| Basic Information | |
|---|---|
| Family ID | F070855 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGWSA |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 49.59 % |
| % of genes near scaffold ends (potentially truncated) | 20.49 % |
| % of genes from short scaffolds (< 2000 bps) | 65.57 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (49.180 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (18.033 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.164 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (38.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.33% β-sheet: 0.00% Coil/Unstructured: 42.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF10991 | DUF2815 | 11.48 |
| PF13479 | AAA_24 | 4.92 |
| PF13392 | HNH_3 | 4.10 |
| PF00271 | Helicase_C | 4.10 |
| PF09588 | YqaJ | 3.28 |
| PF14090 | HTH_39 | 2.46 |
| PF13481 | AAA_25 | 1.64 |
| PF08774 | VRR_NUC | 1.64 |
| PF00176 | SNF2-rel_dom | 1.64 |
| PF05037 | DUF669 | 0.82 |
| PF11753 | DUF3310 | 0.82 |
| PF07883 | Cupin_2 | 0.82 |
| PF00166 | Cpn10 | 0.82 |
| PF03869 | Arc | 0.82 |
| PF09374 | PG_binding_3 | 0.82 |
| PF00145 | DNA_methylase | 0.82 |
| PF07120 | DUF1376 | 0.82 |
| PF06945 | DUF1289 | 0.82 |
| PF00383 | dCMP_cyt_deam_1 | 0.82 |
| PF01710 | HTH_Tnp_IS630 | 0.82 |
| PF04851 | ResIII | 0.82 |
| PF10926 | DUF2800 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.82 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.82 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.82 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.85 % |
| Unclassified | root | N/A | 31.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000206|M3P_c10000003 | All Organisms → cellular organisms → Bacteria | 19567 | Open in IMG/M |
| 3300002408|B570J29032_109922196 | Not Available | 2719 | Open in IMG/M |
| 3300002835|B570J40625_100114795 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
| 3300002835|B570J40625_100206487 | All Organisms → Viruses → Predicted Viral | 2118 | Open in IMG/M |
| 3300003277|JGI25908J49247_10027274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1644 | Open in IMG/M |
| 3300003277|JGI25908J49247_10036902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1345 | Open in IMG/M |
| 3300004096|Ga0066177_10037372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
| 3300004096|Ga0066177_10191701 | Not Available | 834 | Open in IMG/M |
| 3300004282|Ga0066599_100314641 | Not Available | 930 | Open in IMG/M |
| 3300004481|Ga0069718_16136405 | Not Available | 532 | Open in IMG/M |
| 3300005527|Ga0068876_10233130 | Not Available | 1060 | Open in IMG/M |
| 3300005581|Ga0049081_10009946 | All Organisms → Viruses → Predicted Viral | 3606 | Open in IMG/M |
| 3300005581|Ga0049081_10119886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 974 | Open in IMG/M |
| 3300005581|Ga0049081_10120793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300005581|Ga0049081_10315939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300005582|Ga0049080_10152100 | Not Available | 775 | Open in IMG/M |
| 3300005805|Ga0079957_1028573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3732 | Open in IMG/M |
| 3300005805|Ga0079957_1163722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
| 3300006030|Ga0075470_10050188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300008107|Ga0114340_1016767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3496 | Open in IMG/M |
| 3300008107|Ga0114340_1254941 | Not Available | 533 | Open in IMG/M |
| 3300008113|Ga0114346_1089655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1432 | Open in IMG/M |
| 3300008262|Ga0114337_1036018 | All Organisms → cellular organisms → Bacteria | 2757 | Open in IMG/M |
| 3300008266|Ga0114363_1085076 | Not Available | 1169 | Open in IMG/M |
| 3300008267|Ga0114364_1000793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21193 | Open in IMG/M |
| 3300008267|Ga0114364_1002430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10572 | Open in IMG/M |
| 3300008448|Ga0114876_1133113 | Not Available | 934 | Open in IMG/M |
| 3300008448|Ga0114876_1163396 | Not Available | 797 | Open in IMG/M |
| 3300009081|Ga0105098_10000820 | All Organisms → cellular organisms → Bacteria | 11053 | Open in IMG/M |
| 3300009081|Ga0105098_10771733 | Not Available | 517 | Open in IMG/M |
| 3300009082|Ga0105099_10138148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
| 3300009082|Ga0105099_10705688 | Not Available | 626 | Open in IMG/M |
| 3300009085|Ga0105103_10065208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
| 3300009085|Ga0105103_10128666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300009165|Ga0105102_10113618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300009165|Ga0105102_10124971 | Not Available | 1232 | Open in IMG/M |
| 3300009165|Ga0105102_10150265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
| 3300009165|Ga0105102_10349725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300009165|Ga0105102_10423550 | Not Available | 711 | Open in IMG/M |
| 3300009165|Ga0105102_10622328 | Not Available | 598 | Open in IMG/M |
| 3300009165|Ga0105102_10875416 | Not Available | 516 | Open in IMG/M |
| 3300009168|Ga0105104_10870059 | Not Available | 527 | Open in IMG/M |
| 3300009169|Ga0105097_10534748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300009170|Ga0105096_10168121 | Not Available | 1105 | Open in IMG/M |
| 3300009194|Ga0114983_1002192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7357 | Open in IMG/M |
| 3300009194|Ga0114983_1002422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6959 | Open in IMG/M |
| 3300009194|Ga0114983_1065621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300009419|Ga0114982_1063102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300009419|Ga0114982_1084314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300011184|Ga0136709_1056127 | Not Available | 548 | Open in IMG/M |
| 3300011335|Ga0153698_1076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39996 | Open in IMG/M |
| 3300012348|Ga0157140_10000672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4138 | Open in IMG/M |
| 3300012666|Ga0157498_1059771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300013004|Ga0164293_10402217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300017723|Ga0181362_1108825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017736|Ga0181365_1104650 | Not Available | 684 | Open in IMG/M |
| 3300017766|Ga0181343_1161371 | Not Available | 622 | Open in IMG/M |
| 3300017766|Ga0181343_1166815 | Not Available | 610 | Open in IMG/M |
| 3300017777|Ga0181357_1298144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300019784|Ga0181359_1002467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5383 | Open in IMG/M |
| 3300019784|Ga0181359_1023273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2359 | Open in IMG/M |
| 3300019784|Ga0181359_1035536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1929 | Open in IMG/M |
| 3300020530|Ga0208235_1025999 | Not Available | 709 | Open in IMG/M |
| 3300021961|Ga0222714_10291192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300021961|Ga0222714_10580721 | Not Available | 563 | Open in IMG/M |
| 3300022190|Ga0181354_1012653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2533 | Open in IMG/M |
| 3300022208|Ga0224495_10302064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300025075|Ga0209615_101858 | Not Available | 1388 | Open in IMG/M |
| 3300027365|Ga0209300_1000200 | All Organisms → cellular organisms → Bacteria | 36585 | Open in IMG/M |
| 3300027365|Ga0209300_1002720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6399 | Open in IMG/M |
| 3300027608|Ga0208974_1001012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11179 | Open in IMG/M |
| 3300027608|Ga0208974_1041717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1345 | Open in IMG/M |
| 3300027608|Ga0208974_1082667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300027608|Ga0208974_1167488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027693|Ga0209704_1026565 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300027710|Ga0209599_10000259 | Not Available | 37418 | Open in IMG/M |
| 3300027710|Ga0209599_10077287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300027792|Ga0209287_10218053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300027792|Ga0209287_10243527 | Not Available | 687 | Open in IMG/M |
| 3300027797|Ga0209107_10248039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300027900|Ga0209253_10316017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
| 3300027900|Ga0209253_10359204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300027900|Ga0209253_11078182 | Not Available | 548 | Open in IMG/M |
| 3300027956|Ga0209820_1003257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3964 | Open in IMG/M |
| 3300027956|Ga0209820_1201070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300027972|Ga0209079_10013391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2725 | Open in IMG/M |
| 3300028027|Ga0247722_10051510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300031784|Ga0315899_10184908 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300031784|Ga0315899_10576306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300031857|Ga0315909_10086890 | Not Available | 2739 | Open in IMG/M |
| 3300031857|Ga0315909_10113498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2307 | Open in IMG/M |
| 3300031857|Ga0315909_10243004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1388 | Open in IMG/M |
| 3300031857|Ga0315909_10271931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
| 3300031857|Ga0315909_10498098 | Not Available | 842 | Open in IMG/M |
| 3300031857|Ga0315909_10619902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300031885|Ga0315285_10625164 | Not Available | 709 | Open in IMG/M |
| 3300031951|Ga0315904_10141239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2455 | Open in IMG/M |
| 3300031951|Ga0315904_10265732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1632 | Open in IMG/M |
| 3300031951|Ga0315904_10725392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300031963|Ga0315901_10000713 | Not Available | 48708 | Open in IMG/M |
| 3300031963|Ga0315901_10970174 | Not Available | 597 | Open in IMG/M |
| 3300032046|Ga0315289_10838988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300032116|Ga0315903_10017473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8079 | Open in IMG/M |
| 3300032116|Ga0315903_10831055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300033981|Ga0334982_0000824 | Not Available | 19401 | Open in IMG/M |
| 3300033984|Ga0334989_0080282 | All Organisms → Viruses → Predicted Viral | 1803 | Open in IMG/M |
| 3300033993|Ga0334994_0005158 | Not Available | 9193 | Open in IMG/M |
| 3300033993|Ga0334994_0005587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8841 | Open in IMG/M |
| 3300033993|Ga0334994_0036403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3155 | Open in IMG/M |
| 3300034012|Ga0334986_0016027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5213 | Open in IMG/M |
| 3300034012|Ga0334986_0018844 | All Organisms → Viruses → Predicted Viral | 4743 | Open in IMG/M |
| 3300034012|Ga0334986_0042478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2931 | Open in IMG/M |
| 3300034012|Ga0334986_0043526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2888 | Open in IMG/M |
| 3300034012|Ga0334986_0202650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300034101|Ga0335027_0461697 | Not Available | 806 | Open in IMG/M |
| 3300034104|Ga0335031_0127812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
| 3300034104|Ga0335031_0246131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
| 3300034106|Ga0335036_0102992 | All Organisms → Viruses → Predicted Viral | 2093 | Open in IMG/M |
| 3300034106|Ga0335036_0238203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
| 3300034111|Ga0335063_0000845 | Not Available | 18011 | Open in IMG/M |
| 3300034356|Ga0335048_0018806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4892 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 18.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.48% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.38% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 7.38% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.46% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.64% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.64% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.64% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.82% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.82% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.82% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.82% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.82% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000206 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_1000000323 | 3300000206 | Lotic | MKHHKYHYHPQVKAAKLNARAEAALGFLLAIAIGIGLAACLFFGLSA* |
| B570J29032_1099221965 | 3300002408 | Freshwater | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAVLVYGWTL* |
| B570J40625_1001147954 | 3300002835 | Freshwater | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGWST* |
| B570J40625_1002064876 | 3300002835 | Freshwater | MKHHKYHQHYQVKASKLHACAEAALDLITALVVGIGLAACLFYGWSA* |
| JGI25908J49247_100272741 | 3300003277 | Freshwater Lake | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA* |
| JGI25908J49247_100369024 | 3300003277 | Freshwater Lake | MKHQKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA* |
| Ga0066177_100373723 | 3300004096 | Freshwater Lake | MKHHKYHQHYQVKAAKLHARAEAALDLLTAIVIGIALAACLFYGWSA* |
| Ga0066177_101917011 | 3300004096 | Freshwater Lake | MKHPKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALF |
| Ga0066599_1003146411 | 3300004282 | Freshwater | MKHHKYNQHYQVKAAKLHARAEAALDFLTAIAIGIALAACLFYGWSA* |
| Ga0069718_161364051 | 3300004481 | Sediment | MKHLKYHQHYQVKAAKLHARAEAALDLITALVIGVALAACLFYGLSA* |
| Ga0068876_102331303 | 3300005527 | Freshwater Lake | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAALFYGWSA* |
| Ga0049081_100099465 | 3300005581 | Freshwater Lentic | MKHHKYHQHYQVRAAKLHARAEAALSIALACFIGIGMAALLVAWWSS* |
| Ga0049081_101198864 | 3300005581 | Freshwater Lentic | MKHHKYHQHYQVRAAKLHARAEAALDLITALVVGIGLAAALFYGWSA* |
| Ga0049081_101207931 | 3300005581 | Freshwater Lentic | MKHHKYHQHYQVKAAKLHARSEAALDLITALVIGIGLAAALFYGWSA* |
| Ga0049081_103159392 | 3300005581 | Freshwater Lentic | MKHHKYHQHYQVKAAKLHARAEAALDLITALVVGIGLAAALFYGWSA* |
| Ga0049080_101521004 | 3300005582 | Freshwater Lentic | MKHHKYHQHYQVKAAKLHARAEAALDLITALVVGIGLAAALFYGW |
| Ga0079957_10285736 | 3300005805 | Lake | MKHHKYHQHYQVKAAKLHARAEACLDVALAVVIGIGLAACLFYGLSA* |
| Ga0079957_11637225 | 3300005805 | Lake | HHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAALFYGWSA* |
| Ga0075470_100501885 | 3300006030 | Aqueous | LSTERKAMKHQKYHQHYQVRAAKLHARAEAALDLLTALVIGIGLAACLFYGWSA* |
| Ga0114340_10167675 | 3300008107 | Freshwater, Plankton | MKHHKYHQHYQVRAAKLHARAEAALDFITAIVIGLGLAAALFYGWSA* |
| Ga0114340_12549413 | 3300008107 | Freshwater, Plankton | MKHHKYHQHYQVRAAKLHARAEAALDLITTLVIGIGLAACLFYGWSA* |
| Ga0114346_10896551 | 3300008113 | Freshwater, Plankton | RKTMKHHKYHQHYQVRAAKLHARAEAALDFITAIVIGLGLAAALFYGWSA* |
| Ga0114337_10360187 | 3300008262 | Freshwater, Plankton | MKHHHLHQHYQVRAAKLSFRAQAALDFLCNLAVALVIGVGMAALLVAWWSS* |
| Ga0114363_10850762 | 3300008266 | Freshwater, Plankton | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGWSA* |
| Ga0114364_100079318 | 3300008267 | Freshwater, Plankton | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGWSA* |
| Ga0114364_100243011 | 3300008267 | Freshwater, Plankton | MKHHKYHQHYQVKAAKLHARAEAAYDLITALIIGIGLAACLFYGWSA* |
| Ga0114876_11331133 | 3300008448 | Freshwater Lake | MKHQKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGWSA* |
| Ga0114876_11633962 | 3300008448 | Freshwater Lake | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLSACLFYGWSA* |
| Ga0105098_1000082015 | 3300009081 | Freshwater Sediment | MKHHKYHYHPQVKAAKLHGRAQAALDLVLALAIGIGLAALLVAWWSS* |
| Ga0105098_107717331 | 3300009081 | Freshwater Sediment | MKHHKYHQHYQVRAAKLHARAEAALDLNTALVIGIGLAACLFYGWSS* |
| Ga0105099_101381486 | 3300009082 | Freshwater Sediment | MKHHKYNQHYQVRAAKLHARAEAALDLITALVIGIALAACLFYGWSS* |
| Ga0105099_107056882 | 3300009082 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGLSA* |
| Ga0105103_100652083 | 3300009085 | Freshwater Sediment | MKHQKYHQHYQVKAAKLHARAEAALDLLTALVIGIGLAACLFYGLSA* |
| Ga0105103_101286662 | 3300009085 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFFGLSA* |
| Ga0105102_101136183 | 3300009165 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAAYDIALAVVIGIGLAAVLVYGWTL* |
| Ga0105102_101249714 | 3300009165 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAALDLITAIVIGIALAACLFYGLSS* |
| Ga0105102_101502654 | 3300009165 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGVGLAAVLVYGWAL* |
| Ga0105102_103497253 | 3300009165 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEACLDVALAVAIGIGLAALLFYGLSA* |
| Ga0105102_104235502 | 3300009165 | Freshwater Sediment | MKHQKYHQHYQVKAAKLHGRADAAYGIALACIIGIGLAACLFYGLSA* |
| Ga0105102_106223281 | 3300009165 | Freshwater Sediment | MKHHKYNQYYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGLSA* |
| Ga0105102_108754161 | 3300009165 | Freshwater Sediment | MKHHKYNQHYQVKAAKLHARAEAALDLLTAIVIGIALAACLFYGWSS* |
| Ga0105104_108700592 | 3300009168 | Freshwater Sediment | MKHQKYHQHYQVKAAKLHSRADAALSVALACAIGIGL |
| Ga0105097_105347483 | 3300009169 | Freshwater Sediment | MKHHKYNQHYQVKAAKLHARAEAALDLLTAIVIGIGLAA |
| Ga0105096_101681213 | 3300009170 | Freshwater Sediment | MKHHKYNQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGLSA* |
| Ga0114983_10021928 | 3300009194 | Deep Subsurface | MKHHKYHQHYQVRAAKLHARAEAALDLLAALVIGIGLAAALFYGWSA* |
| Ga0114983_10024228 | 3300009194 | Deep Subsurface | MKHLNQYPEVKNAKANARADACLDIALACVIGIGLAACLFFGLSS* |
| Ga0114983_10656212 | 3300009194 | Deep Subsurface | MKHHKYHQHYQVRAAKLHARADAALDLLTALAIGIGLAALLVAWWSA* |
| Ga0114982_10631022 | 3300009419 | Deep Subsurface | MKHHKYHQHYQVRAAKLHARAEAALDLLTALVIGIGLAALLFYGWSA* |
| Ga0114982_10843143 | 3300009419 | Deep Subsurface | MKHQKYHQHYQVKAAKLHGRADAALSIALACVIGIALAACLFFGLSA* |
| Ga0136551_10613651 | 3300010388 | Pond Fresh Water | YQVKAAKLHGRAQAALDLVLALAIGVGLAVLLVAWWSS* |
| Ga0136709_10561272 | 3300011184 | Freshwater | MKHHKYHQHYQVKAAKIHAQADAAYDITLAIIIGVALAAVLVYGWAL* |
| Ga0153698_107653 | 3300011335 | Freshwater | MKHQKYHQHYQVKAAKLHGRADACLDIALACVIGIGLAACLFFGLSS* |
| Ga0157140_100006726 | 3300012348 | Freshwater | MKHHKYHQHYQVRAAKLHARADAALDLLTALVIGIGLAACLFYGWSA* |
| Ga0157498_10597714 | 3300012666 | Freshwater, Surface Ice | ICPGNPATGLFGEIMKHHKYQQHYQVKAAKLHARAEAALDLITALVIGIGLAAVLVYGWTL* |
| Ga0164293_104022173 | 3300013004 | Freshwater | MHICPGNPATGLFGEIMKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAVLVYGWTL* |
| Ga0181362_11088252 | 3300017723 | Freshwater Lake | MKHQKYHQHYQVRAAKLHARAEAALDLITALVIGNGMGA |
| Ga0181365_11046501 | 3300017736 | Freshwater Lake | RERDKEHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA |
| Ga0181343_11613712 | 3300017766 | Freshwater Lake | MKHHKYHQYYQVKAAKLHGRADAAYGIALACIIGIGLAACLFYGLSA |
| Ga0181343_11668152 | 3300017766 | Freshwater Lake | MKHHNYHQHYQVKAAKLHGRADAAYGIALACIIGIGLAACLFYGLSA |
| Ga0181357_12981442 | 3300017777 | Freshwater Lake | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYVWSA |
| Ga0181359_10024678 | 3300019784 | Freshwater Lake | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA |
| Ga0181359_10232735 | 3300019784 | Freshwater Lake | MKHQKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA |
| Ga0181359_10355364 | 3300019784 | Freshwater Lake | MKHHKYHQHYQVKAAKLHARAEAALDLLTAIVIGIALAACLFYGWSA |
| Ga0208235_10259991 | 3300020530 | Freshwater | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAVLVYGWTL |
| Ga0222714_102911925 | 3300021961 | Estuarine Water | PTQGVSMKHHKYHQHYQVKAAKLHARADAALSIALACAIGIGLAACLFYGLSS |
| Ga0222714_105807211 | 3300021961 | Estuarine Water | MKHHKYHQHYQVKAAKLHARADAALSIALACAIGIGLAACL |
| Ga0181354_10126532 | 3300022190 | Freshwater Lake | MKHPKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFYGWSA |
| Ga0224495_103020642 | 3300022208 | Sediment | MKHQKYHQHYQVKAAKLHARADAAYGIALACIIGIVLAACLFYGLSA |
| Ga0209615_1018582 | 3300025075 | Freshwater | MKHHKYHQHYQVKAAKIHARADAAYDIALAIIIGVALAAVLVYGWAL |
| Ga0209300_100020049 | 3300027365 | Deep Subsurface | MKHHKYHQHYQVRAAKLHARAEAALDLLAALVIGIGLAAALFYGWSA |
| Ga0209300_10027202 | 3300027365 | Deep Subsurface | MKHLNQYPEVKNAKANARADACLDIALACVIGIGLAACLFFGLSS |
| Ga0208974_10010123 | 3300027608 | Freshwater Lentic | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAALFYGWSA |
| Ga0208974_10417171 | 3300027608 | Freshwater Lentic | KHHKYHQHYQVRAAKLHARAEAALDFITAIVIGLGLAAALFYGWSA |
| Ga0208974_10826673 | 3300027608 | Freshwater Lentic | MKHHKYHQHYQVKAAKLHARAEAALDLITALVVGIGLAAALFYGWSA |
| Ga0208974_11674881 | 3300027608 | Freshwater Lentic | MKHQKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAA |
| Ga0209704_10265651 | 3300027693 | Freshwater Sediment | MKHHKYNQHYQVKAAKLHARAEAALDLLTAIVIGIALAACLFYGWSS |
| Ga0209599_1000025954 | 3300027710 | Deep Subsurface | MKHQKYHQHYQVKAAKLHGRADAALSIALACVIGIALAACLFFGLSA |
| Ga0209599_100772872 | 3300027710 | Deep Subsurface | MKHHKYHQHYQVRAAKLHARADAALDLLTALAIGIGLAALLVAWWSA |
| Ga0209287_102180533 | 3300027792 | Freshwater Sediment | MKHHKYNQHYQVRAAKLHARAEAALDLITALVIGIALAACLFYGWSS |
| Ga0209287_102435272 | 3300027792 | Freshwater Sediment | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGLSA |
| Ga0209107_102480391 | 3300027797 | Freshwater And Sediment | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAAALFFGWSA |
| Ga0209253_103160172 | 3300027900 | Freshwater Lake Sediment | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGWSA |
| Ga0209253_103592043 | 3300027900 | Freshwater Lake Sediment | MKHHKYHQHYQVKAAKLHARADAALSVALACAIGI |
| Ga0209253_110781821 | 3300027900 | Freshwater Lake Sediment | MKHHKYHQHYQVKAAKLHARADAALSIALACAIGIGLAACLFYGLSA |
| Ga0209820_10032574 | 3300027956 | Freshwater Sediment | MKHHKYHYHPQVKAAKLHGRAQAALDLVLALAIGIGLAALLVAWWSS |
| Ga0209820_12010704 | 3300027956 | Freshwater Sediment | RKEMKHHKYHQHYQIKAAKLHRRAEAALDLITALVIGVGLAAVLVYGWAL |
| Ga0209079_100133914 | 3300027972 | Freshwater Sediment | MKHQKYHQHYQVKAAKLHARAEAALDLLTALVIGIGLAACLFYGLSA |
| Ga0247722_100515106 | 3300028027 | Deep Subsurface Sediment | STERKTMKHHKYHQHYQVRAAKLHARAEAALDLLTALVIGIGLAALLFYGWSA |
| Ga0315899_101849083 | 3300031784 | Freshwater | MKHHHLHQHYQIRAAKLHSRAQAALDFLCNLAVALVIGVGLAALLVAWWSS |
| Ga0315899_105763065 | 3300031784 | Freshwater | FASLTKKDNLMKHHNLNRYYEVRAAKLHIRADAALDFAAAVLIGVAMAALLVAWWSS |
| Ga0315909_100868905 | 3300031857 | Freshwater | MKHHKYHQHYQVRAAKMNARTEAAVDFLVAVLIGIGLAV |
| Ga0315909_101134984 | 3300031857 | Freshwater | MKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAACLFYGWSA |
| Ga0315909_102430046 | 3300031857 | Freshwater | MKHHHLHQHYQIRAAKLHSRAQAAFDFLCNLAVATAIGVGLAALLVAWWSS |
| Ga0315909_102719315 | 3300031857 | Freshwater | MKHHKYHQHYQVRAAKMHSRAEAAYDFLVALVIGVGMAALLVAWWST |
| Ga0315909_104980981 | 3300031857 | Freshwater | MKHHKYHQHYQVRAAKLHFRAQAAFDFLCNLAVATAIGVGLAALLVAW |
| Ga0315909_106199023 | 3300031857 | Freshwater | MKHHKYHQHYQVRAAKLHFRAQAAFDFLCNLAVALVIGVGMAALLVAWWSS |
| Ga0315285_106251642 | 3300031885 | Sediment | MKHHKYHQHYQVRAAKLHARAEAALDLLTALVIGIGLAACLFYGWSA |
| Ga0315904_101412393 | 3300031951 | Freshwater | MNKELTMKHHNHFQHYQVRAAKMHSRAEAAYDFLVALLIGVGLAALLVAWWSS |
| Ga0315904_102657326 | 3300031951 | Freshwater | MKHHKYHQHYQVRAAKLHARAEAALDLITAIVIGIGLAACLFYGWSA |
| Ga0315904_107253922 | 3300031951 | Freshwater | MKHHKYHQHYQVKAAKLHARAEAAYDLITALIIGIGLAACLFYGWSA |
| Ga0315901_100007138 | 3300031963 | Freshwater | MKHHHLHQHYQVRAAKLSFRAQAALDFLCNLAVALVIGVGMAALLVAWWSS |
| Ga0315901_109701742 | 3300031963 | Freshwater | LLIGHLNNFNVQQKMKHHKYHYHPQVKAAKLHGRAQAALDLVLALAIGVGLAVLLVAWWS |
| Ga0315289_108389883 | 3300032046 | Sediment | MKHHKYHQHYQVRAAKMHARAEAALDVVLAVVIGIGLAVLLVAWWSA |
| Ga0315903_1001747312 | 3300032116 | Freshwater | MKHHKYHQHYQVRAAKLHFRAQAAFDFLCNLAVATAIGIGLAALLVAWWSS |
| Ga0315903_108310551 | 3300032116 | Freshwater | HYQVRAAKLSFRAQAALDFLCNLAVALVIGVGMAALLVAWWSS |
| Ga0334982_0000824_5068_5211 | 3300033981 | Freshwater | MKHHKYNQHYQVKATKLHARADAALSIALACVIGIALAACLFFGLSA |
| Ga0334989_0080282_1190_1354 | 3300033984 | Freshwater | LGLFGETMKHHKYHQHYQVKAAKIHRRAEAALDLITALVIGIGLAAVLVYGWTL |
| Ga0334994_0005158_5606_5749 | 3300033993 | Freshwater | MKHHKYHQHYQVKASKLHACAEAALDLITALVVGIGLAACLFYGWSA |
| Ga0334994_0005587_7828_7971 | 3300033993 | Freshwater | MKHHKYHQHYQVRAAKLHARAEAALDLITALVIGIGLAACLFYGWST |
| Ga0334994_0036403_1741_1884 | 3300033993 | Freshwater | MKHHKYHYHPQVKAAKLHSRAEAALDLVLALAIGIGLAALLVAWWSS |
| Ga0334986_0016027_373_516 | 3300034012 | Freshwater | MKHHKYHQHYQVKAAKLHWRAEAALDLITALVIGIGLAAVLVYGWTL |
| Ga0334986_0018844_504_647 | 3300034012 | Freshwater | MKHHKYHQHYQVKAAKLHGRADAAYGIALACIIGIGLAACLFYGLSA |
| Ga0334986_0042478_472_615 | 3300034012 | Freshwater | MKHHKYHQHYQVKAAKLHGRAEAALDLITALVIGIGLAAVLVYGWTL |
| Ga0334986_0043526_1786_1929 | 3300034012 | Freshwater | MKHHKYHQHYQVKAAKLHARAEAAYDIALAIVIGIGLAAVLVYGWTL |
| Ga0334986_0202650_856_999 | 3300034012 | Freshwater | MKHHKYHQHYQVKVAKLHARAEAALDLLTALVIGIGLAACLFYGWSA |
| Ga0335027_0461697_450_593 | 3300034101 | Freshwater | MKHQKYHQHYQVKAAKLHARADAALSVALACAIGIGLAACLFYGLSS |
| Ga0335031_0127812_1106_1249 | 3300034104 | Freshwater | MKHHKYNQHYQVRAAKLHGRADAALSIALACVIGVALAACLFFGLSA |
| Ga0335031_0246131_149_292 | 3300034104 | Freshwater | MKHHKYHQHYQVKAAKLHAHADAALSVALACAIGIGLAACLFYGLSA |
| Ga0335036_0102992_828_971 | 3300034106 | Freshwater | MKHHKYHQHYQVKAAKLHRRAEAALDLITALVIGIGLAAVLVYGWTL |
| Ga0335036_0238203_636_779 | 3300034106 | Freshwater | MKHHKYHQHYQVKAAKLHACADAALSVALACAIGIGLAACLFYGLSS |
| Ga0335063_0000845_8021_8164 | 3300034111 | Freshwater | MKHHKYNQHYQVRAAKLHARAEAALSIALACFIGIGMAALLVAWWSS |
| Ga0335048_0018806_4433_4597 | 3300034356 | Freshwater | LGLFGEIMKHHKYHQHYQVKAAKLHARAEAALDLITALVIGIGLAAVLVYGWTL |
| ⦗Top⦘ |