Metagenome Family F070736

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F070736
Family Type	Metagenome
Number of Sequences	122
Average Sequence Length	38 residues
Representative Sequence	MLELGKEEREKQKAQGKGINGRSHFVLVIKTLSECDHI
Number of Associated Samples	61
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	3.33 %
% of genes near scaffold ends (potentially truncated)	64.75 %
% of genes from short scaffolds (< 2000 bps)	98.36 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (93.443 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.721 % of family members)
Environment Ontology (ENVO)	Unclassified (96.721 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (96.721 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF03732	Retrotrans_gag	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
All Organisms	root	All Organisms	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
cellular organisms	root	All Organisms → cellular organisms	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	2.46 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	2.46 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.82 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.82 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	0.82 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.82 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.44 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.82 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.82 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101863348	Not Available	538	Open in IMG/M
3300005459\|Ga0068867_101067983	Not Available	735	Open in IMG/M
3300011119\|Ga0105246_12530423	Not Available	506	Open in IMG/M
3300013297\|Ga0157378_11236196	Not Available	787	Open in IMG/M
3300015267\|Ga0182122_1062339	Not Available	525	Open in IMG/M
3300015268\|Ga0182154_1009701	Not Available	866	Open in IMG/M
3300015268\|Ga0182154_1020838	Not Available	710	Open in IMG/M
3300015268\|Ga0182154_1046396	Not Available	574	Open in IMG/M
3300015269\|Ga0182113_1038597	Not Available	664	Open in IMG/M
3300015269\|Ga0182113_1092526	Not Available	510	Open in IMG/M
3300015274\|Ga0182188_1020106	Not Available	675	Open in IMG/M
3300015274\|Ga0182188_1024643	Not Available	641	Open in IMG/M
3300015274\|Ga0182188_1029991	Not Available	609	Open in IMG/M
3300015276\|Ga0182170_1045143	Not Available	589	Open in IMG/M
3300015276\|Ga0182170_1063520	Not Available	534	Open in IMG/M
3300015277\|Ga0182128_1069021	Not Available	524	Open in IMG/M
3300015279\|Ga0182174_1016493	Not Available	801	Open in IMG/M
3300015279\|Ga0182174_1040380	Not Available	629	Open in IMG/M
3300015279\|Ga0182174_1064319	Not Available	549	Open in IMG/M
3300015279\|Ga0182174_1081277	Not Available	511	Open in IMG/M
3300015281\|Ga0182160_1075569	Not Available	519	Open in IMG/M
3300015282\|Ga0182124_1016755	Not Available	782	Open in IMG/M
3300015282\|Ga0182124_1020219	Not Available	744	Open in IMG/M
3300015282\|Ga0182124_1035394	Not Available	641	Open in IMG/M
3300015282\|Ga0182124_1079510	Not Available	508	Open in IMG/M
3300015283\|Ga0182156_1015183	Not Available	830	Open in IMG/M
3300015283\|Ga0182156_1032512	Not Available	672	Open in IMG/M
3300015283\|Ga0182156_1078104	Not Available	521	Open in IMG/M
3300015285\|Ga0182186_1025438	Not Available	708	Open in IMG/M
3300015285\|Ga0182186_1042692	Not Available	612	Open in IMG/M
3300015286\|Ga0182176_1061249	Not Available	560	Open in IMG/M
3300015286\|Ga0182176_1066358	Not Available	546	Open in IMG/M
3300015287\|Ga0182171_1022112	Not Available	746	Open in IMG/M
3300015287\|Ga0182171_1033634	Not Available	666	Open in IMG/M
3300015289\|Ga0182138_1018463	Not Available	784	Open in IMG/M
3300015292\|Ga0182141_1017941	Not Available	807	Open in IMG/M
3300015292\|Ga0182141_1067925	Not Available	555	Open in IMG/M
3300015294\|Ga0182126_1082386	Not Available	527	Open in IMG/M
3300015295\|Ga0182175_1034909	Not Available	684	Open in IMG/M
3300015295\|Ga0182175_1086170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	524	Open in IMG/M
3300015296\|Ga0182157_1022572	Not Available	784	Open in IMG/M
3300015296\|Ga0182157_1031565	Not Available	713	Open in IMG/M
3300015296\|Ga0182157_1050528	Not Available	625	Open in IMG/M
3300015296\|Ga0182157_1072506	Not Available	561	Open in IMG/M
3300015298\|Ga0182106_1071319	Not Available	563	Open in IMG/M
3300015298\|Ga0182106_1101914	Not Available	503	Open in IMG/M
3300015299\|Ga0182107_1042680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	659	Open in IMG/M
3300015299\|Ga0182107_1082915	Not Available	541	Open in IMG/M
3300015300\|Ga0182108_1031124	Not Available	727	Open in IMG/M
3300015302\|Ga0182143_1046000	Not Available	645	Open in IMG/M
3300015303\|Ga0182123_1043186	Not Available	639	Open in IMG/M
3300015304\|Ga0182112_1051358	Not Available	626	Open in IMG/M
3300015304\|Ga0182112_1105170	Not Available	503	Open in IMG/M
3300015308\|Ga0182142_1108710	Not Available	512	Open in IMG/M
3300015314\|Ga0182140_1089568	Not Available	546	Open in IMG/M
3300015321\|Ga0182127_1040204	Not Available	713	Open in IMG/M
3300015321\|Ga0182127_1119240	Not Available	509	Open in IMG/M
3300015322\|Ga0182110_1124003	Not Available	502	Open in IMG/M
3300015323\|Ga0182129_1044759	Not Available	670	Open in IMG/M
3300015341\|Ga0182187_1167717	Not Available	537	Open in IMG/M
3300015342\|Ga0182109_1102224	Not Available	675	Open in IMG/M
3300015342\|Ga0182109_1119845	Not Available	636	Open in IMG/M
3300015342\|Ga0182109_1169661	Not Available	559	Open in IMG/M
3300015342\|Ga0182109_1176793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	550	Open in IMG/M
3300015343\|Ga0182155_1094507	Not Available	689	Open in IMG/M
3300015343\|Ga0182155_1118067	Not Available	638	Open in IMG/M
3300015343\|Ga0182155_1139896	Not Available	600	Open in IMG/M
3300015344\|Ga0182189_1055147	Not Available	845	Open in IMG/M
3300015344\|Ga0182189_1171858	Not Available	561	Open in IMG/M
3300015345\|Ga0182111_1030785	Not Available	1075	Open in IMG/M
3300015345\|Ga0182111_1122059	Not Available	658	Open in IMG/M
3300015346\|Ga0182139_1092750	Not Available	729	Open in IMG/M
3300015346\|Ga0182139_1104695	Not Available	697	Open in IMG/M
3300015346\|Ga0182139_1213001	Not Available	531	Open in IMG/M
3300015347\|Ga0182177_1113066	Not Available	680	Open in IMG/M
3300015347\|Ga0182177_1154863	Not Available	604	Open in IMG/M
3300015347\|Ga0182177_1199019	Not Available	549	Open in IMG/M
3300015351\|Ga0182161_1030064	Not Available	1146	Open in IMG/M
3300015351\|Ga0182161_1083297	Not Available	794	Open in IMG/M
3300015351\|Ga0182161_1161122	Not Available	616	Open in IMG/M
3300015351\|Ga0182161_1184840	Not Available	584	Open in IMG/M
3300015355\|Ga0182159_1209767	Not Available	630	Open in IMG/M
3300015355\|Ga0182159_1226127	Not Available	610	Open in IMG/M
3300015355\|Ga0182159_1249195	Not Available	584	Open in IMG/M
3300015355\|Ga0182159_1303902	Not Available	535	Open in IMG/M
3300015361\|Ga0182145_1148003	Not Available	551	Open in IMG/M
3300015361\|Ga0182145_1150649	Not Available	548	Open in IMG/M
3300017404\|Ga0182203_1086763	Not Available	619	Open in IMG/M
3300017404\|Ga0182203_1097704	Not Available	597	Open in IMG/M
3300017409\|Ga0182204_1080448	Not Available	569	Open in IMG/M
3300017409\|Ga0182204_1105436	Not Available	523	Open in IMG/M
3300017411\|Ga0182208_1057588	Not Available	647	Open in IMG/M
3300017411\|Ga0182208_1112241	Not Available	526	Open in IMG/M
3300017413\|Ga0182222_1029342	Not Available	705	Open in IMG/M
3300017413\|Ga0182222_1081031	Not Available	543	Open in IMG/M
3300017415\|Ga0182202_1105157	Not Available	551	Open in IMG/M
3300017415\|Ga0182202_1135306	Not Available	507	Open in IMG/M
3300017415\|Ga0182202_1140422	Not Available	501	Open in IMG/M
3300017417\|Ga0182230_1064286	Not Available	652	Open in IMG/M
3300017425\|Ga0182224_1085772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	621	Open in IMG/M
3300017425\|Ga0182224_1106433	Not Available	581	Open in IMG/M
3300017425\|Ga0182224_1131695	Not Available	542	Open in IMG/M
3300017427\|Ga0182190_1076963	Not Available	653	Open in IMG/M
3300017430\|Ga0182192_1004223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1696	Open in IMG/M
3300017430\|Ga0182192_1052843	Not Available	757	Open in IMG/M
3300017430\|Ga0182192_1140255	Not Available	541	Open in IMG/M
3300017436\|Ga0182209_1047788	Not Available	758	Open in IMG/M
3300017436\|Ga0182209_1156858	Not Available	520	Open in IMG/M
3300017436\|Ga0182209_1167566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	508	Open in IMG/M
3300017438\|Ga0182191_1181804	Not Available	503	Open in IMG/M
3300017442\|Ga0182221_1062550	Not Available	686	Open in IMG/M
3300017442\|Ga0182221_1092639	Not Available	608	Open in IMG/M
3300017442\|Ga0182221_1142467	Not Available	532	Open in IMG/M
3300017443\|Ga0182193_1021329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1035	Open in IMG/M
3300017443\|Ga0182193_1194514	Not Available	504	Open in IMG/M
3300017680\|Ga0182233_1076634	Not Available	604	Open in IMG/M
3300017682\|Ga0182229_1076570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	578	Open in IMG/M
3300017685\|Ga0182227_1099341	Not Available	566	Open in IMG/M
3300017690\|Ga0182223_1107436	Not Available	524	Open in IMG/M
3300017690\|Ga0182223_1109212	Not Available	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.72%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.64%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.72%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.64%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.64%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1018633481	3300005334	Miscanthus Rhizosphere	WHGDDQMLELGKEEREKQKAQGKGIKYSSHFVLVIKTLSECDHI
Ga0068867_1010679831	3300005459	Miscanthus Rhizosphere	MLELGKEEREKQKAQGKGINSRSHFVLVIETLSECDHIYDR*
Ga0105246_125304232	3300011119	Miscanthus Rhizosphere	LRKEEREKQKAQGKGINHRSYFVLVIKTLRECDHI*
Ga0157378_112361961	3300013297	Miscanthus Rhizosphere	MLKLGKEEREKQKAQGKGIKCRSYFVLVIKTLSECDHI*
Ga0182122_10623392	3300015267	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSYFILVIETLSECDHI*
Ga0182154_10097011	3300015268	Miscanthus Phyllosphere	ELGKEEREKQKAQGKGIKYRSHFVLVIKTLSECDHI*
Ga0182154_10208381	3300015268	Miscanthus Phyllosphere	GQKLELGKEEREKQKAQGKDIKCRSHFVLVIKTLSECDHI*
Ga0182154_10463962	3300015268	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKDINCRGYFVLVIETLSEYDHI*
Ga0182113_10385971	3300015269	Miscanthus Phyllosphere	MLELGKEEKEKQKAQGKGINGRSHFVLVIETLSECDHI*
Ga0182113_10925261	3300015269	Miscanthus Phyllosphere	MLKLGEEEREKQKAQGKGIKCRSYFILVIKTLSEC
Ga0182188_10201061	3300015274	Miscanthus Phyllosphere	QMLKLRKEEREKQKAQGKGINCRSHFVLVIETLSECDHI*
Ga0182188_10246431	3300015274	Miscanthus Phyllosphere	VLGLGKEEKEKQKAQGKGINHRKHFILVIKTLREYDHI*
Ga0182188_10299911	3300015274	Miscanthus Phyllosphere	LKLGKEEREKQKVQGKGKNGRSHFVLVIETLSECDHI*
Ga0182170_10451431	3300015276	Miscanthus Phyllosphere	LKLGKEEREKQKAQGKGINSKSYFISVIKTLSECDHI*
Ga0182170_10635201	3300015276	Miscanthus Phyllosphere	GKEEREKQKAQGKGIKCRSHFVLVIKTLSECDHIYDR*
Ga0182128_10690211	3300015277	Miscanthus Phyllosphere	MLELGKEKREKQKTQGKGIICRSYFILVIKTLRECDHI*
Ga0182174_10164931	3300015279	Miscanthus Phyllosphere	KLRKEEREKQKAQGKGINCRSHFVLMIETLSECDHI*
Ga0182174_10403802	3300015279	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSHFVSVIKTLSECDHI
Ga0182174_10643191	3300015279	Miscanthus Phyllosphere	RTWKEEREKQKSQGKGINHRSYFVLVIKTLRECDHI*
Ga0182174_10812771	3300015279	Miscanthus Phyllosphere	TRKEEREKQKAQGKGIFCRSYFVLVIKTLRECDHI*
Ga0182160_10755692	3300015281	Miscanthus Phyllosphere	ELGKEEREKQKAQGKGINSRSHFVSVIKTLSEYDHI*
Ga0182124_10167551	3300015282	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIFDRSHFVLVIKTLSECDHI*
Ga0182124_10202191	3300015282	Miscanthus Phyllosphere	GDDQMLELGKEEREKQKAQGKGINSRSYFVLVIETLSECDHI*
Ga0182124_10353941	3300015282	Miscanthus Phyllosphere	MLELGKEEREKQKTQGKGINSMSHFISMIKTLSECDHI*
Ga0182124_10795101	3300015282	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINGRSHFVLVTETLSECDHI*
Ga0182156_10151832	3300015283	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKCDILLELFGLVIEILSECDHI*
Ga0182156_10325121	3300015283	Miscanthus Phyllosphere	MIELGKEETEKQKAKEKGINSRSHFVSVIKTLSECDHI*
Ga0182156_10781041	3300015283	Miscanthus Phyllosphere	MLGLGKEEREKQKAQGKGINHRSYFVLVIKTLRECD
Ga0182186_10254382	3300015285	Miscanthus Phyllosphere	LKLGKEEREKQKAQGKGINSRSHLVLVIETLSECDHI*
Ga0182186_10426921	3300015285	Miscanthus Phyllosphere	KLGKEEREKQKAQGKGIKCRSHCVLVIKTLSECDHI*
Ga0182176_10612492	3300015286	Miscanthus Phyllosphere	WIEEREKQKAQGKGINHRSYFVLVIKTLREYDHI*
Ga0182176_10663581	3300015286	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIKCRSHFVLVIKTLSEC
Ga0182171_10221121	3300015287	Miscanthus Phyllosphere	VLELGKEEREKQKAQSKGINDRSHFVLVIETLKECDHI*
Ga0182171_10336341	3300015287	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGINCRSHFVIVIETLSECVGDRPPG
Ga0182173_10681631	3300015288	Miscanthus Phyllosphere	IKVLGLGKEKKEKQKAQGKGDIHRSFCILVIETLSECDHI*
Ga0182138_10184632	3300015289	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRIYFVLVIETLSECD
Ga0182141_10179411	3300015292	Miscanthus Phyllosphere	NLGKEEREKQKAQGKGINCRSHFVLVIKTLRECDHI*
Ga0182141_10679251	3300015292	Miscanthus Phyllosphere	MLELRKEEREKQKAQGKGINDRSHFVLVIKTLSECDHI*
Ga0182126_10109291	3300015294	Miscanthus Phyllosphere	VLGLEKEERKKQKAQGKGISGRSHFISVSKTLSGCD
Ga0182126_10823862	3300015294	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGIRDMSHFVSVIKTLSECDHI*
Ga0182175_10349091	3300015295	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSHFVSMIKTLSECDHI*
Ga0182175_10861701	3300015295	Miscanthus Phyllosphere	MLGLGKEEREKQKAQGKGINHRSYFVLVIKTLRECDHI*
Ga0182157_10225721	3300015296	Miscanthus Phyllosphere	MLGLGKEEREKQKAQGKGISRSHFVSVIKTLSECDHI*
Ga0182157_10315652	3300015296	Miscanthus Phyllosphere	GDDQMLKLGKEEREKQKAQGKGINCRSYFVLVIETLSECDHI*
Ga0182157_10505281	3300015296	Miscanthus Phyllosphere	SAWTWKEEREKQKAQGKGINHRSYFVLVIKILRECDHI*
Ga0182157_10725062	3300015296	Miscanthus Phyllosphere	ASTWKEEREKQKAQGKGIFCSSYFVLVIKTLRECDNI*
Ga0182106_10713191	3300015298	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIKSRSHFVLVIKTLSEYDHI*
Ga0182106_11019142	3300015298	Miscanthus Phyllosphere	HDDDQMLELGKEEREKQKAQGKGINSRSHFVPVIKTLSECDHI*
Ga0182107_10426801	3300015299	Miscanthus Phyllosphere	MVMIKCLDLEKKREKQKAQGKGEIDRSFSVLVIKTLGE
Ga0182107_10829151	3300015299	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGKNCRSHFVLVIETLSECDHI*
Ga0182108_10311242	3300015300	Miscanthus Phyllosphere	GQMLKLGKEEREKQKAQRKGIKCRNHFILVIKTLSECDHI*
Ga0182143_10460001	3300015302	Miscanthus Phyllosphere	VLGLGKEEREKQKAQGKGINHRSYFVLVIKTLRECDHI
Ga0182123_10431863	3300015303	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGINSRSHFILVIKTLSECDHI
Ga0182112_10513581	3300015304	Miscanthus Phyllosphere	MQLGKEEREKQKAQGKGIKCRSHFVLVIKTLSECDHI
Ga0182112_11051701	3300015304	Miscanthus Phyllosphere	DQMLELGKEERKKQKAQGKGINSRSHFVSVIKTLSECDHI*
Ga0182142_11087101	3300015308	Miscanthus Phyllosphere	MLELGKEKREKQKAQGKGINSRSYFVLVIKTLSEYDHI*
Ga0182140_10895681	3300015314	Miscanthus Phyllosphere	LKLGKEEREKQKAQGKGKIVGAIFVSVIKTLSECDHI*
Ga0182127_10402041	3300015321	Miscanthus Phyllosphere	MVMVKCLNLEKEEREKQKAQGKGIKCRSHFVLVIKTLSECDH
Ga0182127_11192401	3300015321	Miscanthus Phyllosphere	DQMLELGKEQREKQKAQGKGINSRSHFVLVIKTLRECDHI*
Ga0182110_11240031	3300015322	Miscanthus Phyllosphere	MLKLRKEEREKQKAQGKGINCRSYFVLVIETLSECDHI
Ga0182129_10447592	3300015323	Miscanthus Phyllosphere	LGKEGREKQKAEGKDINSRSHFVLVIETLSECDHI*
Ga0182187_11677171	3300015341	Miscanthus Phyllosphere	QMLKLGKEEGEKQKAQGKGINSRSHLVSVIKTLSECDHI*
Ga0182109_11022241	3300015342	Miscanthus Phyllosphere	DQMLKLGKEEREKQKTQGKGINYRSHFVLVIKTLRECDHI*
Ga0182109_11198451	3300015342	Miscanthus Phyllosphere	VLNLGKEEREKQKAQGKGINCRSHFVLVIKTLRECDHI*
Ga0182109_11696611	3300015342	Miscanthus Phyllosphere	MFELGKEEREKQKAQGKGTNSRSHFVLVVETLSECDHI*
Ga0182109_11767931	3300015342	Miscanthus Phyllosphere	RKEEREKQKAQGKGISSRSHFVLVIETLRECDHI*
Ga0182155_10945071	3300015343	Miscanthus Phyllosphere	WKEEREKQKAQGKGIICRSHFVLVIKTLRECDHI*
Ga0182155_11180671	3300015343	Miscanthus Phyllosphere	VLGLGKEEREKQKAQGKGINGMSHFVSMIKTLSECDHI*
Ga0182155_11398961	3300015343	Miscanthus Phyllosphere	LGLGIEEREKQKAQGKGIKHRSYFVLVIKTLRECDHI*
Ga0182189_10551472	3300015344	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKDIKCRSHFILVIKTMLY*
Ga0182189_11718581	3300015344	Miscanthus Phyllosphere	MLELRKEKREKQKAQGKGKNSRSHFVLVIKTLSECDHI*
Ga0182111_10307851	3300015345	Miscanthus Phyllosphere	MLVLGKEEREKQKAQGKGINSRSHFVSVIKTLSECDHI
Ga0182111_11220591	3300015345	Miscanthus Phyllosphere	LKHGKEEREKQKTQGKGINCRSYFVLVIETLSECDHI*
Ga0182139_10927503	3300015346	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSHFVSVIKTLSECDHIYV
Ga0182139_11046951	3300015346	Miscanthus Phyllosphere	MLKHGKEEREKQKAQGKGINCRSYFVLVIETLSECDHI
Ga0182139_12130012	3300015346	Miscanthus Phyllosphere	MLELEKEEREKQKAQGKGKNCRSYFVLVIETLSECDHIYD*
Ga0182177_11130661	3300015347	Miscanthus Phyllosphere	HGDDQMLELGKEEREKRKAQGKGINSRSHFVLVIKTLRECDHI*
Ga0182177_11548631	3300015347	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGKNCRSHFVLVIETLSECDHI
Ga0182177_11990191	3300015347	Miscanthus Phyllosphere	LGKEEREKQKAQGKGKNYRSHFVLVIEKLSECDHI*
Ga0182161_10300641	3300015351	Miscanthus Phyllosphere	MLELRKEEREKQKAQGKGVNDRSQFILVIKTLSECDHI*
Ga0182161_10832972	3300015351	Miscanthus Phyllosphere	GDDQMLELGKEEREKQKAQGKGIKCRSHFVLVIKTLNECDHI*
Ga0182161_11611221	3300015351	Miscanthus Phyllosphere	LGKEEREKQKAQGKGINSRSHFVLVIETLSECDHI*
Ga0182161_11848402	3300015351	Miscanthus Phyllosphere	MFELGKEEREKQKAQGKGINSMSYFVSVIKTLSEYDHI*
Ga0182159_12097671	3300015355	Miscanthus Phyllosphere	MIKCSKLGKEEREKQKTQGKGIFDRSHFVLVIKTLSECDHI*
Ga0182159_12261271	3300015355	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIKCRSHFVLVIKTLSECDHI*
Ga0182159_12491951	3300015355	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINGRSHFVLVIKTLSECDHI*
Ga0182159_13039022	3300015355	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIIDRSHFVLVIKTLSECDHI*
Ga0182145_11480031	3300015361	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIKSRSHFVLVIKMLSECDHI*
Ga0182145_11506491	3300015361	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSNFVSVIKTLSECDHI*
Ga0182203_10867631	3300017404	Miscanthus Phyllosphere	MNDDHDEGDGHGDDQVLMPGKEEREKQKAQGKGINSRSHFVSVIKTLSECDHI
Ga0182203_10977041	3300017404	Miscanthus Phyllosphere	DQSLELGKEEREKQKAQGKGIKCRSHFVLVIKTLSECDRI
Ga0182204_10804482	3300017409	Miscanthus Phyllosphere	VLGLGKEEREKQKAQGKGDIHSSFCVLVIKEPSGCDHIEDR
Ga0182204_11054362	3300017409	Miscanthus Phyllosphere	MLELGKEEREKQKAQDKGINDKSHFVLVIETLSECDHI
Ga0182208_10575881	3300017411	Miscanthus Phyllosphere	VLGLGKEKREKQKAQGKGISGTSHFILVINTLSECDHV
Ga0182208_11122411	3300017411	Miscanthus Phyllosphere	DQVLGLRKEERKTKGSGKGISGRSHFVLVIKTLSECDHI
Ga0182222_10293421	3300017413	Miscanthus Phyllosphere	QTWKEEREKQKAQDKGINCRSHFVLVIKTLSECDHI
Ga0182222_10810311	3300017413	Miscanthus Phyllosphere	QMLELGKEEREKQKAQGKGINSRSHFVLVIKTLSECDHI
Ga0182202_11051571	3300017415	Miscanthus Phyllosphere	KCLNLEKEEREKQKAQGKGIKCRSHFVLVIKKLSECDHI
Ga0182202_11353061	3300017415	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGINQRSYFVLVIKTLRECDHI
Ga0182202_11404221	3300017415	Miscanthus Phyllosphere	MLELRKEEREKQKAQGKGINSKSHFVLVIKTLSECDHI
Ga0182230_10642861	3300017417	Miscanthus Phyllosphere	EDHDNGDGQMLKLGKEEREKQKAQGKGIKSRSHFVLVIKTLSECDHI
Ga0182224_10857721	3300017425	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGKKCRSHFVVVIETLSECDHI
Ga0182224_11064331	3300017425	Miscanthus Phyllosphere	QMLKLGKEEREKQKAQGKGIKCRSHFVLVIKTLSECDHI
Ga0182224_11316952	3300017425	Miscanthus Phyllosphere	MLKHGKEEREKQKAQGKGIFDRSHFVSVIKTLSECDNI
Ga0182190_10769631	3300017427	Miscanthus Phyllosphere	TWKEEREKQKAQGKGINDRSYFILVIKTLRECDHI
Ga0182192_10042232	3300017430	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGKNYRSHFVLVIEKLSECDHI
Ga0182192_10528431	3300017430	Miscanthus Phyllosphere	GDDQMLELGKEEREKQKAQGKCDILLELFGLVIETLSECDHIYDR
Ga0182192_11402551	3300017430	Miscanthus Phyllosphere	TWKEEREKQKAQGKGINHRSYFVLVIKTLSECDHI
Ga0182209_10477881	3300017436	Miscanthus Phyllosphere	MLKLGQEEREKQKAQGKGIKYMSHFVLVIKTHRECDHI
Ga0182209_11568581	3300017436	Miscanthus Phyllosphere	VLELGKEEREKQKAQGKDKIVGAIFVSVIKTLSECDHI
Ga0182209_11675662	3300017436	Miscanthus Phyllosphere	MIKLGKEEREKQKAQGKGINCMSYFVLVIETLSECDHI
Ga0182191_11818041	3300017438	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGINSRSHFVLVIETLSEC
Ga0182221_10625502	3300017442	Miscanthus Phyllosphere	GDDQVLGLGKEEREKQKAQGKGETLKELFGLVIETLNECDHI
Ga0182221_10926392	3300017442	Miscanthus Phyllosphere	VLELGKEEREKQKAQGKGINCRSHFVLVIETLSECD
Ga0182221_11424671	3300017442	Miscanthus Phyllosphere	QMLELGKEEREKQKAQGKGINSRSHFVLVIETHNECDHI
Ga0182193_10213291	3300017443	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINSRSHFISVIKTLSEC
Ga0182193_11945141	3300017443	Miscanthus Phyllosphere	DDHDDGDDQMLKLGKEEREKQKAQSKGINYRSHFVLVIETLSECDHI
Ga0182233_10766341	3300017680	Miscanthus Phyllosphere	LEKEEREKQKAQGKGIKCRSHFVLVIKALSECDHI
Ga0182229_10765701	3300017682	Miscanthus Phyllosphere	VLGLGKEEREKQKAQGKGINHRSYFVLVIKTLRECDH
Ga0182227_10993413	3300017685	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINCWSHFVLVIKALNECDH
Ga0182223_11074362	3300017690	Miscanthus Phyllosphere	MLELGKEEREKQKAQGKGINNRSHFILVIKTLSEYDHI
Ga0182223_11092121	3300017690	Miscanthus Phyllosphere	MLKLGKEEREKQKAQGKGIKCRSHFVLVIKTLGECDHI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F070736

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences