| Basic Information | |
|---|---|
| Family ID | F070583 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNDQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.49 % |
| % of genes near scaffold ends (potentially truncated) | 28.46 % |
| % of genes from short scaffolds (< 2000 bps) | 82.11 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.545 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.634 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 8.97% β-sheet: 0.00% Coil/Unstructured: 91.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 11.57 |
| PF00664 | ABC_membrane | 4.13 |
| PF03976 | PPK2 | 1.65 |
| PF03412 | Peptidase_C39 | 0.83 |
| PF00474 | SSF | 0.83 |
| PF00753 | Lactamase_B | 0.83 |
| PF13580 | SIS_2 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.54 % |
| All Organisms | root | All Organisms | 28.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120415661 | Not Available | 1052 | Open in IMG/M |
| 3300004479|Ga0062595_100084395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1621 | Open in IMG/M |
| 3300004799|Ga0058863_10041686 | Not Available | 578 | Open in IMG/M |
| 3300004799|Ga0058863_10089624 | Not Available | 2351 | Open in IMG/M |
| 3300004799|Ga0058863_10092598 | Not Available | 3106 | Open in IMG/M |
| 3300004799|Ga0058863_11830263 | Not Available | 1023 | Open in IMG/M |
| 3300004799|Ga0058863_11877787 | Not Available | 888 | Open in IMG/M |
| 3300004799|Ga0058863_11919424 | Not Available | 1588 | Open in IMG/M |
| 3300004800|Ga0058861_11423904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 632 | Open in IMG/M |
| 3300004803|Ga0058862_10277846 | Not Available | 514 | Open in IMG/M |
| 3300004803|Ga0058862_12001524 | Not Available | 554 | Open in IMG/M |
| 3300004803|Ga0058862_12123774 | Not Available | 696 | Open in IMG/M |
| 3300004803|Ga0058862_12175969 | Not Available | 561 | Open in IMG/M |
| 3300005168|Ga0066809_10028998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1161 | Open in IMG/M |
| 3300005178|Ga0066688_10179290 | Not Available | 1338 | Open in IMG/M |
| 3300005332|Ga0066388_102185578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 998 | Open in IMG/M |
| 3300005332|Ga0066388_103629024 | Not Available | 788 | Open in IMG/M |
| 3300005332|Ga0066388_105887448 | Not Available | 620 | Open in IMG/M |
| 3300005337|Ga0070682_101761645 | Not Available | 539 | Open in IMG/M |
| 3300005434|Ga0070709_10287185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1197 | Open in IMG/M |
| 3300005434|Ga0070709_10321067 | Not Available | 1136 | Open in IMG/M |
| 3300005435|Ga0070714_100270555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1575 | Open in IMG/M |
| 3300005435|Ga0070714_101526158 | Not Available | 653 | Open in IMG/M |
| 3300005435|Ga0070714_101828746 | Not Available | 593 | Open in IMG/M |
| 3300005436|Ga0070713_100036017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3990 | Open in IMG/M |
| 3300005436|Ga0070713_100202231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1794 | Open in IMG/M |
| 3300005436|Ga0070713_101156354 | Not Available | 749 | Open in IMG/M |
| 3300005436|Ga0070713_101507356 | Not Available | 652 | Open in IMG/M |
| 3300005436|Ga0070713_102322847 | Not Available | 519 | Open in IMG/M |
| 3300005437|Ga0070710_10083271 | Not Available | 1872 | Open in IMG/M |
| 3300005439|Ga0070711_100844937 | Not Available | 779 | Open in IMG/M |
| 3300005530|Ga0070679_101924164 | Not Available | 540 | Open in IMG/M |
| 3300005533|Ga0070734_10005010 | All Organisms → cellular organisms → Bacteria | 12049 | Open in IMG/M |
| 3300005537|Ga0070730_10011323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 7286 | Open in IMG/M |
| 3300005542|Ga0070732_10039424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2710 | Open in IMG/M |
| 3300005764|Ga0066903_100096665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3963 | Open in IMG/M |
| 3300005764|Ga0066903_100620898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1880 | Open in IMG/M |
| 3300006041|Ga0075023_100008529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2603 | Open in IMG/M |
| 3300006050|Ga0075028_100930127 | Not Available | 537 | Open in IMG/M |
| 3300006050|Ga0075028_101093498 | Not Available | 500 | Open in IMG/M |
| 3300006163|Ga0070715_10981891 | Not Available | 525 | Open in IMG/M |
| 3300006173|Ga0070716_100354133 | Not Available | 1040 | Open in IMG/M |
| 3300006755|Ga0079222_10169527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1269 | Open in IMG/M |
| 3300006852|Ga0075433_11134799 | Not Available | 679 | Open in IMG/M |
| 3300006854|Ga0075425_100142135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2747 | Open in IMG/M |
| 3300009174|Ga0105241_10368978 | Not Available | 1251 | Open in IMG/M |
| 3300009551|Ga0105238_11760219 | Not Available | 651 | Open in IMG/M |
| 3300010043|Ga0126380_11146829 | Not Available | 666 | Open in IMG/M |
| 3300010046|Ga0126384_10320624 | Not Available | 1281 | Open in IMG/M |
| 3300010154|Ga0127503_10393793 | Not Available | 720 | Open in IMG/M |
| 3300010358|Ga0126370_11288045 | Not Available | 684 | Open in IMG/M |
| 3300010359|Ga0126376_10357056 | Not Available | 1298 | Open in IMG/M |
| 3300010359|Ga0126376_10537040 | Not Available | 1091 | Open in IMG/M |
| 3300010359|Ga0126376_11665576 | Not Available | 672 | Open in IMG/M |
| 3300010361|Ga0126378_11814451 | Not Available | 694 | Open in IMG/M |
| 3300010362|Ga0126377_12383392 | Not Available | 605 | Open in IMG/M |
| 3300010366|Ga0126379_12160853 | Not Available | 658 | Open in IMG/M |
| 3300010366|Ga0126379_13601879 | Not Available | 519 | Open in IMG/M |
| 3300010397|Ga0134124_10137403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2167 | Open in IMG/M |
| 3300011271|Ga0137393_10059908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3005 | Open in IMG/M |
| 3300012206|Ga0137380_10019340 | All Organisms → cellular organisms → Bacteria | 6251 | Open in IMG/M |
| 3300012212|Ga0150985_106043792 | Not Available | 963 | Open in IMG/M |
| 3300012931|Ga0153915_10999529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 974 | Open in IMG/M |
| 3300012944|Ga0137410_10979665 | Not Available | 719 | Open in IMG/M |
| 3300012955|Ga0164298_10235324 | Not Available | 1095 | Open in IMG/M |
| 3300012957|Ga0164303_10773121 | Not Available | 657 | Open in IMG/M |
| 3300012961|Ga0164302_10525237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 841 | Open in IMG/M |
| 3300012961|Ga0164302_10892101 | Not Available | 681 | Open in IMG/M |
| 3300012984|Ga0164309_10225343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1306 | Open in IMG/M |
| 3300012984|Ga0164309_10475074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 951 | Open in IMG/M |
| 3300012987|Ga0164307_10021183 | Not Available | 3364 | Open in IMG/M |
| 3300012988|Ga0164306_11844517 | Not Available | 526 | Open in IMG/M |
| 3300012989|Ga0164305_10130961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1670 | Open in IMG/M |
| 3300016357|Ga0182032_11162531 | Not Available | 663 | Open in IMG/M |
| 3300017930|Ga0187825_10303890 | Not Available | 595 | Open in IMG/M |
| 3300020069|Ga0197907_10075506 | Not Available | 3054 | Open in IMG/M |
| 3300020069|Ga0197907_10727879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2599 | Open in IMG/M |
| 3300020069|Ga0197907_10884234 | Not Available | 581 | Open in IMG/M |
| 3300020069|Ga0197907_11324422 | Not Available | 1147 | Open in IMG/M |
| 3300020070|Ga0206356_10315904 | All Organisms → cellular organisms → Eukaryota | 1003 | Open in IMG/M |
| 3300020070|Ga0206356_11475975 | Not Available | 534 | Open in IMG/M |
| 3300020078|Ga0206352_10263975 | Not Available | 715 | Open in IMG/M |
| 3300020080|Ga0206350_11355257 | Not Available | 555 | Open in IMG/M |
| 3300020080|Ga0206350_11484287 | Not Available | 577 | Open in IMG/M |
| 3300020082|Ga0206353_10142020 | Not Available | 3177 | Open in IMG/M |
| 3300021560|Ga0126371_13469635 | Not Available | 532 | Open in IMG/M |
| 3300021855|Ga0213854_1398314 | Not Available | 509 | Open in IMG/M |
| 3300025321|Ga0207656_10112916 | Not Available | 1257 | Open in IMG/M |
| 3300025898|Ga0207692_10166696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1273 | Open in IMG/M |
| 3300025898|Ga0207692_10471902 | Not Available | 793 | Open in IMG/M |
| 3300025916|Ga0207663_11528275 | Not Available | 537 | Open in IMG/M |
| 3300025921|Ga0207652_10224228 | Not Available | 1694 | Open in IMG/M |
| 3300025921|Ga0207652_10488776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1108 | Open in IMG/M |
| 3300025924|Ga0207694_10050425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3223 | Open in IMG/M |
| 3300025924|Ga0207694_10401854 | Not Available | 1139 | Open in IMG/M |
| 3300025924|Ga0207694_11144949 | Not Available | 658 | Open in IMG/M |
| 3300025928|Ga0207700_10008690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 6308 | Open in IMG/M |
| 3300025928|Ga0207700_10291974 | Not Available | 1405 | Open in IMG/M |
| 3300025928|Ga0207700_10476905 | Not Available | 1102 | Open in IMG/M |
| 3300025928|Ga0207700_11526195 | Not Available | 592 | Open in IMG/M |
| 3300026142|Ga0207698_10128284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2162 | Open in IMG/M |
| 3300026142|Ga0207698_10341892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1410 | Open in IMG/M |
| 3300026142|Ga0207698_11351897 | Not Available | 727 | Open in IMG/M |
| 3300026319|Ga0209647_1139548 | Not Available | 1057 | Open in IMG/M |
| 3300027821|Ga0209811_10338391 | Not Available | 582 | Open in IMG/M |
| 3300027826|Ga0209060_10089820 | Not Available | 1442 | Open in IMG/M |
| 3300027842|Ga0209580_10028842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2512 | Open in IMG/M |
| 3300027857|Ga0209166_10053073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2357 | Open in IMG/M |
| 3300027910|Ga0209583_10026582 | Not Available | 1887 | Open in IMG/M |
| 3300030847|Ga0075405_12206697 | Not Available | 1315 | Open in IMG/M |
| 3300030917|Ga0075382_11741859 | Not Available | 889 | Open in IMG/M |
| 3300030917|Ga0075382_11773615 | Not Available | 685 | Open in IMG/M |
| 3300030967|Ga0075399_11408671 | Not Available | 501 | Open in IMG/M |
| 3300030967|Ga0075399_11408671 | Not Available | 501 | Open in IMG/M |
| 3300030969|Ga0075394_11997726 | Not Available | 627 | Open in IMG/M |
| 3300031057|Ga0170834_110008486 | Not Available | 655 | Open in IMG/M |
| 3300031231|Ga0170824_120096459 | Not Available | 591 | Open in IMG/M |
| 3300031446|Ga0170820_11072161 | Not Available | 577 | Open in IMG/M |
| 3300031446|Ga0170820_13247916 | Not Available | 1459 | Open in IMG/M |
| 3300031446|Ga0170820_13247916 | Not Available | 1459 | Open in IMG/M |
| 3300031469|Ga0170819_12938885 | Not Available | 1622 | Open in IMG/M |
| 3300031962|Ga0307479_10270254 | Not Available | 1680 | Open in IMG/M |
| 3300033475|Ga0310811_10114227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3472 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.94% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 8.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 8.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.25% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1204156613 | 3300002568 | Soil | MNDQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0062595_1000843952 | 3300004479 | Soil | MNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDTSIGDC* |
| Ga0058863_100416861 | 3300004799 | Host-Associated | MNDQNRILVRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0058863_100896244 | 3300004799 | Host-Associated | MNEQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0058863_100925982 | 3300004799 | Host-Associated | MNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC* |
| Ga0058863_118302633 | 3300004799 | Host-Associated | MNDNERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0058863_118777872 | 3300004799 | Host-Associated | MNDQNRVLSRKGARELDREETERVSGGLRTLTACTFDPDLGGRDGDGPPEC* |
| Ga0058863_119194244 | 3300004799 | Host-Associated | MNDNNRVLVRTGARELNRKETEQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0058861_114239041 | 3300004800 | Host-Associated | MNDQNRVLIRRGARELDRDETKRVSGGLGTLTACTWDPDF |
| Ga0058862_102778461 | 3300004803 | Host-Associated | RKDMNDQNRILVRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0058862_120015241 | 3300004803 | Host-Associated | MNDETRVLIRRGARELDREETKQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0058862_121237741 | 3300004803 | Host-Associated | MNDQNRVLIRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0058862_121759691 | 3300004803 | Host-Associated | MNYQNRVLSRKGARELDREETERVSGGLRTLTACTFDPDLGGRDGDGPPEC* |
| Ga0066809_100289981 | 3300005168 | Soil | MNDESRVLIRQGARELDRQETKQVSGGLRTLTACTWDPEFGRDGDGPPEC* |
| Ga0066688_101792901 | 3300005178 | Soil | MNDESRVLVRQGARELDRQETEQVSGGLRTLTACTWDPDLGGRDGDGPPEC* |
| Ga0066388_1021855781 | 3300005332 | Tropical Forest Soil | MDNDNRVLVRTGARELNREETKQVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0066388_1036290243 | 3300005332 | Tropical Forest Soil | MDNDNRVLVRTGARELNREETKQVSGGFGTLTACTWDPDFGRDGDGPPEC* |
| Ga0066388_1058874481 | 3300005332 | Tropical Forest Soil | MKDNNRVLARNGARELNREETERVSGGFGTQTACTWDPDLGGRDGDGPPEC* |
| Ga0070682_1017616451 | 3300005337 | Corn Rhizosphere | DKGELDMNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC* |
| Ga0070709_102871851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNESRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070709_103210673 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDESRVLVRRGARELDRDETKRVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070714_1002705554 | 3300005435 | Agricultural Soil | MNDQSRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070714_1015261581 | 3300005435 | Agricultural Soil | MNDQNRVLIRKGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0070714_1018287462 | 3300005435 | Agricultural Soil | MKDESRVLVRRGARELDRDETKRVSGGLTTLTACTWDPDFGRDGD |
| Ga0070713_1000360174 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQSRVLIRRGARELDREETKKVSGGLNTQTACTWDPDLGGRDGDGPPEC* |
| Ga0070713_1002022313 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQSRVLVRRGARELDRDETKRVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070713_1011563541 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNESRVLVRRGARELDREETKRASGGFGTLTACTWDPDFGRDGDGPPEC* |
| Ga0070713_1015073561 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNNERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0070713_1023228471 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDESRVLVRRGARELDRDETKRVSGGLTTLTACTWDPDFGRDGDG |
| Ga0070710_100832718 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDKNRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070711_1008449371 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNKNRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0070679_1019241642 | 3300005530 | Corn Rhizosphere | KMKKTKKEKSMNDNNRVLVRTGARELNRKETEQVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0070734_100050105 | 3300005533 | Surface Soil | MNDESRVLIRRGARELDREETKQVSGGVRTLTACTWDPDFGGDGDSSIGEC* |
| Ga0070730_100113235 | 3300005537 | Surface Soil | MNDESRVLIRRGARELDREETKKVSGGLNTQTACTWDPDLGGRDGDGPPEC* |
| Ga0070732_100394247 | 3300005542 | Surface Soil | MNDESRVLIRRGARELDREETKKVSGGLNTQTACTWDPDFGGRDGDGPPEC* |
| Ga0066903_1000966655 | 3300005764 | Tropical Forest Soil | MNDSNRVLTRTGARELNRDEVDRVSGSIGTLTACTWDPDFGPDGDAQIGEC* |
| Ga0066903_1006208984 | 3300005764 | Tropical Forest Soil | MNDNDRVLVRTGARELNREETEQVSGGFRTLTACTWDPDFGRDGDGPPEC* |
| Ga0075023_1000085295 | 3300006041 | Watersheds | MNDQDRVLIRQGARELDRKETEQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0075028_1009301271 | 3300006050 | Watersheds | VLIRKGARELNREETELVSGGLRTLTACTWDPDLGGRDGDGPPEC* |
| Ga0075028_1010934982 | 3300006050 | Watersheds | MNDNNRVLIRQGARELDREETERVSGGLRTLTACTWDPDFGKDGDASIGEC* |
| Ga0070715_109818911 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRGARELDRDETKRVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0070716_1003541332 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEESRVLIRRGARELDREETKQVSGGLRTLTACTFDPDLGGRDGDGPPEC* |
| Ga0079222_101695274 | 3300006755 | Agricultural Soil | MKDESRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0075433_111347992 | 3300006852 | Populus Rhizosphere | MTKGEQSMNDNNRVLARNGARELNREETERVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0075425_1001421353 | 3300006854 | Populus Rhizosphere | MNDNNRVLARNGARELNREETERVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0105241_103689782 | 3300009174 | Corn Rhizosphere | MNEQNRVLIRRRARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0105238_117602191 | 3300009551 | Corn Rhizosphere | VLIRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0126380_111468292 | 3300010043 | Tropical Forest Soil | MKDNNRVLVRNGARELNREETERVSGGLQTQTACTWDPDLGGRDGDGPPEC* |
| Ga0126384_103206244 | 3300010046 | Tropical Forest Soil | KDNNRVLVRNGARELNREETERVSGGLQTQTACTWDPDLGGRDGDGPPEC* |
| Ga0127503_103937933 | 3300010154 | Soil | MNDQNRVLIRKGARELDREETERVSGGLRTLTACTWDPDFGGDGDHFIGEC* |
| Ga0126370_112880451 | 3300010358 | Tropical Forest Soil | MNNESRVLVRRGARELDRDETRKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0126376_103570562 | 3300010359 | Tropical Forest Soil | MNDNNRVLTRTGARELNRDEVDRVSGSIGTLTACTWDPDFGKDGDSAIGEC* |
| Ga0126376_105370402 | 3300010359 | Tropical Forest Soil | MNDNNRVLTRTGARELNRDEVDRVSGSLGTLTACTWDPDFGKDGDAQIGEC* |
| Ga0126376_116655761 | 3300010359 | Tropical Forest Soil | MDQNRVLIRRGARELNREETEQVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0126378_118144512 | 3300010361 | Tropical Forest Soil | MNDQNRVLIRRGARELDKDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0126377_123833921 | 3300010362 | Tropical Forest Soil | MNDNNRVLTRTGARELNRDEVDRVSGSLGTLTACTWDPDFGKDGDAAIGEC* |
| Ga0126379_121608533 | 3300010366 | Tropical Forest Soil | MSDDNNRVLTRRGARELNREEVERVNGGLNTLTACTWDPDFGGDGDRGIGEC* |
| Ga0126379_136018791 | 3300010366 | Tropical Forest Soil | MNDNNRVLARNGARELNRKETEQVSGGLGTLTACTWDPDFGRDGDGPPEC* |
| Ga0134124_101374034 | 3300010397 | Terrestrial Soil | MNDNERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFGRDGDGLSEC* |
| Ga0137393_100599085 | 3300011271 | Vadose Zone Soil | MNDQNRVLIRKGARELDREETERVSGGLRTLTACTFDPESGGRDGDVSLGEC* |
| Ga0137380_100193402 | 3300012206 | Vadose Zone Soil | MNDESRVLVRQGARELDRQETEQVSGGLRTLTACTWDPDFGGDGDHSIGEC* |
| Ga0150985_1060437922 | 3300012212 | Avena Fatua Rhizosphere | MNDNNRVLVRNGARELNREETEQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0153915_109995292 | 3300012931 | Freshwater Wetlands | MNDESRVLIRQGARELDREETERVSGGLRTLTACTWDPDFGGDGDSSIGEC* |
| Ga0137410_109796652 | 3300012944 | Vadose Zone Soil | MNDEIRVLIRQGARELDREETERVSGGLRTLTACTWDPDFGADGDASIGEC* |
| Ga0164298_102353241 | 3300012955 | Soil | RRTSMNNESRVLVRRGARELDRDETKKVSGGLATLTACTWDPDFGRDGDGPPEC* |
| Ga0164303_107731211 | 3300012957 | Soil | KKRRTSMNNENRVLIRQGARELDREETERVSGGLRTLTACTWDPDLGGRDGDGPPEC* |
| Ga0164302_105252374 | 3300012961 | Soil | MNDNERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFG |
| Ga0164302_108921012 | 3300012961 | Soil | MTDNNRVLARNGARELNREETERVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0164309_102253432 | 3300012984 | Soil | MNDQNRVLIRKGARELDREETERVSGGLRTLTACTFDPDLGGRDGDGPPEC* |
| Ga0164309_104750744 | 3300012984 | Soil | MNDTSRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC* |
| Ga0164307_100211831 | 3300012987 | Soil | MSDNNRVLVRTGARELNREETEQVSGGLRTLTACTWDPDFGRDGDGPPEC* |
| Ga0164306_118445172 | 3300012988 | Soil | QNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC* |
| Ga0164305_101309614 | 3300012989 | Soil | MKDESRVLVRRGARELDRDETKRVSGGLTTRTARAWDPDCGRDGDGPPEV* |
| Ga0182032_111625312 | 3300016357 | Soil | MNDKNRVLVRRGARELDRDETKKVSGGFGTLTACTWDPDFGRDGDGPPEC |
| Ga0187825_103038901 | 3300017930 | Freshwater Sediment | MNDEKRVLVRRGARELDREETRKVSGGLNTQTACTWDPD |
| Ga0197907_100755063 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC |
| Ga0197907_107278794 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDTSIGDC |
| Ga0197907_108842341 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRVLIRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0197907_113244222 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0206356_103159042 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRILVRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0206356_114759752 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0206352_102639753 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0206350_113552572 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRILVRRGARELDRDETKRVSGGLGTLTACTWD |
| Ga0206350_114842871 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | RQRRKDMNDQNRILVRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0206353_101420209 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRVLIRKGARDLDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC |
| Ga0126371_134696351 | 3300021560 | Tropical Forest Soil | MNNESRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC |
| Ga0213854_13983141 | 3300021855 | Watersheds | MNDQNRVLIRRGARELDREETERVSGGLRTLTVCTWDPDFGGDGDHFF |
| Ga0207656_101129163 | 3300025321 | Corn Rhizosphere | MNEQNRVLIRKGARDLDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC |
| Ga0207692_101666964 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDESRVLVRRGARELDRDETKRVSGGLTTLTACTWDPDFGRDG |
| Ga0207692_104719023 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDKNRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC |
| Ga0207663_115282751 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQDRVLIRRGARELDREETKKVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0207652_102242287 | 3300025921 | Corn Rhizosphere | NCDKGELDMNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDFGKDGDASIGEC |
| Ga0207652_104887761 | 3300025921 | Corn Rhizosphere | MNDQNRVLIRKGARELDREETGRVGGSLGTLTACTWDPDF |
| Ga0207694_100504255 | 3300025924 | Corn Rhizosphere | MNDQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDG |
| Ga0207694_104018544 | 3300025924 | Corn Rhizosphere | TNMNDQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0207694_111449491 | 3300025924 | Corn Rhizosphere | VLIRRGARELDRDETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0207700_100086905 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQNRVLIRKGARELDREETQRVSGGLRTLTACTFDPDLGGRDGDVSLGEC |
| Ga0207700_102919743 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDQSRVLIRRGARELDREETKKVSGGLNTQTACTWDPDLGGRDGDGPPEC |
| Ga0207700_104769054 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNESRVLVRRGARELDREETKRASGGFGTLTACTWDPDFGRDGDGPPEC |
| Ga0207700_115261951 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KEKSMNNESRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC |
| Ga0207698_101282845 | 3300026142 | Corn Rhizosphere | MNEQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPYFGRD |
| Ga0207698_103418925 | 3300026142 | Corn Rhizosphere | MNDQNRVLIRKGARDLDREETGRVGGSLGTLTACTWDPDFGK |
| Ga0207698_113518973 | 3300026142 | Corn Rhizosphere | MNDQNRVLIRRGARELDREETKRVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0209647_11395484 | 3300026319 | Grasslands Soil | MNDQNRVLIRKGARELDREETERVSGGLRTLTACTFDPESGGRDGDVSLGEC |
| Ga0209811_103383913 | 3300027821 | Surface Soil | NDHERVLIRRGARELNREETKQVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0209060_100898202 | 3300027826 | Surface Soil | MNDESRVLIRRGARELDREETKQVSGGVRTLTACTWDPDFGGDGDSSIGEC |
| Ga0209580_100288424 | 3300027842 | Surface Soil | MNDESRVLIRRGARELDREETKKVSGGLNTQTACTWDPDFGGRDGDGPPEC |
| Ga0209166_100530732 | 3300027857 | Surface Soil | MNDESRVLIRRGARELDREETKKVSGGLNTQTACTWDPDLGGRDGDGPPEC |
| Ga0209583_100265822 | 3300027910 | Watersheds | MNDQDRVLIRQGARELDRKETEQVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0075405_122066971 | 3300030847 | Soil | RGARELDRDETKKVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0075382_117418591 | 3300030917 | Soil | MNDESRVLVRQGARELDRKETEQVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0075382_117736153 | 3300030917 | Soil | MNDESRVLIRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPEC |
| Ga0075399_114086711 | 3300030967 | Soil | MKKGESMTEESRVLIRQGARELDREETGRVGGSIGTLTACTWDPDFGKDGDASIGEC |
| Ga0075399_114086712 | 3300030967 | Soil | QDRVLIRRGARELDRDETKKVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0075394_119977261 | 3300030969 | Soil | MNEQDRVLIRRGARELDREETKKVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0170834_1100084862 | 3300031057 | Forest Soil | MNEQDRVLIRRGARELDRDETKKVSGGLGTLTACTWDPDFGRDGDGPPEC |
| Ga0170824_1200964591 | 3300031231 | Forest Soil | MNEQDRVLIRRGARELDRDETKKVSGGLRTLTACTWDPDFGRDGDG |
| Ga0170820_110721612 | 3300031446 | Forest Soil | RKEKSMNEQDRVLIRRGARELDRDETKKVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0170820_132479161 | 3300031446 | Forest Soil | MNEQDRVLIRRGARELDRDETKKVSGGLRTLTACTWDPDFGRDGDGPPEC |
| Ga0170820_132479162 | 3300031446 | Forest Soil | MNEQDRVLIRQGARELDREETGRVGGSIGTLTACTWDPDFGKDGDASIGEC |
| Ga0170819_129388855 | 3300031469 | Forest Soil | MTEESRVLIRQGARELDREETGRVGGSIGTLTACTWDPDFGKDGDASIGEC |
| Ga0307479_102702543 | 3300031962 | Hardwood Forest Soil | MNDESRVLIRRGARELDREETKKVSGGLNTQTACTWDPDRGGRDGDGPPES |
| Ga0310811_101142278 | 3300033475 | Soil | MNNESRVLVRRGARELDRDETKKVSGGLTTLTACTWDPDFGRDGDGPPDC |
| ⦗Top⦘ |