freshwater Lake | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLNIFDIEED |
| Ga0209107_103483121 | 3300027797 | Freshwater And Sediment | SNNNKMKTKIIILIVLSFLTAVSLWTAANFKKISDSNIFNIEED |
| Ga0209299_12247683 | 3300027974 | Freshwater Lake | MKKKTKIIVLIILSFLTAVSLWAAANFKKMSDLNIFDVEDD |
| (restricted) Ga0247834_100923524 | 3300027977 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKKISDLDVFNIEED |
| (restricted) Ga0247834_11172833 | 3300027977 | Freshwater | MKKKTKITILIVLSFLTAVALWTAASFKKISDLDIFDIEND |
| (restricted) Ga0247834_11481023 | 3300027977 | Freshwater | MKKKTKIIILIILSFLTAVTLWVAANFKKIFDLDIFDIEDD |
| (restricted) Ga0247839_10855795 | 3300028553 | Freshwater | MWRNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEND |
| (restricted) Ga0247839_13577172 | 3300028553 | Freshwater | MWSNNSDMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| (restricted) Ga0247832_10459412 | 3300028557 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAAANLKRISDLDIFDVEED |
| (restricted) Ga0247831_10802131 | 3300028559 | Freshwater | MKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEN |
| (restricted) Ga0247843_100932328 | 3300028569 | Freshwater | MWSNDSNMKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEND |
| (restricted) Ga0247843_10934083 | 3300028569 | Freshwater | MWSNDSNMKKNTKILILLILSFLTAVTLWAASNLKRISDLDIFDVEED |
| (restricted) Ga0247844_10064379 | 3300028571 | Freshwater | MKKKTKIIILIILSFLTAVTLWVAANFKKISDLDIFDIEND |
| (restricted) Ga0247840_105367461 | 3300028581 | Freshwater | MSKMWSNNNKMKKKTKITILIVLSFLTAVALWTAASFKKMSDLDIFDIEND |
| Ga0315907_100618323 | 3300031758 | Freshwater | MWNNNNKMKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD |
| Ga0315900_110127811 | 3300031787 | Freshwater | MWNNDNNMKKKTKILILIILSLLTAMTLWVASNLKKISELNIFDIEEN |
| Ga0315909_1000384837 | 3300031857 | Freshwater | MKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED |
| Ga0315909_100146598 | 3300031857 | Freshwater | MKKKTKIIILMVLFFLTAVSLWVAANFKKISDLNIFDIEKD |
| Ga0315909_100308672 | 3300031857 | Freshwater | MKKKTKVLVLIVLSLLTAVSLWAASNFKKISDLDIFDIEED |
| Ga0315909_100398223 | 3300031857 | Freshwater | MKKKTKILILVILSFLTTLSLWIASNLKELSDLDIFDIDEE |
| Ga0315909_101061816 | 3300031857 | Freshwater | MKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED |
| Ga0315909_107155161 | 3300031857 | Freshwater | KKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0315904_104294844 | 3300031951 | Freshwater | MWSNNNKMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFDIEED |
| Ga0315904_114231571 | 3300031951 | Freshwater | MWSNGDNMKKKTKILILMILSFLTALSLWIASNLKELSDLDIFDIDEE |
| Ga0315903_102991802 | 3300032116 | Freshwater | MWSNNNKMKKKTKVIVLIVLSFLTAVSLWAAANFKKMSDLNIFDIEED |
| Ga0334980_0001624_6466_6612 | 3300033816 | Freshwater | MWSNDSNMKKKTKVLVLIVLSFLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0334980_0258442_346_501 | 3300033816 | Freshwater | MLKMWSNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Ga0334982_0356357_89_235 | 3300033981 | Freshwater | MWSNDSNMKKKTKLLVLIVLSLLTAISLWAASNFKKMSDLDIFNIEED |
| Ga0334986_0159317_586_726 | 3300034012 | Freshwater | MWSNDSNMKKKTKILILLSFLTAVTLWAASNLKRISDLDIFDVEED |
| Ga0335004_0214291_3_137 | 3300034021 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKRISDLDIFDV |
| Ga0334995_0054069_2216_2362 | 3300034062 | Freshwater | MWSNNNKMKKKTKIIILIVLSFLTAVSLWTAANFKKISDLDIFDIEEN |
| Ga0334995_0361561_739_864 | 3300034062 | Freshwater | MKKKTKILILISLSISTATTLWIASNLKKISDLDFFDIEKD |
| Ga0334995_0700885_351_497 | 3300034062 | Freshwater | MWSNDNNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED |
| Ga0335001_0365846_640_777 | 3300034064 | Freshwater | MWSNDSNMKKKTKILILIALSFLTAVTLWAASNLKRISDLDIFDVE |
| Ga0335019_0222819_572_718 | 3300034066 | Freshwater | MWSNDSNMKKKTKILILIALSFLTAVTLWAASNLKRISDLDIFDVEED |
| Ga0335028_0349563_376_501 | 3300034071 | Freshwater | MKKKTKIIILIVLSFLTAALLWTAANFKKISDLDIFDIEED |
| Ga0335028_0430426_509_634 | 3300034071 | Freshwater | MKKKTKVLILIALSISTATTLWITYNLKKISNLDFFDIEKD |
| Ga0335012_0071521_633_758 | 3300034093 | Freshwater | MKKKTKILILITLSFLTATTLWVAYNLKKISDLDIFDIEED |
| Ga0335027_0270790_789_944 | 3300034101 | Freshwater | MSKMWSNNNKMKKKTKITILIVLSFLTAVSLWTAANFKKISDLDIFDIEED |
| Ga0335030_0185803_1023_1169 | 3300034103 | Freshwater | MWSNNNKMKKKTKVIVLIVLSFLTALSLWAAANFKKMSDLNIFNIEED |
| Ga0335068_0047834_15_161 | 3300034116 | Freshwater | MWSNDSNMKKKTKILILITLSFLTAVTLWAASNLKKISDLDIFDVEED |
| Ga0335053_0630296_87_233 | 3300034118 | Freshwater | MWSNDSNMKKKTKTLILITLSFLTAVTLWAASNLKRISDLDIFDVEED |
| Ga0335007_0038339_661_786 | 3300034283 | Freshwater | MKKNTKIIIVVVLSFLTGLALWAASNLKTISDLDIFNIEED |
| Ga0335013_0521747_248_394 | 3300034284 | Freshwater | MWSNNNKMKKKTKIIILIVLFFLTAVSLWTAANFKKISDLNLFNIEED |
| ⦗Top⦘ |