| Basic Information | |
|---|---|
| Family ID | F070617 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ASGLQVLQLADVDGQPLITALVSYRDPALAIRCGLPPALP |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 95.93 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.244 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (53.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (47.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.82% β-sheet: 26.47% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00710 | Asparaginase | 11.38 |
| PF02452 | PemK_toxin | 5.69 |
| PF04672 | Methyltransf_19 | 5.69 |
| PF13600 | DUF4140 | 2.44 |
| PF00196 | GerE | 1.63 |
| PF01979 | Amidohydro_1 | 1.63 |
| PF07859 | Abhydrolase_3 | 1.63 |
| PF13830 | DUF4192 | 1.63 |
| PF02310 | B12-binding | 1.63 |
| PF02467 | Whib | 1.63 |
| PF01179 | Cu_amine_oxid | 1.63 |
| PF00313 | CSD | 0.81 |
| PF02517 | Rce1-like | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF13380 | CoA_binding_2 | 0.81 |
| PF00753 | Lactamase_B | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF07883 | Cupin_2 | 0.81 |
| PF10604 | Polyketide_cyc2 | 0.81 |
| PF01545 | Cation_efflux | 0.81 |
| PF06283 | ThuA | 0.81 |
| PF03807 | F420_oxidored | 0.81 |
| PF12833 | HTH_18 | 0.81 |
| PF01850 | PIN | 0.81 |
| PF00111 | Fer2 | 0.81 |
| PF13466 | STAS_2 | 0.81 |
| PF00392 | GntR | 0.81 |
| PF03737 | RraA-like | 0.81 |
| PF13594 | Obsolete Pfam Family | 0.81 |
| PF03167 | UDG | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF13379 | NMT1_2 | 0.81 |
| PF00582 | Usp | 0.81 |
| PF02604 | PhdYeFM_antitox | 0.81 |
| PF07729 | FCD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 22.76 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 5.69 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.63 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.63 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.81 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.81 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.81 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.81 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.81 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.81 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.06 % |
| Unclassified | root | N/A | 8.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100126135 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300004633|Ga0066395_10496369 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005406|Ga0070703_10375267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300005764|Ga0066903_108609144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 519 | Open in IMG/M |
| 3300005764|Ga0066903_109147114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 500 | Open in IMG/M |
| 3300006028|Ga0070717_10101835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2439 | Open in IMG/M |
| 3300006028|Ga0070717_10864797 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006163|Ga0070715_10120955 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300006605|Ga0074057_11553698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 801 | Open in IMG/M |
| 3300007265|Ga0099794_10654194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 558 | Open in IMG/M |
| 3300009700|Ga0116217_10924090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300009792|Ga0126374_10909595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300010361|Ga0126378_10607197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1208 | Open in IMG/M |
| 3300010361|Ga0126378_11485704 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010361|Ga0126378_12558767 | Not Available | 583 | Open in IMG/M |
| 3300010361|Ga0126378_12862403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 551 | Open in IMG/M |
| 3300010362|Ga0126377_12307206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300010376|Ga0126381_101012416 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300010376|Ga0126381_101675922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia brasiliensis | 918 | Open in IMG/M |
| 3300010880|Ga0126350_11500007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300012096|Ga0137389_11490523 | Not Available | 572 | Open in IMG/M |
| 3300012207|Ga0137381_11758425 | Not Available | 510 | Open in IMG/M |
| 3300012211|Ga0137377_10071977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ceeclamvirinae → Myrnavirus → Myrnavirus myrna | 3239 | Open in IMG/M |
| 3300012350|Ga0137372_10742866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300012354|Ga0137366_10827360 | Not Available | 656 | Open in IMG/M |
| 3300012971|Ga0126369_10268456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sinosporangium → Sinosporangium siamense | 1689 | Open in IMG/M |
| 3300014169|Ga0181531_10114283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
| 3300015054|Ga0137420_1359535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5146 | Open in IMG/M |
| 3300015264|Ga0137403_11255367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 587 | Open in IMG/M |
| 3300016319|Ga0182033_11888628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 543 | Open in IMG/M |
| 3300016341|Ga0182035_10207935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1553 | Open in IMG/M |
| 3300017942|Ga0187808_10223467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300021180|Ga0210396_10350019 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300021405|Ga0210387_11010519 | Not Available | 728 | Open in IMG/M |
| 3300021406|Ga0210386_10705110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 870 | Open in IMG/M |
| 3300021420|Ga0210394_11639661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 540 | Open in IMG/M |
| 3300021420|Ga0210394_11811090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 509 | Open in IMG/M |
| 3300021432|Ga0210384_11085040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 704 | Open in IMG/M |
| 3300021477|Ga0210398_10313922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1278 | Open in IMG/M |
| 3300021560|Ga0126371_11533276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 794 | Open in IMG/M |
| 3300021560|Ga0126371_11747329 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021560|Ga0126371_12295788 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300021560|Ga0126371_13473739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 532 | Open in IMG/M |
| 3300022724|Ga0242665_10287470 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025915|Ga0207693_10919963 | Not Available | 670 | Open in IMG/M |
| 3300025929|Ga0207664_11267336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300026217|Ga0209871_1028690 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300026319|Ga0209647_1298891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300026481|Ga0257155_1090993 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026514|Ga0257168_1142905 | Not Available | 533 | Open in IMG/M |
| 3300027073|Ga0208366_1004721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1331 | Open in IMG/M |
| 3300027646|Ga0209466_1116243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300027895|Ga0209624_10425486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
| 3300030053|Ga0302177_10052636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2464 | Open in IMG/M |
| 3300030399|Ga0311353_10849723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300030399|Ga0311353_11090009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300030617|Ga0311356_11172532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300031236|Ga0302324_100701480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1428 | Open in IMG/M |
| 3300031543|Ga0318516_10346459 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031544|Ga0318534_10364560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EI5c | 831 | Open in IMG/M |
| 3300031546|Ga0318538_10058341 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300031546|Ga0318538_10223901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1007 | Open in IMG/M |
| 3300031546|Ga0318538_10366410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300031561|Ga0318528_10454983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 687 | Open in IMG/M |
| 3300031561|Ga0318528_10499953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300031572|Ga0318515_10466648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300031668|Ga0318542_10066383 | Not Available | 1678 | Open in IMG/M |
| 3300031680|Ga0318574_10344042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 869 | Open in IMG/M |
| 3300031681|Ga0318572_10070322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1925 | Open in IMG/M |
| 3300031713|Ga0318496_10402542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300031723|Ga0318493_10372246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 779 | Open in IMG/M |
| 3300031724|Ga0318500_10336644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300031736|Ga0318501_10473619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300031744|Ga0306918_10828343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300031744|Ga0306918_10856207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 709 | Open in IMG/M |
| 3300031744|Ga0306918_11092196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 618 | Open in IMG/M |
| 3300031747|Ga0318502_10776642 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031748|Ga0318492_10320457 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031764|Ga0318535_10485990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 549 | Open in IMG/M |
| 3300031765|Ga0318554_10213663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
| 3300031768|Ga0318509_10297437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300031770|Ga0318521_10694028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300031771|Ga0318546_10207142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1341 | Open in IMG/M |
| 3300031771|Ga0318546_10939914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 608 | Open in IMG/M |
| 3300031777|Ga0318543_10118244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1149 | Open in IMG/M |
| 3300031778|Ga0318498_10344335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 666 | Open in IMG/M |
| 3300031779|Ga0318566_10628921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300031792|Ga0318529_10539176 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031821|Ga0318567_10553576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
| 3300031833|Ga0310917_10408462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 923 | Open in IMG/M |
| 3300031835|Ga0318517_10065967 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300031835|Ga0318517_10175916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 961 | Open in IMG/M |
| 3300031845|Ga0318511_10317272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300031859|Ga0318527_10438036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 557 | Open in IMG/M |
| 3300031860|Ga0318495_10171548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300031860|Ga0318495_10553323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300031879|Ga0306919_11076455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 613 | Open in IMG/M |
| 3300031890|Ga0306925_10685514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1074 | Open in IMG/M |
| 3300031893|Ga0318536_10474417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 630 | Open in IMG/M |
| 3300031894|Ga0318522_10190467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300031896|Ga0318551_10731555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 574 | Open in IMG/M |
| 3300031896|Ga0318551_10825548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300031897|Ga0318520_10398273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300031912|Ga0306921_12066976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300031942|Ga0310916_10975155 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031942|Ga0310916_11607533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ISL-1 | 528 | Open in IMG/M |
| 3300031945|Ga0310913_10223939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1318 | Open in IMG/M |
| 3300031945|Ga0310913_10549351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300031946|Ga0310910_10547605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 918 | Open in IMG/M |
| 3300031954|Ga0306926_11434500 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032009|Ga0318563_10156349 | Not Available | 1224 | Open in IMG/M |
| 3300032010|Ga0318569_10132931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1138 | Open in IMG/M |
| 3300032025|Ga0318507_10203555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 854 | Open in IMG/M |
| 3300032043|Ga0318556_10571839 | Not Available | 590 | Open in IMG/M |
| 3300032044|Ga0318558_10425926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 661 | Open in IMG/M |
| 3300032054|Ga0318570_10429254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 603 | Open in IMG/M |
| 3300032059|Ga0318533_10553473 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300032063|Ga0318504_10103778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1276 | Open in IMG/M |
| 3300032064|Ga0318510_10343225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 628 | Open in IMG/M |
| 3300032065|Ga0318513_10076928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1535 | Open in IMG/M |
| 3300032067|Ga0318524_10313959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300032076|Ga0306924_11166446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300032261|Ga0306920_103425067 | Not Available | 588 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 53.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001261354 | 3300002245 | Forest Soil | PDGAGRLAATGLQILQLGEAGGQPLITALVSYRDPALAARCGLPAFLP* |
| Ga0066395_104963692 | 3300004633 | Tropical Forest Soil | RLAASGLQVLQLGEVAGQILITALVSYRDPALAVRCGLPEIIG* |
| Ga0070703_103752672 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLQLLQLANVDGQPLITALVSYRDPSLAVRCGLPAELPLTPG* |
| Ga0066903_1086091444 | 3300005764 | Tropical Forest Soil | LVASGLQVLQLADSGGQPLITALVSYRDPALAIRCGLPPTLP* |
| Ga0066903_1091471142 | 3300005764 | Tropical Forest Soil | DERGRLAASGLQVLQLGEVDGQILITALVSYRDPELAVRCGLPAILG* |
| Ga0070717_101018354 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLVVTGLQIVQLADVNGELLISALVSYRDPAVAVRCGLPAVID* |
| Ga0070717_108647971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAVSGLQVLQLADVAGQPLIIALVSYRDPAVAIRCGLPAVLS* |
| Ga0070715_101209551 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DDHGRLAVSGLQVLQVNDVDGQPLITALVSYRDPSLAIRCGLPAALP* |
| Ga0074057_115536981 | 3300006605 | Soil | EHGRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPEIIG* |
| Ga0099794_106541942 | 3300007265 | Vadose Zone Soil | ASGLQVLQLTSVDGQPLITALVSYRDPALVIRCGLPAAL* |
| Ga0116217_109240901 | 3300009700 | Peatlands Soil | VLQLGEVDGQVLITHLVSYRDPALAIRCGLPPALP* |
| Ga0126374_109095953 | 3300009792 | Tropical Forest Soil | ASGLQVLQLADVDGQPLITALVSYRDPALAIRCGLPPALP* |
| Ga0126378_106071971 | 3300010361 | Tropical Forest Soil | GRLVASGLQVLQLANVDGQPLITALVSYRDPAIAIRCGLPAVLPN* |
| Ga0126378_114857041 | 3300010361 | Tropical Forest Soil | RGRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPEVLG* |
| Ga0126378_125587672 | 3300010361 | Tropical Forest Soil | ERGRLAASGLQVLQLGEVAGQILITALVSYRDPALAVRCGLPEIIG* |
| Ga0126378_128624031 | 3300010361 | Tropical Forest Soil | QPDEHGRLAVSGLQVLQLAEADGQILLAALVSYRDPALAVRCGLPEILG* |
| Ga0126377_123072062 | 3300010362 | Tropical Forest Soil | RMVTGLQVLQLGDLEGQPVIVALVSYRDPALAIRCGWPAALPATPMA* |
| Ga0126381_1010124162 | 3300010376 | Tropical Forest Soil | LAISGLQVLQLADVAGRPLITALVSYRDPALAIRCGLPARLSRR* |
| Ga0126381_1016759223 | 3300010376 | Tropical Forest Soil | GLQVLQLADSGGQPLITALVSYRDPALAIRCGLLPALP* |
| Ga0126350_115000072 | 3300010880 | Boreal Forest Soil | LQFGEVNGQLLITTLVSYRDPALAIRCGLPPFAA* |
| Ga0137389_114905232 | 3300012096 | Vadose Zone Soil | QLADSGGEPLITALVSYRDPALAIRCGLPASLARP* |
| Ga0137381_117584251 | 3300012207 | Vadose Zone Soil | QILQLSEVAGRPLISALVSYRDPAIATRCGLPEFAG* |
| Ga0137377_100719771 | 3300012211 | Vadose Zone Soil | IASGLQVLQLANVDGQPLITALVSYRDPALAIRCGLPAVLPN* |
| Ga0137372_107428661 | 3300012350 | Vadose Zone Soil | DPQGRLAVTGLQVLQVAETGGQPLVSALVSYRDPAIAVRCGLPEFIG* |
| Ga0137366_108273601 | 3300012354 | Vadose Zone Soil | ASGLQVLQLANVDGQPLITALVSYRDPALAIRCGLPAALPN* |
| Ga0126369_102684564 | 3300012971 | Tropical Forest Soil | VASGLQVLQLADVDGQPLIAALVSYRDPAIAIRCGLPAALT* |
| Ga0181531_101142835 | 3300014169 | Bog | LVVSGLQVLQLGEVDGQPLVTTLVSYRDPALAVRCGLPSSLP* |
| Ga0137420_13595351 | 3300015054 | Vadose Zone Soil | MSQTVKATLLVSGLQVLQLGEVDGRPLITTLVSYRDPDLAVRCGLQSSLP* |
| Ga0137403_112553672 | 3300015264 | Vadose Zone Soil | GLQVLQVSDAAGQPLISALVSYRDPAIAIRCGLPEFIG* |
| Ga0182033_118886281 | 3300016319 | Soil | GRLVASGLQVLQLASVDGRPLITALVSYRDPAIAIRCGLPAVLT |
| Ga0182035_102079353 | 3300016341 | Soil | GRLAASGLQVLQLGEVDGQIVITALVSYRDPALAVRCGLPEVLG |
| Ga0187808_102234672 | 3300017942 | Freshwater Sediment | LVARGLQLLTLGEVDGQVLVTALVSYRDPALAARCGLPGII |
| Ga0210396_103500193 | 3300021180 | Soil | VRQLGEVDDQPLITTLVSYRDPALAIRCGLPSSLP |
| Ga0210387_110105191 | 3300021405 | Soil | PDGAGRLAATGLQILQLGEVDGEPLITALVSYRDPALAARCGLPAILP |
| Ga0210386_107051101 | 3300021406 | Soil | QILQLASVNGQLLITALVSYRDPAVAIRCGLPATLS |
| Ga0210394_116396612 | 3300021420 | Soil | PDGAGGLVVSGLQVLQLSEVDGRPLITTVVSYRDPALAVRCGLSPSLP |
| Ga0210394_118110902 | 3300021420 | Soil | DRQGHLVVSGLQVLQLGEADGQLLITRLVSYRDPALAIRCGFAT |
| Ga0210384_110850403 | 3300021432 | Soil | HGRLAVSGLQVLQVNDVDGQPLITALVSYRDPSLAIRCGLPAALP |
| Ga0210398_103139221 | 3300021477 | Soil | PDGEGHLVVSGLQILQLGEVRGQLLITTLVSYRDPALAIRCAFAT |
| Ga0126371_115332762 | 3300021560 | Tropical Forest Soil | QVLQLTTVDGQPLITALVSYRDPALAIRCGLPAVLP |
| Ga0126371_117473292 | 3300021560 | Tropical Forest Soil | LQVLQLGEVDGQILITALISYRDPGLAVRCGLPEVLG |
| Ga0126371_122957883 | 3300021560 | Tropical Forest Soil | SGLQLLAIGDVNGDPVITALVSYRDPAIAVRCGLPAIIDPAR |
| Ga0126371_134737392 | 3300021560 | Tropical Forest Soil | TYQPDEHGRLAVDGLQVLQLSEVAGQILIAVLVSYRDPALAVRCGLPEILG |
| Ga0242665_102874701 | 3300022724 | Soil | VLQLARVNGQPLIAALVSYRDPVLVIRCGLRATLS |
| Ga0207693_109199631 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GVQILQLADVDGQPLITALVSYRDPGLAVRCGLPAEVAQLS |
| Ga0207664_112673361 | 3300025929 | Agricultural Soil | LQLANVDGQPLITALVSYRDPSLAVRCGLPAELPLTPG |
| Ga0209871_10286901 | 3300026217 | Permafrost Soil | QVLQLAETGGQVLITALVSYRDPGLVSRCGLPSSLPLPAPMSRDE |
| Ga0209647_12988912 | 3300026319 | Grasslands Soil | VSGLQILQLDNLGSQPLITVLVSYRDPALAIRCGLPPALP |
| Ga0257155_10909932 | 3300026481 | Soil | RLAVSGLQVLQLADSGGEPLITALVSYRDPALAIRCGLPAALP |
| Ga0257168_11429051 | 3300026514 | Soil | SGLQVLQIADVAGEPLITALVSYRDPALAIRCGLPPEWG |
| Ga0208366_10047213 | 3300027073 | Forest Soil | LQVLQLAEVNDQLLITTLVSYRDPAIAIRCGMPAVLQ |
| Ga0209466_11162432 | 3300027646 | Tropical Forest Soil | YQPDEHGRLAASGLQVLQLGEVAGQVLITALVSYRDPALAVRCGLPEILG |
| Ga0209624_104254863 | 3300027895 | Forest Soil | AVSGLQVLQLGEVNGQLLITTLVSYRDPALAIRCGLPPFAA |
| Ga0302177_100526361 | 3300030053 | Palsa | QLGEVDGQVLITLLVSYRDPALASRCGLPSSLPVSR |
| Ga0311353_108497231 | 3300030399 | Palsa | LQILQLGEVDGQVLITSLVSYRDPALASRCGLPSSLPVSR |
| Ga0311353_110900091 | 3300030399 | Palsa | GDGRPAVTGLQILQLAWVDGKPLISALASYRDPALAVRCGLPYFIT |
| Ga0311356_111725322 | 3300030617 | Palsa | DGRPAVTGLQILQLAWVDGKPLISALASYRDPALAVRCGLPDLIT |
| Ga0302324_1007014804 | 3300031236 | Palsa | LQILQLGEVDGQVLITLLVSYRDPALASRCGLPSSLPVSR |
| Ga0318516_103464592 | 3300031543 | Soil | PDERGRLAASGLQVLQLAEVDGQILITALVSYRDPALAVRCGLPGVLG |
| Ga0318534_103645601 | 3300031544 | Soil | LVASGLQVLQLADLDGQLLITALVSYRDPGLAIRCGLPAALP |
| Ga0318538_100583412 | 3300031546 | Soil | RGRLAASGLQVLQLGEEAGQILITALVSYRDPALAVRCGLPEIIG |
| Ga0318538_102239011 | 3300031546 | Soil | VTGLQVLQLADTGGQPLITALASYRDPALAIRCGMPALLQ |
| Ga0318538_103664101 | 3300031546 | Soil | LQVLHLADSGGQPLITALVSYRDPALAIRCGLPPVLP |
| Ga0318528_104549832 | 3300031561 | Soil | GRLAVSGLQILQLGEVHGQILIAALVSYRDPALAVRCGLPEILG |
| Ga0318528_104999532 | 3300031561 | Soil | GRLVASGLQVLQLGEVDGQVLVTALVSYRDPALVARCGLPEVL |
| Ga0318515_104666486 | 3300031572 | Soil | PDGRGRLVASGLQVLQLASVDGRPLITALVSYRDPAIAIRCGLPAVLT |
| Ga0318542_100663831 | 3300031668 | Soil | HLVVSGLQVLQLGEVDGQLLITTLVSYRDPALAIRCGLPPRLP |
| Ga0318574_103440421 | 3300031680 | Soil | TGLQVLQLADTGGQPLITALASYRDPALAIRCGMPALLQ |
| Ga0318572_100703224 | 3300031681 | Soil | QGRLVASGLQVLQLADVDGQPLITALVSYRDPALAIRCGLPPALP |
| Ga0318496_104025421 | 3300031713 | Soil | LVASGLQVLQLADVDGQPLITALVSYRDLAIAIRCGLPPALPD |
| Ga0318493_103722461 | 3300031723 | Soil | KGHLIVSGLQVLQLGEVNGQLLITTLVSYRDPVLAIRCGLPLRLP |
| Ga0318500_103366443 | 3300031724 | Soil | VLQLGEVNGQLLITTLVSYRDPALAIRCGLPPRLP |
| Ga0318501_104736191 | 3300031736 | Soil | LQVLHLADSGGQPLITALVSYRDPALAIRCGLPPALP |
| Ga0306918_108283431 | 3300031744 | Soil | QVLHLADSGGQPLITALVSYRDPALAIRCGLPPALP |
| Ga0306918_108562072 | 3300031744 | Soil | PDERGRLAASGLQVLQLGEVNGQILITALVSYRDPALAVRCGLPEVIG |
| Ga0306918_110921962 | 3300031744 | Soil | DGHGRLAASGLQVLQLTTVGGQPLITALVSYRDPALAIRCGLPATLS |
| Ga0318502_107766422 | 3300031747 | Soil | QVLQLGEVDGQILITALVSYRDPALAVRCGLPEVLG |
| Ga0318492_103204571 | 3300031748 | Soil | RGRLAASGLQVLQLAEVDGQILITALVSYRDPALAVRCGLPGVLG |
| Ga0318535_104859902 | 3300031764 | Soil | YQPDERGRLAASGLQVLQLGEVNGQILITALVSYRDPALAVRCGLPEVIG |
| Ga0318554_102136631 | 3300031765 | Soil | GAGKAEDGRLVASGLLVLQLAEMDGQVLVTALVSYRDPALAARCGLPAVI |
| Ga0318509_102974374 | 3300031768 | Soil | VLHLADSGGQPLITALVSYRDPALAIRCGLPPVLP |
| Ga0318521_106940282 | 3300031770 | Soil | VLQLGEADGQILVAALVSYRDPGLAVRCGLPEILG |
| Ga0318546_102071421 | 3300031771 | Soil | VASGLQVLQLASVDGRPLITALVSYRDPAIAIRCGLPAVLT |
| Ga0318546_109399142 | 3300031771 | Soil | SLAVTGLQVLQLADTSGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0318543_101182442 | 3300031777 | Soil | ERGRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPAILG |
| Ga0318498_103443351 | 3300031778 | Soil | VLQLTSVGGQPLITALVSYRDPALAIRCGLPATLS |
| Ga0318566_106289211 | 3300031779 | Soil | PEGRLVVSGLQVLQLADTGGQPLITALVSYRDAGLAVRCGMPAMQAM |
| Ga0318529_105391762 | 3300031792 | Soil | HGLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPEVLG |
| Ga0318567_105535761 | 3300031821 | Soil | QGLAASGLQVLQLGEADGQILVAALVSYRDPGLAVRCGLPEILG |
| Ga0310917_104084622 | 3300031833 | Soil | SGLQILQLGEVHGQILIAALVSYRDPALAVRCGLPEILG |
| Ga0318517_100659672 | 3300031835 | Soil | QDLQLGEEAGQILITALVSYRDPALAVRCGLPEIIG |
| Ga0318517_101759162 | 3300031835 | Soil | EPGPEGSLAVTGLQVLQLADTSGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0318511_103172723 | 3300031845 | Soil | QGRLIASGLQVLHLADSGGQPLITALVSYRDPALAIRCGLPPVLP |
| Ga0318527_104380362 | 3300031859 | Soil | EPDTEGRLAVSGLQILQLADAGGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0318495_101715481 | 3300031860 | Soil | PDGQGRLAASGLQVLQLAVIDGQLLITALVSYRDPALAIRCGLPAALP |
| Ga0318495_105533231 | 3300031860 | Soil | QGRLVVSGLQVLQLADLDGQLLITALVSYRDPGLAIRCGLPAALP |
| Ga0306919_110764552 | 3300031879 | Soil | TGLQVLQLADTSGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0306925_106855145 | 3300031890 | Soil | DGRGRLVASGLQVLQLASVDGRPLITALVSYRDPAIAIRCGLPAVLT |
| Ga0318536_104744173 | 3300031893 | Soil | ASGLQVLQLADVDGQLLITALVSYRDPALAIRCGLPAVLS |
| Ga0318522_101904671 | 3300031894 | Soil | LIASGLQVLQLADVDGQPLITALVSYRDPALAIRCGLPAVLS |
| Ga0318551_107315551 | 3300031896 | Soil | VLQLADSGGQPLITALVSYRDPALAIRCGLPPALP |
| Ga0318551_108255481 | 3300031896 | Soil | LQVLQLGEVNGQLLITTLVSYRDPALAIRCGLPPRLP |
| Ga0318520_103982732 | 3300031897 | Soil | PDGRGRLVASGLQVLQLADSGGQPLITALVSYRDPALAIRCGLPAALP |
| Ga0306921_120669761 | 3300031912 | Soil | ASGLQVLQLADLDGQLLITALVSYRDPGLAIRCGLPAALP |
| Ga0310916_109751552 | 3300031942 | Soil | GRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPEVLG |
| Ga0310916_116075332 | 3300031942 | Soil | VASGLQVLQLADVDGHPLITALVSYRDPALAIRCGLPPTLP |
| Ga0310913_102239391 | 3300031945 | Soil | ERGRLAASGLQVLQLAEVDGQILITALVSYRDPALAVRCGLPGVLG |
| Ga0310913_105493512 | 3300031945 | Soil | SGLLVLQLGEVDGRVLVTALVSYRDPALAVRCGLPEVI |
| Ga0310910_105476051 | 3300031946 | Soil | DHGRLAASGLQVLQLGEVDGHILIVALVSYRDPALAVRCGLPGILG |
| Ga0306926_114345002 | 3300031954 | Soil | QPDERGRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPAILG |
| Ga0318563_101563492 | 3300032009 | Soil | YQPDERGRLAASGLQVLQLGEEAGQILITALVSYRDPALAVRCGLPEIIG |
| Ga0318569_101329311 | 3300032010 | Soil | SGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPAILG |
| Ga0318507_102035552 | 3300032025 | Soil | VLQLADTSGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0318556_105718391 | 3300032043 | Soil | RLVASGLLVLQLAEMDGQVLVTALVSYRDPALAARCGLPAVI |
| Ga0318558_104259261 | 3300032044 | Soil | DERGRLVASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPEVLS |
| Ga0318570_104292541 | 3300032054 | Soil | DEHGRLVASGLLVLQLGEVDGRVLVTALVSYRDPALAVRCGLPEVI |
| Ga0318533_105534731 | 3300032059 | Soil | YQPDERGRLAASGLQVLQLGEVDGQILITALVSYRDPALAVRCGLPAILG |
| Ga0318504_101037782 | 3300032063 | Soil | TVTGLQVLQLADTGGQPLITALASYRDPALAIRCGMPALLQ |
| Ga0318510_103432252 | 3300032064 | Soil | EGSLAVTGLQVLQLADTSGQPLITALASYRDPALAIRCGMPAVLQ |
| Ga0318513_100769289 | 3300032065 | Soil | SGLQVLQLASVDGRPLITALVSYRDPAIAIRCGLPAVLT |
| Ga0318524_103139593 | 3300032067 | Soil | LQVLHLADSGGQPLITALVSYRDPALAIRCGLPPTLP |
| Ga0306924_111664462 | 3300032076 | Soil | GRLVASGLLVLQLAEMDGQVLVTALVSYRDPALAARCGLPAVI |
| Ga0306920_1034250671 | 3300032261 | Soil | LQVLQLADVGGRPLITALVSYRDPALAIRCGLPAALPS |
| ⦗Top⦘ |