| Basic Information | |
|---|---|
| Family ID | F070524 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLPF |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.36 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 86.99 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.073 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.764 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.780 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF03471 | CorC_HlyC | 40.65 |
| PF00005 | ABC_tran | 2.44 |
| PF01797 | Y1_Tnp | 2.44 |
| PF02687 | FtsX | 1.63 |
| PF12704 | MacB_PCD | 1.63 |
| PF04397 | LytTR | 0.81 |
| PF01969 | Ni_insertion | 0.81 |
| PF10728 | DUF2520 | 0.81 |
| PF07804 | HipA_C | 0.81 |
| PF08681 | DUF1778 | 0.81 |
| PF01594 | AI-2E_transport | 0.81 |
| PF12679 | ABC2_membrane_2 | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF03544 | TonB_C | 0.81 |
| PF13305 | TetR_C_33 | 0.81 |
| PF13545 | HTH_Crp_2 | 0.81 |
| PF06983 | 3-dmu-9_3-mt | 0.81 |
| PF13602 | ADH_zinc_N_2 | 0.81 |
| PF02384 | N6_Mtase | 0.81 |
| PF01804 | Penicil_amidase | 0.81 |
| PF00294 | PfkB | 0.81 |
| PF00106 | adh_short | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.44 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.81 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.81 |
| COG3550 | Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin module | Signal transduction mechanisms [T] | 0.81 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.81 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.37 % |
| Unclassified | root | N/A | 1.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10074286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300001593|JGI12635J15846_10557663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300005179|Ga0066684_10947291 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005186|Ga0066676_10226623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300005332|Ga0066388_100041728 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
| 3300005332|Ga0066388_105212310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005336|Ga0070680_100698937 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005434|Ga0070709_10840653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300005435|Ga0070714_100428150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300005542|Ga0070732_10243105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300005542|Ga0070732_10861549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005563|Ga0068855_100997905 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005563|Ga0068855_101912521 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005614|Ga0068856_100591500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300005764|Ga0066903_102866770 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005764|Ga0066903_103623769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300005764|Ga0066903_107336074 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006052|Ga0075029_100548544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300006086|Ga0075019_10071271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1971 | Open in IMG/M |
| 3300006172|Ga0075018_10233680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300006173|Ga0070716_100336328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300006954|Ga0079219_11895167 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006954|Ga0079219_12141033 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007255|Ga0099791_10428290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300009038|Ga0099829_10088582 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300009038|Ga0099829_10385543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1157 | Open in IMG/M |
| 3300009088|Ga0099830_10757644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300009088|Ga0099830_11220506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009143|Ga0099792_10341457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300009792|Ga0126374_11906548 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009839|Ga0116223_10911453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010048|Ga0126373_10331280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1529 | Open in IMG/M |
| 3300010048|Ga0126373_11809746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300010048|Ga0126373_12108724 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010048|Ga0126373_12464246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 580 | Open in IMG/M |
| 3300010358|Ga0126370_10823464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300010361|Ga0126378_12434162 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010366|Ga0126379_12934209 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010373|Ga0134128_11953819 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010376|Ga0126381_102362007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300010396|Ga0134126_10060356 | All Organisms → cellular organisms → Bacteria | 4730 | Open in IMG/M |
| 3300010396|Ga0134126_10188845 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300010396|Ga0134126_12429115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300010396|Ga0134126_12672996 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010398|Ga0126383_13528900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300011270|Ga0137391_10816034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300012189|Ga0137388_10398441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
| 3300012205|Ga0137362_10096878 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300012210|Ga0137378_11722991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300012361|Ga0137360_10048974 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
| 3300012362|Ga0137361_10061449 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300012362|Ga0137361_11714468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012363|Ga0137390_11984312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012532|Ga0137373_10154053 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300012685|Ga0137397_10742751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300012917|Ga0137395_10678797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012957|Ga0164303_10263646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 995 | Open in IMG/M |
| 3300012960|Ga0164301_10312622 | Not Available | 1063 | Open in IMG/M |
| 3300012971|Ga0126369_11095104 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012971|Ga0126369_11750191 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300013307|Ga0157372_11259381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 854 | Open in IMG/M |
| 3300014968|Ga0157379_10213294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1748 | Open in IMG/M |
| 3300015053|Ga0137405_1213717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1354 | Open in IMG/M |
| 3300015054|Ga0137420_1463010 | All Organisms → cellular organisms → Bacteria | 5212 | Open in IMG/M |
| 3300016270|Ga0182036_10877033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300016294|Ga0182041_10877096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300016294|Ga0182041_11568578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300016319|Ga0182033_11824780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300016445|Ga0182038_10410349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300017933|Ga0187801_10045411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
| 3300018064|Ga0187773_11138590 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300020579|Ga0210407_10173626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1668 | Open in IMG/M |
| 3300020579|Ga0210407_10765305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300020580|Ga0210403_10891585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300020581|Ga0210399_11077335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300020583|Ga0210401_10307974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
| 3300020583|Ga0210401_10789510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300020583|Ga0210401_11445155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300021168|Ga0210406_11362592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300021171|Ga0210405_11009895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021432|Ga0210384_11630333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300021560|Ga0126371_10029001 | All Organisms → cellular organisms → Bacteria | 5164 | Open in IMG/M |
| 3300022523|Ga0242663_1069368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300024330|Ga0137417_1193377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300025898|Ga0207692_11199301 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300025910|Ga0207684_10090173 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
| 3300025912|Ga0207707_10101630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2513 | Open in IMG/M |
| 3300025912|Ga0207707_10314369 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300025917|Ga0207660_10014176 | All Organisms → cellular organisms → Bacteria | 5234 | Open in IMG/M |
| 3300025917|Ga0207660_10532691 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300025917|Ga0207660_11516675 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025921|Ga0207652_10374265 | Not Available | 1286 | Open in IMG/M |
| 3300025922|Ga0207646_10135275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2219 | Open in IMG/M |
| 3300025928|Ga0207700_10431170 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300025944|Ga0207661_10441503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1184 | Open in IMG/M |
| 3300025949|Ga0207667_11629941 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026320|Ga0209131_1396746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300026536|Ga0209058_1026394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3678 | Open in IMG/M |
| 3300026895|Ga0207758_1004136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1605 | Open in IMG/M |
| 3300027765|Ga0209073_10446434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300027911|Ga0209698_10633931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300028536|Ga0137415_11346303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300028800|Ga0265338_10858691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300028906|Ga0308309_11366958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300030707|Ga0310038_10351799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300031231|Ga0170824_106945345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300031446|Ga0170820_16725435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300031668|Ga0318542_10778360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031681|Ga0318572_10847219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300031744|Ga0306918_11269910 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031753|Ga0307477_10428128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300031768|Ga0318509_10277142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 938 | Open in IMG/M |
| 3300031819|Ga0318568_10677978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300031820|Ga0307473_11403167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031846|Ga0318512_10754665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031910|Ga0306923_10079485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3673 | Open in IMG/M |
| 3300031941|Ga0310912_10383024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1094 | Open in IMG/M |
| 3300031947|Ga0310909_10449578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1081 | Open in IMG/M |
| 3300031954|Ga0306926_10130615 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300031981|Ga0318531_10407641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300032043|Ga0318556_10625599 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032180|Ga0307471_100252016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 1818 | Open in IMG/M |
| 3300033405|Ga0326727_10422422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.25% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100742864 | 3300000567 | Peatlands Soil | VEHAVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFS |
| JGI12635J15846_105576632 | 3300001593 | Forest Soil | MSVEFREAPVDDEGVSPHNHRIADYLRPKTLAMLLLGFSSG |
| Ga0066684_109472912 | 3300005179 | Soil | MSVEFRGAPVDDEGVSPHKHRFADYLRPKTLTMLVLGFSSGLPFYLVG |
| Ga0066676_102266231 | 3300005186 | Soil | MSVEFREAPLENEGVSPHQHRIGDYLRPKTLAMLLLGFSSG |
| Ga0066388_1000417284 | 3300005332 | Tropical Forest Soil | MSVEFREAPVENERVSLRKHRIADYLRPKTLSMLLLGFSSGLPF |
| Ga0066388_1052123101 | 3300005332 | Tropical Forest Soil | MSVEFREPPLDNVGVSPQKHRIADYLRPKTLAMLLLGFSSG |
| Ga0070680_1006989372 | 3300005336 | Corn Rhizosphere | MHLVLVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLGFSSGLPF |
| Ga0070709_108406532 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVEFRDVAIDHENVTPHKHRVADYLRPKTLAMLLLGFSSGL |
| Ga0070714_1004281502 | 3300005435 | Agricultural Soil | VSSAAATVHMVVFREAPVDNGRVSPHKHRITDYLRPKTLAMLLLGFSS |
| Ga0070732_102431052 | 3300005542 | Surface Soil | LALLEHMVVFRGAPLDNGRVSPHKHRITDYLRPKTLAMLLLG |
| Ga0070732_108615493 | 3300005542 | Surface Soil | MAGALRFAKLPSDNRGVSPLKHRMADYLRPKTLAMLLLGFS |
| Ga0068855_1009979051 | 3300005563 | Corn Rhizosphere | MFVFREAPVDNGRVSPHKHRITEYLRPKTLAMLLLGFSSGLPF |
| Ga0068855_1019125213 | 3300005563 | Corn Rhizosphere | MHLVLVVFRETPVHNGLVSAHKHRITDYLRPKTLAMLLLGFSSGL |
| Ga0068856_1005915003 | 3300005614 | Corn Rhizosphere | MVVFREAPVDNGRVSPHKHRITDYLRPKTLAMLLLGFSSGLPFL |
| Ga0066903_1028667703 | 3300005764 | Tropical Forest Soil | MSVEFREAPIENESVSPHKRRITDYLRPKTLAMLFLGFSSGLPFYLV |
| Ga0066903_1036237694 | 3300005764 | Tropical Forest Soil | MSVEFREAPIENEGVSPHKRRITDYLRPKTLAMLF |
| Ga0066903_1073360741 | 3300005764 | Tropical Forest Soil | MSVEFREARVENEGVRPHKHRIADYLRPKTLAMLLLGFSSGLPF |
| Ga0075029_1005485441 | 3300006052 | Watersheds | MVEFREAPVDNEGVSPHKHRLADYLRPKTLSMLLLGFS |
| Ga0075019_100712711 | 3300006086 | Watersheds | MVEFREAPVDNEGVSPHKHRLADYLRPKTLSMLLLGFSSGL |
| Ga0075018_102336801 | 3300006172 | Watersheds | MSVEVRGAPVDNEGVNARKHRIGDYLRPKTLTMLLLG |
| Ga0070716_1003363282 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVFREAPVDNGRVSPHKHRITDYLRPKTLAMLLLGFSS |
| Ga0079219_118951672 | 3300006954 | Agricultural Soil | MSVEFRNPPADNEGVSSQKHRIADYLRPKTLAMLLLGFSSGLPFFLVGN |
| Ga0079219_121410331 | 3300006954 | Agricultural Soil | VFHEAPLDNGRVSPHKHRITDYLRPKTLAMLLLGFSSGLPFLL |
| Ga0099791_104282901 | 3300007255 | Vadose Zone Soil | MSVEFREAPVDNERVSLRKHRIADYLRPKTLAMLLLGFSSGLPFFLV |
| Ga0099829_100885824 | 3300009038 | Vadose Zone Soil | MSVEFREAPVDDEDVSPHKHRIADYLRPKTLTMLLLGFSS |
| Ga0099829_103855431 | 3300009038 | Vadose Zone Soil | MSVEFRVAPVDDEGVSPHKHLVADYLRPKTLTMLLLGFSSG |
| Ga0099830_107576441 | 3300009088 | Vadose Zone Soil | MRVQFREAPVDEEGVSPHKHRVAGYLRPNTLEPLLL |
| Ga0099830_112205061 | 3300009088 | Vadose Zone Soil | MSVEFREAPVDDEGVSPHKHLVADYLRPKTLTMLL |
| Ga0099792_103414571 | 3300009143 | Vadose Zone Soil | MTVEFREAPVDDEDVSPHKHRVAGYLRPKTLTMLLLGFSS |
| Ga0126374_119065481 | 3300009792 | Tropical Forest Soil | MNVEFREAPVENEGVSPHKRRITDYLQPKTLAMLLLGF |
| Ga0116223_109114531 | 3300009839 | Peatlands Soil | VEHRVEFREAPVDNERVNPHKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0126373_103312802 | 3300010048 | Tropical Forest Soil | MSVEFREAHTDNEGVSPQKHRISDYLRPKTLAMLLLGFSSGLPFFLV |
| Ga0126373_118097462 | 3300010048 | Tropical Forest Soil | MVEIRQAPVDNERVSPQKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0126373_121087241 | 3300010048 | Tropical Forest Soil | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSS |
| Ga0126373_124642461 | 3300010048 | Tropical Forest Soil | MVEFRKAPVDNERVNSRKHRIADYLRPKTLAMLLLGF |
| Ga0126370_108234641 | 3300010358 | Tropical Forest Soil | MVEFREAPVENERVSPHKHRIADYLRPKTLAMLLLGFS |
| Ga0126378_124341622 | 3300010361 | Tropical Forest Soil | MFEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLP |
| Ga0126379_129342092 | 3300010366 | Tropical Forest Soil | MVEFREAPVDNERVSPHKHRFADYLRPKTLAMLLLGFSSGLPFLLVG |
| Ga0134128_119538192 | 3300010373 | Terrestrial Soil | MHLVLVVFREAPVHNGLVSAHKHRITEYLRPKTLAMLLLGFSSGLPFLLV |
| Ga0126381_1023620071 | 3300010376 | Tropical Forest Soil | MGVEFREAPLDNEAVSPQKHRIADYLRPKTLAMLLLGFSSGLPFFL |
| Ga0134126_100603561 | 3300010396 | Terrestrial Soil | MHLVLVVFREAPVHNELVSAHKHRITDYLRPKTLAMLLLGFSS |
| Ga0134126_101888451 | 3300010396 | Terrestrial Soil | MHLVLVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLGFSSGLPFL |
| Ga0134126_124291151 | 3300010396 | Terrestrial Soil | MSVEFRKAPVHDESVSSHKHRISDYLQPKTLTMLLLGFSSGLPF |
| Ga0134126_126729962 | 3300010396 | Terrestrial Soil | MHLVLVVFRESPVHNGRVSAHKHRITEYLRPKTLAMLLLGFSSGLPFLLV |
| Ga0126383_135289001 | 3300010398 | Tropical Forest Soil | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLPF |
| Ga0137391_108160342 | 3300011270 | Vadose Zone Soil | MVEFREAPVDNERVSPHKHGIADYLRPKTLAMLLLGFSSG |
| Ga0137388_103984412 | 3300012189 | Vadose Zone Soil | MSVEFREAPVDDEGVSPHKHLVADYLRPKTLTMLLLGFSSGLPFFLVGN |
| Ga0137362_100968785 | 3300012205 | Vadose Zone Soil | MTVEFREAPVDDEGVSPHKHLVADYLRPKTLTMLLLGFSSGLPF |
| Ga0137378_117229911 | 3300012210 | Vadose Zone Soil | MVEFRVAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLPFLLVG |
| Ga0137360_100489741 | 3300012361 | Vadose Zone Soil | MRVEFREAPVDDEGVSPNKHRIADYLRPKTLAMLLLGFSSGLPFF |
| Ga0137361_100614495 | 3300012362 | Vadose Zone Soil | MSVEFREAPVDDEGVSPHKHLVADYLRPKTLTMLLLGFSSGLPFYLVG |
| Ga0137361_117144682 | 3300012362 | Vadose Zone Soil | MSVEFRDAPVDDEGVSPHKHLVADYLRPKTLTMLLLGFSSGLPFYLVG |
| Ga0137390_119843121 | 3300012363 | Vadose Zone Soil | VQDGQQSVEFREAPVDNEGVSPHKHRLADYLRPKTLSMLLLGFSSGLPF |
| Ga0137373_101540535 | 3300012532 | Vadose Zone Soil | MVEFREAPVDNERVSSHKHRIADYLRPKTLAMLLL |
| Ga0137397_107427512 | 3300012685 | Vadose Zone Soil | MRVEFREASVDDEDVSPHKHGVAGYLRPKTLTMLLLGFSSGLPFFLVG |
| Ga0137395_106787971 | 3300012917 | Vadose Zone Soil | MSVEFREAPVDDEGVSPHKHLVADYLRPKTLAMLLLGF |
| Ga0164303_102636461 | 3300012957 | Soil | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLP |
| Ga0164301_103126221 | 3300012960 | Soil | MVVFRETPVDNGRVSPHKHRITDYLRPKTLAMLLLGFSSGLP |
| Ga0126369_110951041 | 3300012971 | Tropical Forest Soil | LSFVRLRYNERVNTHKRRIADYLRPKTLAMLLLGFSSGLPFLL |
| Ga0126369_117501911 | 3300012971 | Tropical Forest Soil | MVEFRKAPVENERVSPHKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0157372_112593811 | 3300013307 | Corn Rhizosphere | MHLVLVVFREAPVHNGLVSAHKHRITEYLRPKTLAMLLLGFSSGLPFLLVGNT |
| Ga0157379_102132941 | 3300014968 | Switchgrass Rhizosphere | MVVFREAPVDNGRVSPHKHRITDYLRPKTLAMLLLGF |
| Ga0137405_12137172 | 3300015053 | Vadose Zone Soil | MSVEFREGPLENEGVSSQKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0137420_146301011 | 3300015054 | Vadose Zone Soil | MSVEFREPPRDNVRVSLSKHRIADYLRPKTFDNVLLGFSSGLPFYLVWQYFRLLAPR* |
| Ga0182036_108770332 | 3300016270 | Soil | MVEFRKAPADNERVNPHKRQIADYLRPKTLAMLLLGFSSGLPFLLVG |
| Ga0182041_108770963 | 3300016294 | Soil | MSVEFREAPIENEDVSPHKRRITDYLRPKTLAMLF |
| Ga0182041_115685781 | 3300016294 | Soil | MFGFMSVDFREAPVENEGVSPHKHRITDYLRPKTLAM |
| Ga0182033_118247801 | 3300016319 | Soil | MSVEFREAPIENEGVSLYKHRISDYLRPKTLSMLLLGFSS |
| Ga0182038_104103492 | 3300016445 | Soil | MSVEHREAHVENEKVRPQKHRIADYLRPKTLTMLLLGFS |
| Ga0187801_100454111 | 3300017933 | Freshwater Sediment | MSVEFGEAHVENESVSPHKHRITDYLRPKTFTMLLLGFSSGLPFL |
| Ga0187773_111385902 | 3300018064 | Tropical Peatland | MVEIREAPVDNERVSPQKHRITDYLRPKTLAMLLLGFSSGLPFLLV |
| Ga0210407_101736261 | 3300020579 | Soil | MRVEFREPPVDNERVSLRKHRIADYLRPKTLTMLLLGFSSGLPF |
| Ga0210407_107653052 | 3300020579 | Soil | MSVEFREAPVDNERVNPHKRRIADYLRPKTLTMLLL |
| Ga0210403_108915851 | 3300020580 | Soil | MSVEFREAPVDDEGVSPHKHRIGDYLQPKTLTMLLLG |
| Ga0210399_110773351 | 3300020581 | Soil | MRVEFREAPVDDEGVSPHNHRLADYLRPKTLSMLLLGFSS |
| Ga0210401_103079741 | 3300020583 | Soil | MVEFREPPVDNDRVNPHKHRFADYLRPKTLAMLLLGFSSGLPFLL |
| Ga0210401_107895102 | 3300020583 | Soil | MVEFREPPVDNDGVNPHKHQFADYLRPKTLAMLLLGFSSGLP |
| Ga0210401_114451552 | 3300020583 | Soil | MSVEFREAPVDDEGVSPHKHRVADYLRPKTLAMLLLGFSSGLPF |
| Ga0210406_113625921 | 3300021168 | Soil | MRVEFREAPVDNERVSLRKHRIADYLRPKTLAMLLLGFSSGLPFFLV |
| Ga0210405_110098951 | 3300021171 | Soil | MSVEDRKSRVENECLNPHKHRITDYLRPKTLSMLLLGFSSGLPFYL |
| Ga0210384_116303332 | 3300021432 | Soil | MSVEFRKAPLENEGVSSQKHRIADYLRPKTLAMLLLGFSSGLP |
| Ga0126371_100290015 | 3300021560 | Tropical Forest Soil | MSVEFREAPVENEGVSPHKHRITDYLRPKTLAMLLLGFSSGLPFYLVG |
| Ga0242663_10693681 | 3300022523 | Soil | MVEFREPPVDNDRVNPHKHRFADYLRPKTLAMLLLGFS |
| Ga0137417_11933771 | 3300024330 | Vadose Zone Soil | MSVEFREAPVDNERVSLRKHRIADYLRPKTLTMLLLGFSSGLP |
| Ga0207692_111993011 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEFREAPVDNERVSPHKHQIADYLRPKTLTMLLLGFSSGFPFLLVGN |
| Ga0207684_100901731 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEFRVAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLPFL |
| Ga0207707_101016303 | 3300025912 | Corn Rhizosphere | MVEFREAPIDNERVSSHKHRIADYLRPKTLAMLLLGFSS |
| Ga0207707_103143693 | 3300025912 | Corn Rhizosphere | MVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLGFSSGLPF |
| Ga0207660_100141766 | 3300025917 | Corn Rhizosphere | MHLVLVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLGFSSGLPFLL |
| Ga0207660_105326911 | 3300025917 | Corn Rhizosphere | MVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLGFSSGLPFLL |
| Ga0207660_115166752 | 3300025917 | Corn Rhizosphere | MVEFREAPIDNERVSSHKHRIADYLRPKTLAMLLLGFSSGLPFLLV |
| Ga0207652_103742652 | 3300025921 | Corn Rhizosphere | MVVFRDAPVHNGHLTAHKHRITEYLRPKTLAMLLLG |
| Ga0207646_101352754 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEFRVAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0207700_104311701 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGLPFLLVGN |
| Ga0207661_104415033 | 3300025944 | Corn Rhizosphere | MVEFREAPIDNERVSSHKHRIADYLRPKTLAMLLLGFSSGLPFL |
| Ga0207667_116299411 | 3300025949 | Corn Rhizosphere | MHLVLVVFRETPVHNGLVSAHKHRITDYLRPKTLAMLLLGFSSGLHFQLVGNT |
| Ga0209131_13967462 | 3300026320 | Grasslands Soil | MRVEFREASVDDEDVSPHKHGVAGYLRPKTLTMLLLGFSSGLPFFLVGN |
| Ga0209058_10263941 | 3300026536 | Soil | LHHALSEAREAPVDNEGVSPHKHRLADYLRPKTLAMLL |
| Ga0207758_10041363 | 3300026895 | Tropical Forest Soil | MSVEFREAPVENEGVSPHKHRITDYLRPKTLAMLYLGFS |
| Ga0209073_104464342 | 3300027765 | Agricultural Soil | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGF |
| Ga0209698_106339311 | 3300027911 | Watersheds | MVEFREAPVDNEGVSPHKHRLADYLRPKTLSMLLLGFSSGLPFYL |
| Ga0137415_113463031 | 3300028536 | Vadose Zone Soil | MDNRVESRKAPVDNEGVSPHKHRLADYLRPKTLAMLLLGF |
| Ga0265338_108586911 | 3300028800 | Rhizosphere | MDKIWRMSIEVRESPVENERVNPRKHRIADYLQPKTLSMLLLGFSSG |
| Ga0308309_113669581 | 3300028906 | Soil | MDKIWRMSIEVRESPVENERVNPHKHRIADYLQPKTLSMLLL |
| Ga0310038_103517991 | 3300030707 | Peatlands Soil | VEHAVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLGFSSGL |
| Ga0170824_1069453451 | 3300031231 | Forest Soil | MSVEFREAPVDDESVSPHKHRIADYLRPKTLTMLLLGF |
| Ga0170820_167254352 | 3300031446 | Forest Soil | MSVEFREAPVDNKRVNPQRHRIADYLRPKTLTMLLLGFSSGLPFFLVG |
| Ga0318542_107783602 | 3300031668 | Soil | MSVEHREAHVENEKVSPQKHRIADYLRPKTLTMLLLG |
| Ga0318572_108472192 | 3300031681 | Soil | MSVEHREAHVENEKVSPQKHRIADYLRPKTLTMLLLGFSSGLPFYL |
| Ga0306918_112699102 | 3300031744 | Soil | MSVEFREARVENESVSPHKHRIADYLRPKTLTMLLLGFSSGLPFLLVGN |
| Ga0307477_104281282 | 3300031753 | Hardwood Forest Soil | MSVEFREAPVDDEGVSPHKHRVADYLRPKTLTMLLLGFSSGLPFYL |
| Ga0318509_102771421 | 3300031768 | Soil | MSVEFREAPIENEGVSPHKHRITDYLRPKTLAMLFLGFSSGLPF |
| Ga0318568_106779783 | 3300031819 | Soil | MSVEFPEAPVENEGVSPHKHRITDYLRPKTLAMLYLGFSSGL |
| Ga0307473_114031672 | 3300031820 | Hardwood Forest Soil | MSVEFREAPVDDEGVSSHKHQVADYLRPKTLAMLLLGFSSGLPFFLVGNT |
| Ga0318512_107546651 | 3300031846 | Soil | MSVEFPEAPIENEGVSPHKRWITDYLRPKTLAMLFLGFSSGLPFY |
| Ga0306923_100794851 | 3300031910 | Soil | MSVEFPEAPVENEGVSPHKHRITDYLRPKTLAMLYLGFSSGLPFYLVG |
| Ga0310912_103830241 | 3300031941 | Soil | MSVEFGDTPVENEGVSLHKHRITDYLRPKTLAMLLLGFSSGLPFY |
| Ga0310909_104495783 | 3300031947 | Soil | MSVEFPEAPVENEGVSPHKQRITDYLRPKTLAMLYLGFS |
| Ga0306926_101306151 | 3300031954 | Soil | MVEFREAPVDNERVSPHKHRFADYLRPKTLAMLLLGFSSGLPF |
| Ga0318531_104076413 | 3300031981 | Soil | MSVEFREAPIENEDVSPHKRRITDYLRPKTLAMLFLGFSSGLPFY |
| Ga0318556_106255991 | 3300032043 | Soil | MSVEFREAPVENEGVSPHKHRITDYLRPKTLAMLLLGFSSGLPFYLVGN |
| Ga0307471_1002520161 | 3300032180 | Hardwood Forest Soil | MVEFREAPVDNERVSPHKHRIADYLRPKTLAMLLLG |
| Ga0326727_104224223 | 3300033405 | Peat Soil | VEHGVEFREAPVDNERVSPHKHRTADYLQPKTLAMLLLGFSSGLPFLLV |
| ⦗Top⦘ |