| Basic Information | |
|---|---|
| Family ID | F070509 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKKLRLSVAILALLAVGILAGCSGTTKSPDVSDSIRKSLDQA |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.06 % |
| % of genes near scaffold ends (potentially truncated) | 79.67 % |
| % of genes from short scaffolds (< 2000 bps) | 73.17 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.911 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.715 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF05532 | CsbD | 13.01 |
| PF00072 | Response_reg | 2.44 |
| PF13620 | CarboxypepD_reg | 2.44 |
| PF12344 | UvrB | 1.63 |
| PF12779 | WXXGXW | 1.63 |
| PF01566 | Nramp | 1.63 |
| PF00561 | Abhydrolase_1 | 0.81 |
| PF01592 | NifU_N | 0.81 |
| PF00882 | Zn_dep_PLPC | 0.81 |
| PF07730 | HisKA_3 | 0.81 |
| PF06170 | DUF983 | 0.81 |
| PF00691 | OmpA | 0.81 |
| PF01594 | AI-2E_transport | 0.81 |
| PF02405 | MlaE | 0.81 |
| PF02620 | YceD | 0.81 |
| PF06271 | RDD | 0.81 |
| PF16277 | DUF4926 | 0.81 |
| PF01451 | LMWPc | 0.81 |
| PF02469 | Fasciclin | 0.81 |
| PF00571 | CBS | 0.81 |
| PF06210 | DUF1003 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 13.01 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.63 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.81 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.81 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.81 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.81 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.81 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.81 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.81 |
| COG5349 | Uncharacterized conserved protein, DUF983 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.91 % |
| All Organisms | root | All Organisms | 43.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104125549 | Not Available | 596 | Open in IMG/M |
| 3300001154|JGI12636J13339_1046513 | Not Available | 542 | Open in IMG/M |
| 3300001410|JGI20179J14886_1017119 | Not Available | 619 | Open in IMG/M |
| 3300004137|Ga0058883_1005462 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300004140|Ga0058894_1441876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300004152|Ga0062386_100769075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 792 | Open in IMG/M |
| 3300004152|Ga0062386_101094942 | Not Available | 661 | Open in IMG/M |
| 3300004479|Ga0062595_102464689 | Not Available | 518 | Open in IMG/M |
| 3300004635|Ga0062388_101923551 | Not Available | 610 | Open in IMG/M |
| 3300005467|Ga0070706_101954050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300005526|Ga0073909_10348892 | Not Available | 685 | Open in IMG/M |
| 3300005537|Ga0070730_10444794 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005541|Ga0070733_11124307 | Not Available | 527 | Open in IMG/M |
| 3300005938|Ga0066795_10249679 | Not Available | 525 | Open in IMG/M |
| 3300005947|Ga0066794_10047850 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300006047|Ga0075024_100332477 | Not Available | 754 | Open in IMG/M |
| 3300006047|Ga0075024_100344861 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006055|Ga0097691_1078412 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300006059|Ga0075017_100006859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7210 | Open in IMG/M |
| 3300006162|Ga0075030_100705773 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006172|Ga0075018_10671983 | Not Available | 557 | Open in IMG/M |
| 3300006173|Ga0070716_101683731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300007258|Ga0099793_10002543 | All Organisms → cellular organisms → Bacteria | 6117 | Open in IMG/M |
| 3300007788|Ga0099795_10098449 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300009029|Ga0066793_10648134 | Not Available | 601 | Open in IMG/M |
| 3300009131|Ga0115027_11439773 | Not Available | 562 | Open in IMG/M |
| 3300009518|Ga0116128_1160503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300009519|Ga0116108_1163757 | Not Available | 658 | Open in IMG/M |
| 3300009523|Ga0116221_1122713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300009523|Ga0116221_1400974 | Not Available | 597 | Open in IMG/M |
| 3300009525|Ga0116220_10277202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300009624|Ga0116105_1223843 | Not Available | 527 | Open in IMG/M |
| 3300009632|Ga0116102_1182803 | Not Available | 567 | Open in IMG/M |
| 3300009764|Ga0116134_1052673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 1551 | Open in IMG/M |
| 3300009839|Ga0116223_10642931 | Not Available | 611 | Open in IMG/M |
| 3300010159|Ga0099796_10013902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 2311 | Open in IMG/M |
| 3300011120|Ga0150983_14454122 | Not Available | 524 | Open in IMG/M |
| 3300012361|Ga0137360_10334136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300012685|Ga0137397_10361223 | Not Available | 1082 | Open in IMG/M |
| 3300012917|Ga0137395_11131457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300014152|Ga0181533_1206749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300014200|Ga0181526_10723210 | Not Available | 628 | Open in IMG/M |
| 3300014502|Ga0182021_11628833 | Not Available | 777 | Open in IMG/M |
| 3300014654|Ga0181525_10561149 | Not Available | 635 | Open in IMG/M |
| 3300014838|Ga0182030_11046536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300017925|Ga0187856_1026176 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
| 3300017925|Ga0187856_1203882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300017931|Ga0187877_1034999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2447 | Open in IMG/M |
| 3300017931|Ga0187877_1102619 | Not Available | 1193 | Open in IMG/M |
| 3300017935|Ga0187848_10269827 | Not Available | 715 | Open in IMG/M |
| 3300017940|Ga0187853_10179700 | Not Available | 1000 | Open in IMG/M |
| 3300017996|Ga0187891_1030583 | Not Available | 2425 | Open in IMG/M |
| 3300018014|Ga0187860_1132331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. 7M | 1089 | Open in IMG/M |
| 3300018030|Ga0187869_10126442 | Not Available | 1278 | Open in IMG/M |
| 3300018030|Ga0187869_10190277 | Not Available | 1006 | Open in IMG/M |
| 3300018038|Ga0187855_10292951 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300018042|Ga0187871_10316993 | Not Available | 862 | Open in IMG/M |
| 3300020199|Ga0179592_10023555 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
| 3300020579|Ga0210407_10180063 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300020579|Ga0210407_10182415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1627 | Open in IMG/M |
| 3300021088|Ga0210404_10189506 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300021168|Ga0210406_11325916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021170|Ga0210400_11511186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300021181|Ga0210388_10038488 | All Organisms → cellular organisms → Bacteria | 3960 | Open in IMG/M |
| 3300021406|Ga0210386_11240487 | Not Available | 629 | Open in IMG/M |
| 3300021420|Ga0210394_10560067 | Not Available | 1005 | Open in IMG/M |
| 3300021474|Ga0210390_11257892 | Not Available | 595 | Open in IMG/M |
| 3300021478|Ga0210402_11264023 | Not Available | 665 | Open in IMG/M |
| 3300021478|Ga0210402_11742083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300022557|Ga0212123_10700836 | Not Available | 623 | Open in IMG/M |
| 3300025469|Ga0208687_1034573 | Not Available | 1323 | Open in IMG/M |
| 3300025553|Ga0208080_1043962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1206 | Open in IMG/M |
| 3300025650|Ga0209385_1026214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2304 | Open in IMG/M |
| 3300025836|Ga0209748_1098945 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300025878|Ga0209584_10010816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3003 | Open in IMG/M |
| 3300025926|Ga0207659_10981051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
| 3300027394|Ga0209904_1021891 | Not Available | 506 | Open in IMG/M |
| 3300027674|Ga0209118_1133544 | Not Available | 690 | Open in IMG/M |
| 3300027729|Ga0209248_10073265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1040 | Open in IMG/M |
| 3300027853|Ga0209274_10317309 | Not Available | 801 | Open in IMG/M |
| 3300027857|Ga0209166_10263286 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300027905|Ga0209415_10479067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300027910|Ga0209583_10088761 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300027910|Ga0209583_10164421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
| 3300027910|Ga0209583_10469227 | Not Available | 615 | Open in IMG/M |
| 3300027915|Ga0209069_10584268 | Not Available | 641 | Open in IMG/M |
| 3300028674|Ga0302161_10117557 | Not Available | 675 | Open in IMG/M |
| 3300028678|Ga0302165_10038960 | Not Available | 1267 | Open in IMG/M |
| 3300028769|Ga0302213_1149323 | Not Available | 632 | Open in IMG/M |
| 3300029636|Ga0222749_10204298 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300029987|Ga0311334_10205609 | Not Available | 1508 | Open in IMG/M |
| 3300029999|Ga0311339_10190367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2339 | Open in IMG/M |
| 3300030058|Ga0302179_10132854 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300030805|Ga0265756_102835 | Not Available | 911 | Open in IMG/M |
| 3300031128|Ga0170823_10560295 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300031231|Ga0170824_120349614 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300031235|Ga0265330_10296122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300031524|Ga0302320_10892312 | Not Available | 964 | Open in IMG/M |
| 3300031708|Ga0310686_102182464 | Not Available | 554 | Open in IMG/M |
| 3300031726|Ga0302321_101307521 | Not Available | 832 | Open in IMG/M |
| 3300031962|Ga0307479_11463267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300032180|Ga0307471_101893231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 9.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.06% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.06% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.81% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001410 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028769 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102762872 | 3300000567 | Peatlands Soil | MKTLKLFFTLFTLFAGGIPAGCSGTAAQSPDVSDSIRKSLDQAGLKEVSVS |
| JGI1027J12803_1041255492 | 3300000955 | Soil | MKTLRLSVAMLALFAVGILIGCSQTASKSPDVSDSIRKSL |
| JGI12636J13339_10465131 | 3300001154 | Forest Soil | MKTVRLSVNVLALLAAGTLAGCSGTAAKSPEVSDSIRKSLDQA |
| JGI20179J14886_10171191 | 3300001410 | Arctic Peat Soil | MKKLIMSVAMLALLAVGVLAGCSGTAVKSPDVADNIRKSLDQ |
| Ga0058883_10054623 | 3300004137 | Forest Soil | MKKIRLSVAMLTLVAVGALAGCSGTAASPDVADGIRKSLDQAGFK |
| Ga0058894_14418762 | 3300004140 | Forest Soil | MKTLKLSVAALALLAVGSLAGCSGTAASPDVSDSIRKSLDQAG |
| Ga0062386_1007690752 | 3300004152 | Bog Forest Soil | MKKLGLSVAMLALLAVGILAGCSKTTASPDVADSIRKSLDQAG |
| Ga0062386_1010949422 | 3300004152 | Bog Forest Soil | MKKFSLSVAMLALFAGGILAGCSTTATKSPDVSDSIRKSLD |
| Ga0062595_1024646892 | 3300004479 | Soil | MKKLRLSLAMITLVAVGILAGCSETVAKAPDVSDSIRKSLDQEG |
| Ga0062388_1019235513 | 3300004635 | Bog Forest Soil | MKKFKISVSIVTIFAAGILAGCSGTTAKSPDVSDAIRKSLDQANL |
| Ga0070706_1019540502 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLRLSVAILTVVFVGILAGCAGTDAKSPDVSDSIRTSL |
| Ga0073909_103488921 | 3300005526 | Surface Soil | MKSQKLLGAMGALLLAAALTGCSNTPKSPDVADSIRKTLDQSGLKDVSVSQ |
| Ga0070730_104447942 | 3300005537 | Surface Soil | MKKFKLSVAMLTLFAVAALGGCSGTAASPDVADGIR |
| Ga0070733_111243071 | 3300005541 | Surface Soil | MLTLCITGVLAGCFGAATKSPEVTDNIRKSLDQAGFKDVSV |
| Ga0066795_102496793 | 3300005938 | Soil | MKKLRFSVAILTLLAVGIMAGCTGAAPKSPDVADSIRKSLDQANLKDVT |
| Ga0066794_100478503 | 3300005947 | Soil | MNTLRLSVAMLTLLAVGTLAGCSATTQKSPDVSDSIRTALDQAGLKSV |
| Ga0075024_1003324771 | 3300006047 | Watersheds | MGKIRLYAGMLALLGAGTLAGCSGTAASPDVSDGIRKSLDQAGLKDVSVSQD |
| Ga0075024_1003448611 | 3300006047 | Watersheds | MKRLTFSVAMVPLLAVGILAGCSQTVSESPDVSDSIRKSLDQAGFKDIRTGLINGS* |
| Ga0075029_1003916731 | 3300006052 | Watersheds | MKTAKLFFALLAVLAAGILAGCSTTVAKSPDVSDSIR |
| Ga0075029_1005677542 | 3300006052 | Watersheds | MKTIQLLVTMLALLAAGILAGCTTTVAKSPDVSDSIRKS |
| Ga0097691_10784121 | 3300006055 | Arctic Peat Soil | MKKLRFSVAMLAVFAVGILIGCSETSTKSPDVSDSIRKS |
| Ga0075017_10000685911 | 3300006059 | Watersheds | MKTIKLFSTLLMLLAAWILAGCSTTVAKSPDVSDSIRKSLDQAGFKSVSV |
| Ga0075030_1007057731 | 3300006162 | Watersheds | MKKFGLSIAMLALVAAGTVAGCSATSAKSPDVSDNIRKSLDQAGLK |
| Ga0075018_106719831 | 3300006172 | Watersheds | MRKITLSVATFTLLTVGTLAGCSGTAVKSTDVSDSVRKSLDQA |
| Ga0070716_1016837312 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALRLSVTVLALLAAGTLAGCSGTSAKSPDVSDSIRKSLD |
| Ga0075014_1002713362 | 3300006174 | Watersheds | MKTIKLFSTLLMLLAAWILAGCSTTVAKSPDVSDSIRKSLDQAG |
| Ga0075527_100648301 | 3300006640 | Arctic Peat Soil | MKTTKLFFTMLALLAAGILAGCSTTAVKSPDVSDSIRKALD |
| Ga0099793_100025433 | 3300007258 | Vadose Zone Soil | MKILKLSVNVLALLAAGTLAGCSETAAKSPDVSDGIRKSLRTP* |
| Ga0099795_100984491 | 3300007788 | Vadose Zone Soil | MKSLVKVLGLFSVMTFGMLAGCSSTASKSPDVTDSIRKSLDQ |
| Ga0066793_106481342 | 3300009029 | Prmafrost Soil | MKKLRLSVAILALLAVGILAGCSGTTKSPDVSDSIRKSLDQA |
| Ga0115027_114397731 | 3300009131 | Wetland | MKTLRLSVAVLALVALGMAACSGTVQQSPDVSDSIRTALDQAG |
| Ga0116128_10585703 | 3300009518 | Peatland | MKTTKLSFTILALLSAGIMTGCSTTSAKSPDVSDSIRKSLDQAGF |
| Ga0116128_11605032 | 3300009518 | Peatland | MKKLRLSLAMLTLFAGGILAGCSATATKSPDVSGSIRTSLDQ |
| Ga0116108_11637571 | 3300009519 | Peatland | MKNLRVSVTILALLAAGALAACSATSTKSPDVSDSIRKS |
| Ga0116221_11227131 | 3300009523 | Peatlands Soil | MKNLSCSVTMLALLCFGALAGCSGTPRKSPDVSDSIRKSL |
| Ga0116221_14009742 | 3300009523 | Peatlands Soil | MKKLRLSVVLVALLAVGILAGCSQTATKSPDVSDSVRKSLDQAGF |
| Ga0116220_102772022 | 3300009525 | Peatlands Soil | MKTLRFSVTVLALLAAGALVGCSGTAAKSPDVSDNIRKSLDQ |
| Ga0116137_11254162 | 3300009549 | Peatland | MKTIKVFFTLLTLLAAGMLAGCSAPVAKSPDVSGSIRKSLDQAGLK |
| Ga0116105_12238432 | 3300009624 | Peatland | VFDQKDEDMKTTQLSLIALVLLASGILAGCSTNATKSPDVSDSIRKAL |
| Ga0116115_11665601 | 3300009631 | Peatland | MKTIKVFFTLLTLLAAGMLAGCSAPVAKSPDVSGSIRKSLDQAGL |
| Ga0116102_11828031 | 3300009632 | Peatland | MKTTKLSFAVLALLAAGIMAGCSTTTAKSPDVSDSIRKSLDQ |
| Ga0116134_10526731 | 3300009764 | Peatland | MKMLRLSVTMLTLLAVGTLAGCSGTPRKSPDVSDSLRKSLDQAGFKD |
| Ga0116223_106429311 | 3300009839 | Peatlands Soil | MKKIKLSVAMLALLAAGALAGCSGTAASPDVSDSIRRSLDQ |
| Ga0099796_100139021 | 3300010159 | Vadose Zone Soil | MVVLLIAGCLSACSNTPTKSPDVADNIRKSLDQANLKDVSVSQD |
| Ga0150983_144541221 | 3300011120 | Forest Soil | MKKISLSVATLALLAAGTLAGCSGTATKSADISDTVRKSLDQAGLKDVTVS |
| Ga0137360_103341361 | 3300012361 | Vadose Zone Soil | MKILKLSVNVLALLAAGTLAGCSGTAAKSPDVSDSIRKSLDQ |
| Ga0137397_103612232 | 3300012685 | Vadose Zone Soil | MKILKLSVNVLALLAAGTLTAAKSPDVSDGIRKLLRTP* |
| Ga0137395_111314571 | 3300012917 | Vadose Zone Soil | MVVLLIAGCLSACSNTPTKSPDVADNIRKSLDQANLKDVSVSQDR |
| Ga0181533_12067493 | 3300014152 | Bog | MKKLRLSAVMVALLAVGILAGCSQTVTKSPDVADSIRKSLDQAGFKDVAV |
| Ga0181521_101042085 | 3300014158 | Bog | MKTTKLSFTILALLSAGIMTGCSTTSAKSPDVSDSIRKSLDQ |
| Ga0181531_105940142 | 3300014169 | Bog | MNRKTIKVFFTLLALIAAGIMAGCSTTAAKSPDVSDSIR |
| Ga0181526_107232101 | 3300014200 | Bog | MSKIKLSAAVLALVAAGTLAACSGTAASPDVSDSIHKSLDQAGLK |
| Ga0182021_116288333 | 3300014502 | Fen | MKKLIMFIAMLTLLAVVVLAGCTGTAVKSPDIADNIHKSLDQ |
| Ga0181525_105611491 | 3300014654 | Bog | MKTLRLSIAIPTLLAVGILAGCSGTPAKSPDVSDNI |
| Ga0182030_110465362 | 3300014838 | Bog | MRKIKLSVAVLALVAAGTLAGCSGTAASPDVSDSIHKSLDQA |
| Ga0187856_10261761 | 3300017925 | Peatland | MKKLGLSVVMVALLAVGILAGCSQTATKSPDVSDSIRKS |
| Ga0187856_12038821 | 3300017925 | Peatland | MKKLRLSVVMVALLAVGILAGCSQTATKSPDVADSIRKSLDQAGFKDV |
| Ga0187877_10349991 | 3300017931 | Peatland | MKKLRLSVVMVALLAVGILAGCSQTATKSPDVSDSIRKS |
| Ga0187877_11026193 | 3300017931 | Peatland | MKKLGLSVVMVALLAVGILAGCSQTATKSPDVSDSIRKSLD |
| Ga0187848_102698271 | 3300017935 | Peatland | MKKLRLSFAMLALLALGILAGCSQTATKSPDVSDSIRKSLDQA |
| Ga0187853_101474052 | 3300017940 | Peatland | MKTIKVFFTLLTLLAAGMLAGCSAPVAKSPDVSGSIRKSLDQ |
| Ga0187853_101797001 | 3300017940 | Peatland | MKTTKIHVIALALLAIGTLVGCWGDPAKSPDVSDGIRKSLDQ |
| Ga0187891_10305833 | 3300017996 | Peatland | MKKLRLSVAMLTLLAAGMLAGCSGPTTKSPDVSDSIRKSLD |
| Ga0187860_11323311 | 3300018014 | Peatland | MKKLRLSVAMLTLLAAGMLAGCSGPTTKSPDVSDSIRKSLDQAGLKGVAVS |
| Ga0187872_102535542 | 3300018017 | Peatland | MKTAKVFFTMLALLAAAILAACSTTAAKSPDVSDSIHKSLDQ |
| Ga0187869_101264423 | 3300018030 | Peatland | MKNLRVSVTILALLAAGALAACSATSTKSPDVSDSIRKSLD |
| Ga0187869_101902771 | 3300018030 | Peatland | MKKLRLSVVVVALLAVGILAGCSQTATKSPDVSDSIRKSLDQAG |
| Ga0187863_100466766 | 3300018034 | Peatland | MKAIKLLFTMLGLVVTGILVGCSTTAAKSPDVSESIRKS |
| Ga0187855_102929512 | 3300018038 | Peatland | MKTVRLSVAIITLLAVGILAGCSGTAAKSPNVSDNIRKSLDQAGFK |
| Ga0187871_103169933 | 3300018042 | Peatland | MKKLRLSVVVVALLAVGILAGCSQTATKSPDVSDSIRKS |
| Ga0187859_100988171 | 3300018047 | Peatland | MKTHKLFLTLLTLLAAGILAGCSGPAASPDVAGNIQKSLDQAGL |
| Ga0179592_100235552 | 3300020199 | Vadose Zone Soil | MKILKLSVNVLALLAAGTLAGCSETAAKSPDVSDGIRKSLRTP |
| Ga0210407_101800631 | 3300020579 | Soil | MKKLRLSVAMLALVAVGILAGCSGTAASPDVADGIRKS |
| Ga0210407_101824151 | 3300020579 | Soil | MKTHRFSVAVVALLAAGALAGCSGTVAKSPEVSDSIR |
| Ga0210404_101895061 | 3300021088 | Soil | MKKLRLSVAVLTLLAVATLAGCYRTTASPDVSGTIRQSLDRAGFKD |
| Ga0210406_113259162 | 3300021168 | Soil | MKTLKLSVAALALLAVGSLAGCSGTAASPDVSDSIRKSLDQAGFK |
| Ga0210400_115111862 | 3300021170 | Soil | MKLKLSITVLTLFAIGTLAGCSGTAASPDVSDNIRKSLDQAGF |
| Ga0210388_100384885 | 3300021181 | Soil | MKKFRLSVMMVTLVAQGGLAGCSATAAKSPDVTDSIRKSLDQASLKDVT |
| Ga0210388_115765232 | 3300021181 | Soil | MKTLRLLFTLPALLAVGIMAGCSTTTAKSPDVSDTIRKSLD |
| Ga0210386_112404872 | 3300021406 | Soil | MKKLRLSVAVLALFATGTLVSCSGPAASPDVSDSIRRSLDQAGFKD |
| Ga0210394_105600671 | 3300021420 | Soil | MKTFGWSVAAVTLIALGTLAGCSATAAKSPDVQDSIQKSLDQASLKDVTVSEDRNKGVIT |
| Ga0210390_112578922 | 3300021474 | Soil | MGKIKLCLSLLALLGAGALAGCSGTAASPDVADGVRK |
| Ga0210402_112640231 | 3300021478 | Soil | MLRLSATVLTLLTAGILAGCSGTAASPDVSGSIRTALDRANL |
| Ga0210402_117420832 | 3300021478 | Soil | MKKLKVSGIALTLLVVGICAGCSTTAAKSPDVSDSLRKS |
| Ga0212123_107008362 | 3300022557 | Iron-Sulfur Acid Spring | MKKLRFSVAMLAVLAVGILTGCSETSTKSPDVSDSIRKSL |
| Ga0208687_10345733 | 3300025469 | Peatland | MKMLRLSVTMLTLLAVGTLAGCSGTPRKSPDVSDSIRKSLD |
| Ga0208080_10439621 | 3300025553 | Arctic Peat Soil | MKKLRLSVAMLALLAVGILAGCSGTATKSPDISDSIRKSLDQ |
| Ga0209385_10262142 | 3300025650 | Arctic Peat Soil | MKKLIISVAMLALLAVVVLAGCSGTAVKSSDVADNIRKSLDQAGFKDVTVSQ |
| Ga0209748_10989451 | 3300025836 | Arctic Peat Soil | MNTLRLSVAMLTLLAVGTLAGCSATTQKSPDVSDNIRT |
| Ga0209584_100108161 | 3300025878 | Arctic Peat Soil | MNKLRLSVVILTLLAVGILVGCSKTATKSPEVADNIRKSLDQAGFKDI |
| Ga0207659_109810511 | 3300025926 | Miscanthus Rhizosphere | MKKLRLSLALLTLLAVGILAGCAETTAKSPDVSDSIRKS |
| Ga0209904_10218912 | 3300027394 | Thawing Permafrost | MKKLRLSVVMVALLAVGILAGCSQTATKLPDVSDSIRKSLDQAGFKDV |
| Ga0209118_11335441 | 3300027674 | Forest Soil | MKRLRLSVAMLAVLAMGILTGCSETSTKSPDVSDSIRKSL |
| Ga0209248_100732653 | 3300027729 | Bog Forest Soil | MKKLKLSVTTFMLLAVGTIAGCSTTVASPDVSDSIRKSLDQAGYKDV |
| Ga0209039_101016683 | 3300027825 | Bog Forest Soil | MKTIKLFFTVLTLLATGILTGCTTTGSKSPEVADSIRKSLDDAGFKSVSV |
| Ga0209274_103173091 | 3300027853 | Soil | MKKFRLSVMAVTLIAQGGLAGCSATAAKSPDVTDSIRKSLDQA |
| Ga0209166_102632862 | 3300027857 | Surface Soil | MKKFKLSVAMLTLFAVAALGGCSGTAASPDVADGIRK |
| Ga0209415_104790671 | 3300027905 | Peatlands Soil | MKKIKLSVAMLALLAAGALAGCSGTAASPDVSDSIRRSLDQAGLK |
| Ga0209583_100887612 | 3300027910 | Watersheds | MKTFGLSGTVLALLAVATLAGCSGTAAKSPDVSDSIRKSLD |
| Ga0209583_101644211 | 3300027910 | Watersheds | MKNVRLSFATLTLLALGSLSGCSGTAAKSPDVSDNIRKSLDQAGLK |
| Ga0209583_104692271 | 3300027910 | Watersheds | MKRLRLSVAMVPLLAVGILAGCSQTVSESPDVSDSIRKSLD |
| Ga0209069_105842683 | 3300027915 | Watersheds | MKRLTFSVAMVPLLAVGILAGCSQTVSESPDVSDSIRKSLDQAGFKDIR |
| Ga0302161_101175573 | 3300028674 | Fen | MKKLRLSVVMVALLAVGILAGCSQTATKSPDVSDSIRKSLDQAGFKD |
| Ga0302165_100389603 | 3300028678 | Fen | MKKLRLSVAMLSLLVAGILAGCSATPTKSPEVSDNIRKSLDQAGLNDVSV |
| Ga0302213_11493232 | 3300028769 | Fen | MKKLRLSVVMVALLAVGILAGCSQTATKSPDVSDSIRKSLDQAGFK |
| Ga0222749_102042981 | 3300029636 | Soil | MKTLRAFVTVLALLAAGAISGCSGTSAKSPDVSDSIRK |
| Ga0311334_102056091 | 3300029987 | Fen | MKTIRLSVAILSLFALEMLAGCSGTAKSPEVSNSIRKSLDQAGFN |
| Ga0311339_101903673 | 3300029999 | Palsa | MKKLRLSMVMVALLAVGILAGCSQTATKSPDVSDSIRKSLD |
| Ga0302177_104233571 | 3300030053 | Palsa | MKTFKLFLGTLTLLAAGIMAGCSTTAAKSPDVSDNI |
| Ga0302179_101328542 | 3300030058 | Palsa | MKTVRLSVAIITLLAVGILAGCSGTAAKSPNVSDN |
| Ga0311370_115071561 | 3300030503 | Palsa | MKTIKLFFALLTLLAAGIMAGCSTTGAKSPDVSDSIRKSLDQAGFK |
| Ga0311354_108070071 | 3300030618 | Palsa | MNRKTIKVFFTLLALIAAGIMAGCSTTAAKSPDVSDSIRKSL |
| Ga0265756_1028351 | 3300030805 | Soil | MRRIRWYAAMLALLGAGALAGCSKTAASPDVSDSIRKSLDQEGLKDV |
| Ga0302180_104892032 | 3300031028 | Palsa | VKTLKLFLGTLTLLAAGIMAGCSTTAAKSPDVSDNIRKSLDQA |
| Ga0170823_105602951 | 3300031128 | Forest Soil | MKAFRFSVTALALLVAAVLAGCSGTAAKSPDVSDNIRKS |
| Ga0170824_1203496141 | 3300031231 | Forest Soil | MKALRFSVTALALLVAAVLAGCSGTAAKSPDVSDNIRKS |
| Ga0265330_102961221 | 3300031235 | Rhizosphere | MKKLRLSGVMVALLAVGILAGCSQTATKSPDVSDSIRKSLDQAG |
| Ga0302320_108923121 | 3300031524 | Bog | MKTLRLSIAIPTLLAVGILAGCSGTPAKSPDVSDNIRKSLDQA |
| Ga0302326_121977052 | 3300031525 | Palsa | MKTSQVFLTVLALLVAGIMAGCSTTAVKSPDVSSSIRKSLDDAGFKD |
| Ga0310686_1021824641 | 3300031708 | Soil | MNKLRLSVAMLTLLAAGIMAGCSGPAASPDVSDSIRKSLDQAGLKNVA |
| Ga0302321_1013075212 | 3300031726 | Fen | MKKFRMLVAALSLLAFGVLAGCSGTAKSPEVADSIRKS |
| Ga0307479_114632671 | 3300031962 | Hardwood Forest Soil | MNKVRLSVVTLTLLAFGSLAGCSGTAAKSPDVSDNIRKSLDQAGFKDVSITQD |
| Ga0307471_1018932313 | 3300032180 | Hardwood Forest Soil | MKKLRLSVAMLTLVAAGALAGCSGTVASPDVSDRIRKSLDQARFKDVSVSEDRE |
| ⦗Top⦘ |