| Basic Information | |
|---|---|
| Family ID | F070720 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 56 residues |
| Representative Sequence | MLSRRVWSRATPMIVQMMTTRISLRCLLDDMTMRPVALVQLHLHHRQTLLYLLYLSG |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.95 % |
| % of genes near scaffold ends (potentially truncated) | 29.51 % |
| % of genes from short scaffolds (< 2000 bps) | 99.18 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.410 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.541 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.361 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (98.361 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 63.53% β-sheet: 0.00% Coil/Unstructured: 36.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.41 % |
| All Organisms | root | All Organisms | 24.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300013297|Ga0157378_13291325 | Not Available | 502 | Open in IMG/M |
| 3300015268|Ga0182154_1063091 | Not Available | 526 | Open in IMG/M |
| 3300015269|Ga0182113_1070692 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 556 | Open in IMG/M |
| 3300015274|Ga0182188_1042956 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 556 | Open in IMG/M |
| 3300015274|Ga0182188_1054814 | Not Available | 521 | Open in IMG/M |
| 3300015275|Ga0182172_1075051 | Not Available | 506 | Open in IMG/M |
| 3300015276|Ga0182170_1059759 | Not Available | 544 | Open in IMG/M |
| 3300015279|Ga0182174_1071206 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 533 | Open in IMG/M |
| 3300015279|Ga0182174_1081178 | Not Available | 511 | Open in IMG/M |
| 3300015282|Ga0182124_1010334 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 892 | Open in IMG/M |
| 3300015282|Ga0182124_1056798 | Not Available | 562 | Open in IMG/M |
| 3300015282|Ga0182124_1075295 | Not Available | 517 | Open in IMG/M |
| 3300015283|Ga0182156_1050997 | Not Available | 592 | Open in IMG/M |
| 3300015286|Ga0182176_1046883 | Not Available | 609 | Open in IMG/M |
| 3300015287|Ga0182171_1048649 | Not Available | 601 | Open in IMG/M |
| 3300015289|Ga0182138_1030259 | Not Available | 686 | Open in IMG/M |
| 3300015291|Ga0182125_1012757 | Not Available | 888 | Open in IMG/M |
| 3300015292|Ga0182141_1037736 | Not Available | 658 | Open in IMG/M |
| 3300015292|Ga0182141_1071356 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 547 | Open in IMG/M |
| 3300015294|Ga0182126_1049049 | Not Available | 614 | Open in IMG/M |
| 3300015294|Ga0182126_1054996 | Not Available | 595 | Open in IMG/M |
| 3300015294|Ga0182126_1072694 | Not Available | 547 | Open in IMG/M |
| 3300015295|Ga0182175_1023526 | Not Available | 763 | Open in IMG/M |
| 3300015295|Ga0182175_1075179 | Not Available | 547 | Open in IMG/M |
| 3300015296|Ga0182157_1020297 | Not Available | 808 | Open in IMG/M |
| 3300015298|Ga0182106_1003406 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 1362 | Open in IMG/M |
| 3300015298|Ga0182106_1046674 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 639 | Open in IMG/M |
| 3300015298|Ga0182106_1055038 | Not Available | 610 | Open in IMG/M |
| 3300015298|Ga0182106_1075440 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 554 | Open in IMG/M |
| 3300015298|Ga0182106_1075726 | Not Available | 553 | Open in IMG/M |
| 3300015299|Ga0182107_1097445 | Not Available | 514 | Open in IMG/M |
| 3300015299|Ga0182107_1101976 | Not Available | 506 | Open in IMG/M |
| 3300015300|Ga0182108_1051269 | Not Available | 630 | Open in IMG/M |
| 3300015300|Ga0182108_1059090 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 604 | Open in IMG/M |
| 3300015303|Ga0182123_1035295 | Not Available | 676 | Open in IMG/M |
| 3300015303|Ga0182123_1051145 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 610 | Open in IMG/M |
| 3300015303|Ga0182123_1088728 | Not Available | 519 | Open in IMG/M |
| 3300015304|Ga0182112_1056870 | Not Available | 608 | Open in IMG/M |
| 3300015305|Ga0182158_1057705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 602 | Open in IMG/M |
| 3300015305|Ga0182158_1095817 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 516 | Open in IMG/M |
| 3300015307|Ga0182144_1043370 | Not Available | 663 | Open in IMG/M |
| 3300015308|Ga0182142_1107567 | Not Available | 514 | Open in IMG/M |
| 3300015314|Ga0182140_1075340 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 576 | Open in IMG/M |
| 3300015323|Ga0182129_1059962 | Not Available | 615 | Open in IMG/M |
| 3300015341|Ga0182187_1065837 | Not Available | 746 | Open in IMG/M |
| 3300015341|Ga0182187_1092400 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 663 | Open in IMG/M |
| 3300015342|Ga0182109_1155471 | Not Available | 578 | Open in IMG/M |
| 3300015343|Ga0182155_1091038 | Not Available | 699 | Open in IMG/M |
| 3300015343|Ga0182155_1114129 | Not Available | 646 | Open in IMG/M |
| 3300015344|Ga0182189_1180116 | Not Available | 551 | Open in IMG/M |
| 3300015345|Ga0182111_1077440 | Not Available | 777 | Open in IMG/M |
| 3300015346|Ga0182139_1143287 | Not Available | 620 | Open in IMG/M |
| 3300015346|Ga0182139_1174973 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 574 | Open in IMG/M |
| 3300015346|Ga0182139_1204848 | Not Available | 540 | Open in IMG/M |
| 3300015346|Ga0182139_1227532 | Not Available | 518 | Open in IMG/M |
| 3300015347|Ga0182177_1074021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 794 | Open in IMG/M |
| 3300015347|Ga0182177_1142425 | Not Available | 624 | Open in IMG/M |
| 3300015351|Ga0182161_1077054 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 818 | Open in IMG/M |
| 3300015351|Ga0182161_1203939 | Not Available | 561 | Open in IMG/M |
| 3300015355|Ga0182159_1168247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 692 | Open in IMG/M |
| 3300015355|Ga0182159_1181172 | Not Available | 670 | Open in IMG/M |
| 3300015355|Ga0182159_1254531 | Not Available | 579 | Open in IMG/M |
| 3300015355|Ga0182159_1294610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 543 | Open in IMG/M |
| 3300015355|Ga0182159_1295794 | Not Available | 542 | Open in IMG/M |
| 3300015355|Ga0182159_1322652 | Not Available | 521 | Open in IMG/M |
| 3300015361|Ga0182145_1158249 | Not Available | 539 | Open in IMG/M |
| 3300015361|Ga0182145_1164610 | Not Available | 532 | Open in IMG/M |
| 3300017404|Ga0182203_1053846 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 719 | Open in IMG/M |
| 3300017404|Ga0182203_1058812 | Not Available | 700 | Open in IMG/M |
| 3300017404|Ga0182203_1162462 | Not Available | 503 | Open in IMG/M |
| 3300017407|Ga0182220_1044251 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 647 | Open in IMG/M |
| 3300017407|Ga0182220_1045640 | Not Available | 641 | Open in IMG/M |
| 3300017409|Ga0182204_1102463 | Not Available | 528 | Open in IMG/M |
| 3300017410|Ga0182207_1055252 | Not Available | 739 | Open in IMG/M |
| 3300017410|Ga0182207_1111597 | Not Available | 588 | Open in IMG/M |
| 3300017410|Ga0182207_1115556 | Not Available | 581 | Open in IMG/M |
| 3300017410|Ga0182207_1140361 | Not Available | 544 | Open in IMG/M |
| 3300017411|Ga0182208_1034549 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 751 | Open in IMG/M |
| 3300017411|Ga0182208_1123847 | Not Available | 510 | Open in IMG/M |
| 3300017413|Ga0182222_1014355 | Not Available | 844 | Open in IMG/M |
| 3300017413|Ga0182222_1089805 | Not Available | 528 | Open in IMG/M |
| 3300017415|Ga0182202_1028524 | Not Available | 823 | Open in IMG/M |
| 3300017415|Ga0182202_1085549 | Not Available | 589 | Open in IMG/M |
| 3300017417|Ga0182230_1108931 | Not Available | 516 | Open in IMG/M |
| 3300017420|Ga0182228_1052634 | Not Available | 700 | Open in IMG/M |
| 3300017425|Ga0182224_1118242 | Not Available | 562 | Open in IMG/M |
| 3300017427|Ga0182190_1028046 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 910 | Open in IMG/M |
| 3300017427|Ga0182190_1045956 | Not Available | 774 | Open in IMG/M |
| 3300017427|Ga0182190_1118778 | Not Available | 564 | Open in IMG/M |
| 3300017427|Ga0182190_1157316 | Not Available | 510 | Open in IMG/M |
| 3300017430|Ga0182192_1074445 | Not Available | 673 | Open in IMG/M |
| 3300017430|Ga0182192_1098531 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 612 | Open in IMG/M |
| 3300017433|Ga0182206_1031948 | Not Available | 831 | Open in IMG/M |
| 3300017433|Ga0182206_1115331 | Not Available | 558 | Open in IMG/M |
| 3300017433|Ga0182206_1133640 | Not Available | 532 | Open in IMG/M |
| 3300017436|Ga0182209_1076656 | Not Available | 655 | Open in IMG/M |
| 3300017436|Ga0182209_1097647 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 607 | Open in IMG/M |
| 3300017436|Ga0182209_1112840 | Not Available | 579 | Open in IMG/M |
| 3300017436|Ga0182209_1139163 | Not Available | 541 | Open in IMG/M |
| 3300017438|Ga0182191_1100319 | Not Available | 616 | Open in IMG/M |
| 3300017438|Ga0182191_1117694 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 584 | Open in IMG/M |
| 3300017438|Ga0182191_1165765 | Not Available | 520 | Open in IMG/M |
| 3300017442|Ga0182221_1129538 | Not Available | 548 | Open in IMG/M |
| 3300017443|Ga0182193_1157051 | Not Available | 545 | Open in IMG/M |
| 3300017443|Ga0182193_1183463 | Not Available | 515 | Open in IMG/M |
| 3300017680|Ga0182233_1079350 | Not Available | 594 | Open in IMG/M |
| 3300017681|Ga0182226_1066169 | Not Available | 662 | Open in IMG/M |
| 3300017682|Ga0182229_1043698 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 761 | Open in IMG/M |
| 3300017683|Ga0182218_1144120 | Not Available | 513 | Open in IMG/M |
| 3300017684|Ga0182225_1130852 | Not Available | 519 | Open in IMG/M |
| 3300017685|Ga0182227_1066718 | Not Available | 659 | Open in IMG/M |
| 3300017685|Ga0182227_1068073 | Not Available | 654 | Open in IMG/M |
| 3300017685|Ga0182227_1109929 | Not Available | 545 | Open in IMG/M |
| 3300017685|Ga0182227_1112562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 540 | Open in IMG/M |
| 3300017686|Ga0182205_1091979 | Not Available | 621 | Open in IMG/M |
| 3300017686|Ga0182205_1103789 | Not Available | 596 | Open in IMG/M |
| 3300017690|Ga0182223_1039160 | Not Available | 690 | Open in IMG/M |
| 3300017690|Ga0182223_1069002 | Not Available | 593 | Open in IMG/M |
| 3300017690|Ga0182223_1114685 | Not Available | 514 | Open in IMG/M |
| 3300021060|Ga0182232_1066574 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 590 | Open in IMG/M |
| 3300025960|Ga0207651_10822034 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar | 825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0157378_132913251 | 3300013297 | Miscanthus Rhizosphere | MLSRRVWSRATLATVQMMTTRMSLRCLLDDMTVRPVALAQLHLRRRQTPLSLLFLSG* |
| Ga0182154_10630911 | 3300015268 | Miscanthus Phyllosphere | MLSRRVWSRATPATAQMMTTRISLRCLLDDMTMRLVAPVQLHLHRRQIPLYLLYLSG* |
| Ga0182113_10706922 | 3300015269 | Miscanthus Phyllosphere | MLSRRGWSRVTPAIAQMMTTRRSLRCLLDDMTIRLVAPVQLHLHRRQTPL |
| Ga0182188_10429561 | 3300015274 | Miscanthus Phyllosphere | MLSRMVWSRATPAIVQMMTIRISLGCLLDDMMVRPVALAQLHKHCRQTLLYLLFVSE* |
| Ga0182188_10548141 | 3300015274 | Miscanthus Phyllosphere | MLSRRVWSRATLVIVQMMIIRLSLRCLLDNMTVRPVALAQLHHNHHRQISLFKQYLSG* |
| Ga0182172_10750511 | 3300015275 | Miscanthus Phyllosphere | MLNRRGWSRATPAIAQMMTTGIFLRCLHDDMTMRPVALVQLHLHRRQTPLYLPYLSE* |
| Ga0182170_10597591 | 3300015276 | Miscanthus Phyllosphere | MLSRRGWSRATLVTAQMMTIGTFLRCLHDDMTMRPVAPVQLHLHHRQTPLYLLSLSG* |
| Ga0182174_10712061 | 3300015279 | Miscanthus Phyllosphere | MLSRRVWSRATLAIVQMMIIRISLGCLLDDMMVRLVALAQLHRHCKQTSLFLLYLSR* |
| Ga0182174_10811781 | 3300015279 | Miscanthus Phyllosphere | MLSRRVWSRATPMIVQMMTTRISLRCLLDDMTMRPVALVQLHLHHRQTLLYLLYLSG* |
| Ga0182124_10103341 | 3300015282 | Miscanthus Phyllosphere | MLSRRVWSRVTLAIIQMMIIRISLGCLLDDMTVRPVVPAQSHRHHRQTLLYLLYLSG |
| Ga0182124_10567981 | 3300015282 | Miscanthus Phyllosphere | MLSRRVWSRATLVTVLMMIIRISLGCLLIDMTVRPVAPAQLHSHHRQTPLYLLFLSR* |
| Ga0182124_10752951 | 3300015282 | Miscanthus Phyllosphere | MLSRRRWSRATPVTAQMRTTVIFLRCLHDDMIMRPVAPVQLHLHHRQTPLFLPYLSG* |
| Ga0182156_10509971 | 3300015283 | Miscanthus Phyllosphere | MLSRRGWSRVTLAIAQMRTTMISLRCLLDDMIMRLVAPVQLHLHSRWTPLYLPYLSR* |
| Ga0182176_10468831 | 3300015286 | Miscanthus Phyllosphere | LLSRRGWSRATPVTAQTRTTGTFLRCLYVDMSMRPVAPVQLHLHHRQTPLYLPYLSG |
| Ga0182171_10486491 | 3300015287 | Miscanthus Phyllosphere | MVETDPLVTAQMMTTEIFLRCLHDDMTMRPVALVQLHLHRRQTPLYLPYLSG* |
| Ga0182138_10053592 | 3300015289 | Miscanthus Phyllosphere | MLSKRGLLQASLVIAQMMTTSLFLKRLHDDMTMRLEALVQLHMHRR* |
| Ga0182138_10302591 | 3300015289 | Miscanthus Phyllosphere | MLSRRVWSRATLVIAQMMTTRISLRCLLDDMMVRPVALAQLHLHRRQTSLSLLFLSG* |
| Ga0182125_10127571 | 3300015291 | Miscanthus Phyllosphere | MLSKRVWSRATLVIVQMMTTRISLECLLDDMIVRPVAPDQLHHRQTPLYLLFLSG* |
| Ga0182141_10377361 | 3300015292 | Miscanthus Phyllosphere | MLSRKRWLRATLATAQMMTIGISLRCLLDDMTMRLVAPVQLHLHRRQTPLYLLYFERMR* |
| Ga0182141_10713562 | 3300015292 | Miscanthus Phyllosphere | MHSRRVWSRVALVIVQMMIIRLFLRCLHEHMTERLVALAQLHRPRRQTPLFLLFLSRCGRIRHARPRRPQL |
| Ga0182126_10490491 | 3300015294 | Miscanthus Phyllosphere | MLSRRVWSRVTLVIVQMMIIMLSLRCLLDEMTVRPVAPAQLHRHRRQTPLFLLYLSE* |
| Ga0182126_10549961 | 3300015294 | Miscanthus Phyllosphere | MLSRRGWLRATPVTVQMMTIRISLRCLLEDMTMRSVAPAQLHLHHRQILLYLLYLSG* |
| Ga0182126_10726941 | 3300015294 | Miscanthus Phyllosphere | MLSMRVWSRATLVTVQMMTTRISLRCLHDDITVRPVALAQLHHSHHRQTPLTPLHMGFTLA* |
| Ga0182175_10235261 | 3300015295 | Miscanthus Phyllosphere | MLSKRVWSRATPAIVQMMTTRISLRCLHDDMTVRPVALAQLHRHHRQTLLFLLYLNG* |
| Ga0182175_10751791 | 3300015295 | Miscanthus Phyllosphere | MLSMRVWSRATPATVQMMTTRISLRCLHDDMTVRPVAPAQLHKHHRQTPLFLRFLSE* |
| Ga0182157_10202971 | 3300015296 | Miscanthus Phyllosphere | SRRGWSRATPVIAQMRTTKIFLRCLHVDMTMRLVAPVYLHLHRRQTPLYLLYLRG* |
| Ga0182106_10034063 | 3300015298 | Miscanthus Phyllosphere | MLSRRVWSRAIPVIVQMMTIRLFLRCLLDDMIVRLVAPAQLHHSHHRQILLSLLFLSG* |
| Ga0182106_10466742 | 3300015298 | Miscanthus Phyllosphere | MLSRRVWSRATPATAQMRTTAISLRCLHDDMTMRPIVLVQLHLHRRQTPLYL |
| Ga0182106_10550381 | 3300015298 | Miscanthus Phyllosphere | MLNRRAWLRVTPVIVLMMIIRLFLRCHLINKTVRLVALVQLHHSHHRQTPLYLLFLSG* |
| Ga0182106_10754401 | 3300015298 | Miscanthus Phyllosphere | MLSRRVWSRVTLVIAQMMTTRISLRCLLDVMTMRSVALVQLHLHHRQTPLY |
| Ga0182106_10757261 | 3300015298 | Miscanthus Phyllosphere | MLSRRGWSRATPVIAQMRTTGTFLRCLHIDMTMRLVALVQLHLHRRQTLLYLPYLSG* |
| Ga0182107_10974451 | 3300015299 | Miscanthus Phyllosphere | RSLMLSRRGWSIATLVTAQMMTTRLFLRCLHDDMIMRPVAPVQLHLHRRQTLLYLLSLSG |
| Ga0182107_11019761 | 3300015299 | Miscanthus Phyllosphere | MLSRRGWSRVTPATAQMRTTAISLRCLLDDMIMRPVALVQLHLHHRLTPLYLPYLSR* |
| Ga0182108_10512691 | 3300015300 | Miscanthus Phyllosphere | MHSRRVWLRVILVTVQMMTTRISLRCLHDDMTVRLVAPAQLHRHRRQTLLYLLYLSG* |
| Ga0182108_10590902 | 3300015300 | Miscanthus Phyllosphere | MLSRSGWLRATPVTAQMRTTTISLRCLHDDMTMRPVALVQLPLHRRQT |
| Ga0182123_10352951 | 3300015303 | Miscanthus Phyllosphere | MLSRRGWLRATPAIAQMMTTGISLRCLLNIMTMRPVAPVQLHLHYRQTLLYLLYLGG* |
| Ga0182123_10511451 | 3300015303 | Miscanthus Phyllosphere | MLSRRVWSRATPVIVQMMTTRISLRCLLNNMTVRPVAPTQLHPSHHRQTPLFLLFLSG* |
| Ga0182123_10887281 | 3300015303 | Miscanthus Phyllosphere | MLSRRVWSRATPVTAQMMTTKISLRCLLDDMTMRLVAPVQLHLHRRQTPLYLLYLSG* |
| Ga0182112_10568701 | 3300015304 | Miscanthus Phyllosphere | MHSQRVWSRATPVTVQMMTIRLFLRCLLDVMIVRPVSLAQFHHSHHRQTPLYLLFLSG* |
| Ga0182158_10577052 | 3300015305 | Miscanthus Phyllosphere | LLSRRGWSRATLVTAQMRTTRTFLRCLHDDMIMRPVALVQLHLHHRQT |
| Ga0182158_10958171 | 3300015305 | Miscanthus Phyllosphere | MLSRRGWLRATLVIAQMMTTVISIRCLHDDRTIRPVALVQLHLHHRQTPLY |
| Ga0182144_10433703 | 3300015307 | Miscanthus Phyllosphere | VIASMRTTGIFLRCLHVDMTMRSIALVQLHLYRRQTLLYLPYLSG* |
| Ga0182142_11075672 | 3300015308 | Miscanthus Phyllosphere | MLSRRVWSRATLVTVQMMIIRLSLICLLDDMIVRPVALAQLHRHRKQTLLF* |
| Ga0182140_10753401 | 3300015314 | Miscanthus Phyllosphere | MLSRRGWSRATLVTAQMRTIAISLRCLHDNMTMRPVALVQLHLHHRQTPLYLTY |
| Ga0182129_10599621 | 3300015323 | Miscanthus Phyllosphere | SLMLSRRGWSRATPATAQMMTTRIFLRCLLDDMTMRPVALVQLHMHHRQTPLYLLYLSG* |
| Ga0182187_10658371 | 3300015341 | Miscanthus Phyllosphere | MLSRRAWSRVTLVTVQMMTTRISLGCLLDDMTVRPVAPAQLHHRHHRQTPLYLLFLSG* |
| Ga0182187_10924001 | 3300015341 | Miscanthus Phyllosphere | MHSQRVWSRVTPVTVQMMTTKISLGCLLDDMIVRPVAPAQLHHSHHRQTPLYLLFLNR* |
| Ga0182109_11554711 | 3300015342 | Miscanthus Phyllosphere | MRSSGAQQLQRRRSLILSRRVWARATPAIVLMMIIRISLGCLLGDMIVRLVAPVQLHQRHRRQTPLYLLYLSG* |
| Ga0182155_10910381 | 3300015343 | Miscanthus Phyllosphere | MLSRRGWSRVTLVIAHMRTTAISLRCLHVDMTMRPVALVQLHLHDRQTLLYLPYLSR* |
| Ga0182155_11141291 | 3300015343 | Miscanthus Phyllosphere | TLVLVQMTTIKISLRFLLNDMTMRPVAPVQLHLHHRQIPLYLLYLSR* |
| Ga0182189_11801161 | 3300015344 | Miscanthus Phyllosphere | LSRMVWSRATLVTVQMMIIRISLVCLLDVMMARPVALVQLHLHCRLTPLYLLYLSG* |
| Ga0182111_10774401 | 3300015345 | Miscanthus Phyllosphere | MLSRRGWSRATLVIAQMMTTRLSLRYLHDDMTMRLGALVQLHLHPRLIP |
| Ga0182139_11432871 | 3300015346 | Miscanthus Phyllosphere | MLSRMVGSRVTPVIAQMMTTRISLRCLLDNMMVRPVALAQLHLHHRQTLLYLLYLSG* |
| Ga0182139_11749732 | 3300015346 | Miscanthus Phyllosphere | MLSRRVWSRATPTIVQMMTTRISLECLLDDMIVRLVALAQLHSHHRQILLYLLFL |
| Ga0182139_12048481 | 3300015346 | Miscanthus Phyllosphere | MLSRRVWSRATLVIVLLMIIRLFLICLLDDMIVRPVAPAWLHPSHHRQTSLSLLFLSR* |
| Ga0182139_12275321 | 3300015346 | Miscanthus Phyllosphere | MLSRRVWSRVTLVTAQMMTTRISLRCLLDDMMVRPVAPAQLHRHRRQTPLSLLFLSG* |
| Ga0182177_10740211 | 3300015347 | Miscanthus Phyllosphere | MLSRRVWSRATPVTVQMMTTRISLGCLLDDMIVRPVALAQLHHSLHRQTPLYLLFLSG* |
| Ga0182177_11424251 | 3300015347 | Miscanthus Phyllosphere | TLVIVQMMIIRLSLRCLLDDMIVRLVAPAQLHHSHHRQIPLYLLYLNG* |
| Ga0182161_10770541 | 3300015351 | Miscanthus Phyllosphere | MLSRRVWSRATPAIVQMMTTRLSLRCLLDDMIVRPVAPVQLHHSHHSQTPLYLLFLS |
| Ga0182161_12039391 | 3300015351 | Miscanthus Phyllosphere | MLSRRVWSRATPVISQMMTTRISLKCLLDDMMVRPVAPAQLHLHRRQTPLSLLFLSG* |
| Ga0182159_11682471 | 3300015355 | Miscanthus Phyllosphere | MLSRRVWSRATPMTVQMMIIRISLGCLLDDMMVRLVVLAQLHLHRRQTSLYLLYLSG* |
| Ga0182159_11811721 | 3300015355 | Miscanthus Phyllosphere | MLSKRVWSRATLVIVQMMIIRLSLKCLLDDMTVRLVALAQLHHSHHRQTLLSLLFLSG* |
| Ga0182159_12545311 | 3300015355 | Miscanthus Phyllosphere | MLNTRVWSRETLVIVQMMIIRPFLRCLLDHMKERPVTLAQLHSHRRQTPL |
| Ga0182159_12946102 | 3300015355 | Miscanthus Phyllosphere | MLSRRVWSRVTPVTVQMMIIRISLGCLLDDMMVRPVAPVQLHLHHKQTPLYLL |
| Ga0182159_12957942 | 3300015355 | Miscanthus Phyllosphere | MLSRRVWSRGTLVVVQMMTTRLSLRCLLDDMTVRLVALAQLHHRQILLSLLFLSG* |
| Ga0182159_13226521 | 3300015355 | Miscanthus Phyllosphere | MLSRRVWSRVTPVIVQMMIIRLSLRCLLDDMIVRPVALAQLHHNHHRQTPLFLLFLSR* |
| Ga0182145_11582491 | 3300015361 | Miscanthus Phyllosphere | MLSRRVWSRVTPVTVQIMTTKISLRFLLDDMTMRPVAPAQFHPSHHRQTLLFSLFLSG* |
| Ga0182145_11646101 | 3300015361 | Miscanthus Phyllosphere | MLSRSGWLRATPVTAQMRTTTISLRCLHDDMTMRPVALVQLPLHRRQTPLYLPYLSG* |
| Ga0182203_10538461 | 3300017404 | Miscanthus Phyllosphere | MLSRRAWLRATPATVQMMITRISLRCLLDDMTVRPVVPAQLHRHRRQTLLFLLYL |
| Ga0182203_10588121 | 3300017404 | Miscanthus Phyllosphere | SRATPVTVLMMTTKTFLRCLHDDMIMRLVALVQLHLHRRLTPLYLPYLSG |
| Ga0182203_11624621 | 3300017404 | Miscanthus Phyllosphere | MLSRRGWLRATPMIVQMMTTMISLRCLHDNMTMRPVALVLLHLHHRQTPLYLPYLSG |
| Ga0182220_10442511 | 3300017407 | Miscanthus Phyllosphere | LLSRREWSRATPTTTQMRTTVISLRCLHVDMIMRPVALVQLHLHRRQTPLSLLYWS |
| Ga0182220_10456401 | 3300017407 | Miscanthus Phyllosphere | MLSRRGLSRATLVTAQMMTTSLFLRCLHDDMTMRPTAPVQRHLPHRQTPLSLLYLSG |
| Ga0182204_11024631 | 3300017409 | Miscanthus Phyllosphere | MLSRRVWSRATPVTVQMITTRLSLRCLLDDMTVRLVALAQLHHSHHRQIPLSLLFLSG |
| Ga0182207_10552521 | 3300017410 | Miscanthus Phyllosphere | LRLSRRGASLVTAQTMTTSLFLICLHADMMQRLVALVPLHLHHRQTPLSLLFLSG |
| Ga0182207_11115971 | 3300017410 | Miscanthus Phyllosphere | MHSQRVWSRVTPVTVQMMTTRISLGCLLDDMIVRPVALAQLHLHRRQTPLSLLFLSG |
| Ga0182207_11155561 | 3300017410 | Miscanthus Phyllosphere | MLSRRVWSRATPVIVLVMIIRLFLRCLLNDMTVRSVALAQLHHSHHKQTPLSLLFLSR |
| Ga0182207_11403611 | 3300017410 | Miscanthus Phyllosphere | MLSRRVWSRATLVTVQMMTTRISLRCLLDDMIVRPVAPDQLHHSHHRQTPLYLLFLSG |
| Ga0182208_10345491 | 3300017411 | Miscanthus Phyllosphere | MLSRRVWSRATLVTVEMMTTRLSLRCCLDNMTVRLVAPAQLHPSHHRQTLLFLVFLS |
| Ga0182208_11238471 | 3300017411 | Miscanthus Phyllosphere | MLSRRGWSRATPAIAQMMIIRISLRCLHDDMTMRPVAPVQLHLHHRQTPLYLLSLSG |
| Ga0182222_10143551 | 3300017413 | Miscanthus Phyllosphere | MLSRRGLLRATLVIAQMMTTSLFLRCLHDNMTMRLVAPVYLHLHYRQTLLYLPYLSG |
| Ga0182222_10898051 | 3300017413 | Miscanthus Phyllosphere | MLSRRVWLRAILVTAQMMIIRLSLKCLLDDMTVRPVTPAQLHPSHHKQTPLFLLFLSG |
| Ga0182202_10285241 | 3300017415 | Miscanthus Phyllosphere | MLSRRVRSRVTPVIVQMITNRISLRCLLDDMTMRPVAPVQLHLHRRQTPLSLLYLSG |
| Ga0182202_10855491 | 3300017415 | Miscanthus Phyllosphere | LMLSRRGWSRATPVIASMRTTGIFLRCLHVDMTMRSIALVQLHLYRRQTLLY |
| Ga0182230_11089311 | 3300017417 | Miscanthus Phyllosphere | MLSRRVWSRATPVTVQMMTTRISLGCLLDDMIVRPVALAQLHHSHHRQTPLSLLFLSG |
| Ga0182228_10526341 | 3300017420 | Miscanthus Phyllosphere | MLSRRVWSRATPVIVQMMIISLFLRCLHDDMTMRPVAPVQLHLHHKQTLLYLLSLSG |
| Ga0182224_11182422 | 3300017425 | Miscanthus Phyllosphere | MLSRRVWSRVTLAIIQMMIIRISLGCLLDDMTVRPVVPAQFHRHRRQTLLYLLYLSG |
| Ga0182190_10280461 | 3300017427 | Miscanthus Phyllosphere | MLSRRVWSRATLAIVQMMIIRISLGCLLDDMMVRPVALVQLHRHRIQTPLYLLYLSG |
| Ga0182190_10459561 | 3300017427 | Miscanthus Phyllosphere | MLSRRGWSRVTPVTAQMMTTRISLRYLLDDMMVRPVVLVLLHLHHRQTLLYLLFLSG |
| Ga0182190_11187781 | 3300017427 | Miscanthus Phyllosphere | MLSRRVWSRATPMIVQMMTTRISLGCLLGDMTVRPVALAQLHHNHHRQTPLFLLFLSE |
| Ga0182190_11573161 | 3300017427 | Miscanthus Phyllosphere | MLSRRVWSRATPVIVLMMTTRISLRCLLDDMMVRLVVLAQLHGHRRQIPLFLLYLSG |
| Ga0182192_10744451 | 3300017430 | Miscanthus Phyllosphere | MLSRRGWSRATPATAQIMTTGRSLRCLLDDMTMRPVALVQLHLHHRQIPLYLLYLSG |
| Ga0182192_10985311 | 3300017430 | Miscanthus Phyllosphere | MVSRRMWSRATLVIAQTRTIGTFLRCLHIDMIMRPAALVQLHLHHRQMPLFLPYLSE |
| Ga0182206_10319481 | 3300017433 | Miscanthus Phyllosphere | MHSKRMWLRVTLVTVLMMIIRLFLKCLLDDMIVRPVAPAQLHPSHHRQTLLFLLFLSG |
| Ga0182206_11153312 | 3300017433 | Miscanthus Phyllosphere | MLSRRGWSRATPVIAQMMTTGIFLRCLLNDMTMSPVALVQLHLHHRQTPLYLPYLSG |
| Ga0182206_11336401 | 3300017433 | Miscanthus Phyllosphere | RRGWSRVTLVTAQMRTTRIFLRCLHDNMTMRPVALVQLHLHHRQIPLYLIYLSG |
| Ga0182209_10766561 | 3300017436 | Miscanthus Phyllosphere | MLSRRVWSRATPATVLMMTTRTFLRCLHDDMIMRPVALVQLHLHHRQTLLYLLSLSG |
| Ga0182209_10976472 | 3300017436 | Miscanthus Phyllosphere | MLSRRVWSRETLVTVLMMIIMLSLICLLDDMMVRPVALVQLHRHRIQTPLYLLYLSG |
| Ga0182209_11128401 | 3300017436 | Miscanthus Phyllosphere | MLSTRGWLRVTPVTSQMMTTRLSLRCLHDDMTMRPVAPVQLHLHHRQTSLYLLYLSG |
| Ga0182209_11391631 | 3300017436 | Miscanthus Phyllosphere | MLSRRVYSRATLVIGQMMTTRISLRCLHDDMTMRPTALVQLHLHHTQTSPYLLSLSE |
| Ga0182191_11003191 | 3300017438 | Miscanthus Phyllosphere | MLSRRGWSRATLVIAQMMTTRISLRCLLDDMTMRPVALVQLHLHRRQTPLYLLFLSR |
| Ga0182191_11176942 | 3300017438 | Miscanthus Phyllosphere | MLRRMGWLRVTPAIAQMRTTVISLRCLHDDMTMRPVAPVQLHLHRRLTR |
| Ga0182191_11657651 | 3300017438 | Miscanthus Phyllosphere | MLSRRVWSRATPAIVQMMTAKISLGCLLDDMIVRPVAPAQLHHSHHRQTPLYLLFLNR |
| Ga0182221_11295381 | 3300017442 | Miscanthus Phyllosphere | MLSRRVWSRATPVIVQMMTTRLSLRCLLDDMTVRLVALAQLHHSHHRQTPLSLLYLSG |
| Ga0182193_11570511 | 3300017443 | Miscanthus Phyllosphere | MLSTTVWSRATPVTAQMMTTRISLRCLLDDMTMRPVAPVQVHLHHKQNPLYLLYLSE |
| Ga0182193_11834631 | 3300017443 | Miscanthus Phyllosphere | MLSRRGWSRATPATAQMRTTTISLRYLHDDMTMRPVVPVQLHLHHRQALLYLLSLSG |
| Ga0182233_10793501 | 3300017680 | Miscanthus Phyllosphere | MLIRRGLLRVTPVIAQIMTTSLSLRCLHDDMTMRLVALVQLHLHRRQTPLYLPYLSG |
| Ga0182226_10661691 | 3300017681 | Miscanthus Phyllosphere | MLSRRVWSRATLVIAQMMTTRISLRCLLDNMMVRPVALAQLHLHHRQTLLYLLFLSG |
| Ga0182229_10436981 | 3300017682 | Miscanthus Phyllosphere | MHSRRVWLRVILVTVQMMTTRISLGCLLGDMTVRPVAPAQLHHRQTLLYLLFLSG |
| Ga0182218_11441201 | 3300017683 | Miscanthus Phyllosphere | MLSRRVWSRATLVIVQMMTTRISLGCLLDDMIVRPVALAQLHHSHHRQTPLYLLFLSG |
| Ga0182225_11308521 | 3300017684 | Miscanthus Phyllosphere | MLSRRGWLRATPVTAQMMTTSLSLRCLLDDMTMRPVAPVQLHLHHRQIPLNLLYLSG |
| Ga0182227_10667181 | 3300017685 | Miscanthus Phyllosphere | MLSRRGWLRATPVTAQMMTTVISLRCLHDDMTIRPVALVQLHLHHRQTPLYLPSLSG |
| Ga0182227_10680731 | 3300017685 | Miscanthus Phyllosphere | MLSRSGWLRATPVIALTRTTRTFLRCLHVDMTMRPAALVQLHLHYRQTPLFLPYLSG |
| Ga0182227_11099292 | 3300017685 | Miscanthus Phyllosphere | MLSRRGLLRATPVIAQMMTTSLFLRCLHDDMTMRSVAPVQLHLHRRLTPLYLQYLSG |
| Ga0182227_11125621 | 3300017685 | Miscanthus Phyllosphere | MLNRRGGSKVTPAIAQMMTTGTFLRCLHDDMTMRSVAPVQLHLHHRQTLLYLLSLSG |
| Ga0182205_10919791 | 3300017686 | Miscanthus Phyllosphere | MLSRRVWSRATLVIVQMMTTRLSLRCLLDDMTVRPVAPAQLHHRHHRQTPLYLLFLSG |
| Ga0182205_11037891 | 3300017686 | Miscanthus Phyllosphere | MLSRRVWSRVTPVIVQMMTTRISIRCLLDDMIVRPVALAQLYPSHHRQTPLFLLFLSG |
| Ga0182223_10391601 | 3300017690 | Miscanthus Phyllosphere | MLSRRVWSRAIPVIVQMMTIRLFLRCLLDDMIVRLVAPAQLHHSHHRQTLLSLLFLSG |
| Ga0182223_10690021 | 3300017690 | Miscanthus Phyllosphere | MLGRRGWSRVTLVTAQMRTTMTFLRCLHIDMTMRPVALAQLHLHHRQTPLYLLSLSG |
| Ga0182223_11146851 | 3300017690 | Miscanthus Phyllosphere | MLSRRVWSRATPVIAQMMTIRISLGCLLDDMMVRPVAPAQLHLHHRQTPLYLLYLSG |
| Ga0182232_10665742 | 3300021060 | Phyllosphere | MLSRRGWSRATLVIAQMMTTRISLRCLLDDMTMRLVAPVQLHLHRRQTPLYL |
| Ga0207651_108220343 | 3300025960 | Switchgrass Rhizosphere | MLSRRGWSRATPVIAQMMTTVISLRCLHDDMTLRLVAPVQLHLHHRQTPLYLPYLSGLGR |
| ⦗Top⦘ |