NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070460

Metagenome / Metatranscriptome Family F070460

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070460
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 47 residues
Representative Sequence ADLIVDGKSDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH
Number of Associated Samples 114
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 93.50 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.431 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.943 % of family members)
Environment Ontology (ENVO) Unclassified
(34.146 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.967 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.77%    β-sheet: 5.48%    Coil/Unstructured: 65.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF01656CbiA 13.01
PF13602ADH_zinc_N_2 8.94
PF02653BPD_transp_2 6.50
PF13676TIR_2 4.07
PF00501AMP-binding 3.25
PF00107ADH_zinc_N 3.25
PF07685GATase_3 2.44
PF08240ADH_N 2.44
PF00528BPD_transp_1 2.44
PF00005ABC_tran 2.44
PF13416SBP_bac_8 1.63
PF07726AAA_3 1.63
PF02026RyR 1.63
PF02518HATPase_c 0.81
PF02728Cu_amine_oxidN3 0.81
PF00701DHDPS 0.81
PF02727Cu_amine_oxidN2 0.81
PF00266Aminotran_5 0.81
PF00578AhpC-TSA 0.81
PF00903Glyoxalase 0.81
PF03167UDG 0.81
PF09520RE_TdeIII 0.81
PF00496SBP_bac_5 0.81
PF13458Peripla_BP_6 0.81
PF13191AAA_16 0.81
PF00072Response_reg 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.63
COG3733Cu2+-containing amine oxidaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.63
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.81
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.81
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.06 %
UnclassifiedrootN/A8.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17095955All Organisms → cellular organisms → Bacteria2977Open in IMG/M
2162886012|MBSR1b_contig_1346690All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300000953|JGI11615J12901_10681374All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300000956|JGI10216J12902_110885336All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300000956|JGI10216J12902_115070282All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300001990|JGI24737J22298_10172178All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300003911|JGI25405J52794_10155127All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300004022|Ga0055432_10196941All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300004157|Ga0062590_101828902All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300004479|Ga0062595_102097907All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300004480|Ga0062592_100808121All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300005290|Ga0065712_10324182All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005293|Ga0065715_10955631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae558Open in IMG/M
3300005332|Ga0066388_106911483All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005345|Ga0070692_10310378All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005353|Ga0070669_100073865All Organisms → cellular organisms → Bacteria2527Open in IMG/M
3300005367|Ga0070667_100245024Not Available1601Open in IMG/M
3300005445|Ga0070708_100268825All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300005459|Ga0068867_101499431All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005467|Ga0070706_101269353All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005467|Ga0070706_101772374All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005546|Ga0070696_101359266All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005577|Ga0068857_102321006All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005586|Ga0066691_10547275All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005616|Ga0068852_100247300All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300005719|Ga0068861_100250460All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300005881|Ga0075294_1000292All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300006173|Ga0070716_101477423All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300006354|Ga0075021_10010800All Organisms → cellular organisms → Bacteria4970Open in IMG/M
3300006804|Ga0079221_11666850All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006806|Ga0079220_11067786Not Available650Open in IMG/M
3300006881|Ga0068865_100294376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1297Open in IMG/M
3300006904|Ga0075424_102723969Not Available516Open in IMG/M
3300007076|Ga0075435_100769865All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300007265|Ga0099794_10194584All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae1038Open in IMG/M
3300009012|Ga0066710_103126139All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300009038|Ga0099829_11149408All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009094|Ga0111539_11329258All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300009162|Ga0075423_10684824Not Available1082Open in IMG/M
3300009545|Ga0105237_10686558All Organisms → cellular organisms → Eukaryota → Viridiplantae1030Open in IMG/M
3300009804|Ga0105063_1058925All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae568Open in IMG/M
3300009836|Ga0105068_1105077All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010029|Ga0105074_1053892Not Available714Open in IMG/M
3300010321|Ga0134067_10146000All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300010359|Ga0126376_10114747All Organisms → cellular organisms → Bacteria2086Open in IMG/M
3300010359|Ga0126376_11188717Not Available777Open in IMG/M
3300010360|Ga0126372_12566246All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010360|Ga0126372_12880769All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300010375|Ga0105239_12011400All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300010376|Ga0126381_102991012All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300010398|Ga0126383_11703476All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010398|Ga0126383_12858835All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300011119|Ga0105246_11836882All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012189|Ga0137388_10211699All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300012199|Ga0137383_11205876All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae544Open in IMG/M
3300012231|Ga0137465_1066734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_211070Open in IMG/M
3300012354|Ga0137366_11133284Not Available536Open in IMG/M
3300012363|Ga0137390_10486457Not Available1209Open in IMG/M
3300012891|Ga0157305_10156016All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae619Open in IMG/M
3300012904|Ga0157282_10378166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300012927|Ga0137416_10645442All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300012944|Ga0137410_10270446All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300012948|Ga0126375_10818619All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012984|Ga0164309_11019506All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012985|Ga0164308_11565607All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae607Open in IMG/M
3300013308|Ga0157375_13019289All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300014262|Ga0075301_1167287All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300014968|Ga0157379_11402881All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300015359|Ga0134085_10596250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300015371|Ga0132258_10582040All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300015374|Ga0132255_100119441All Organisms → cellular organisms → Bacteria3620Open in IMG/M
3300017789|Ga0136617_10292094All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300017789|Ga0136617_10466548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1009Open in IMG/M
3300017927|Ga0187824_10040376All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1423Open in IMG/M
3300018054|Ga0184621_10101227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_211019Open in IMG/M
3300018076|Ga0184609_10065846All Organisms → cellular organisms → Bacteria → Proteobacteria1577Open in IMG/M
3300018076|Ga0184609_10450959All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300018422|Ga0190265_10461363All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300018468|Ga0066662_12561192All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300018469|Ga0190270_11884496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21654Open in IMG/M
3300019883|Ga0193725_1037364All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300019886|Ga0193727_1119921All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300019997|Ga0193711_1046229All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae525Open in IMG/M
3300020018|Ga0193721_1083786All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300020081|Ga0206354_10082791All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300020580|Ga0210403_11164087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae596Open in IMG/M
3300022694|Ga0222623_10083064All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300025535|Ga0207423_1083303All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300025907|Ga0207645_10328742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_211021Open in IMG/M
3300025910|Ga0207684_11415471All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300025913|Ga0207695_11749106All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025914|Ga0207671_10455213All Organisms → cellular organisms → Eukaryota → Viridiplantae1019Open in IMG/M
3300025915|Ga0207693_10351837All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300025917|Ga0207660_10776815All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300025927|Ga0207687_10693388All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300025945|Ga0207679_11438553All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300025961|Ga0207712_10911886All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300025986|Ga0207658_11425422All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300026035|Ga0207703_12038207All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300026089|Ga0207648_10290394All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300026089|Ga0207648_10957316All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300026285|Ga0209438_1049390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_211387Open in IMG/M
3300026371|Ga0257179_1012639All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300026514|Ga0257168_1062538All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300026548|Ga0209161_10353862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300027277|Ga0209846_1050922All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027424|Ga0209984_1045530All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae637Open in IMG/M
3300027671|Ga0209588_1138295All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300027717|Ga0209998_10177221Not Available554Open in IMG/M
3300027775|Ga0209177_10290638Not Available619Open in IMG/M
3300027775|Ga0209177_10409368All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300027894|Ga0209068_10008008All Organisms → cellular organisms → Bacteria4991Open in IMG/M
3300027907|Ga0207428_11038563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Amorphaceae → Acuticoccus → Acuticoccus yangtzensis575Open in IMG/M
(restricted) 3300028043|Ga0233417_10049410All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300028381|Ga0268264_10727200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21987Open in IMG/M
3300028536|Ga0137415_10609110All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300028587|Ga0247828_10737620All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300028814|Ga0307302_10597450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21549Open in IMG/M
3300029636|Ga0222749_10224769All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300031820|Ga0307473_11344178All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031823|Ga0307478_11610301All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae536Open in IMG/M
3300032075|Ga0310890_11242660All Organisms → cellular organisms → Bacteria608Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.88%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.06%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.06%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.44%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.63%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_020231302088090014SoilGLSPAAGRVLADLVVDGKSDPDLAPLSVERFRGRHEDAAALEAACVAHYARRYLR
MBSR1b_0107.000069002162886012Miscanthus RhizosphereAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH
JGI11615J12901_1068137423300000953SoilALAPLSVERLAAASRDGAALEAACVAQYARRYTH*
JGI10216J12902_11088533633300000956SoilLSPATGRALADLIVDGKSDPDLAPISVERFGSAPRDPAALESACVAQYARRYTH*
JGI10216J12902_11507028213300000956SoilDPDLAPLSVERFRGRWQGAAELEAACVGQYARKYTR*
JGI24737J22298_1017217813300001990Corn RhizosphereGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
JGI25405J52794_1015512723300003911Tabebuia Heterophylla RhizosphereAGRALADLIVDGKSDPDLAPLSVERFGGAHRDPAALESACVAQYARRYTH*
Ga0055432_1019694113300004022Natural And Restored WetlandsADLILDGRSDPDLGPLSVERFGCRFDAPAELRATCVAQYARKYTH*
Ga0062590_10182890213300004157SoilLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH*
Ga0062595_10209790713300004479SoilAAGRALADLIVDGKSDPDLGPLSVERFRGRWEDAAELEAACVGQYARKYTH*
Ga0062592_10080812133300004480SoilLSLSPSTGRALADLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH*
Ga0065712_1032418213300005290Miscanthus RhizosphereAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0065715_1095563113300005293Miscanthus RhizosphereADLIVDGKSDPDLGPLSVGRFAGAARDPGALEAACVAQYARRYTH*
Ga0066388_10691148323300005332Tropical Forest SoilLADLILDGRSDPDLAPLSVERFRGRFAHSAELTSACTSQYARKYTH*
Ga0070692_1031037833300005345Corn, Switchgrass And Miscanthus RhizosphereDLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH*
Ga0070669_10007386533300005353Switchgrass RhizosphereLSLSPAAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0070667_10024502413300005367Switchgrass RhizosphereLADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0070708_10026882533300005445Corn, Switchgrass And Miscanthus RhizosphereSLSPAAGRALADLIVDGKSDPDLTPISVERFGESYRNPGTLESACVAQYARRYTH*
Ga0068867_10149943113300005459Miscanthus RhizosphereGKSDPDLGPLSVERFRGRWEDAAGLEAACVGQYARKYTH*
Ga0070706_10126935313300005467Corn, Switchgrass And Miscanthus RhizosphereLIVDGKSEPDLAPLSVQRFAGAARDGAALEAACVAQYARRYTH*
Ga0070706_10177237413300005467Corn, Switchgrass And Miscanthus RhizosphereSPAAGRALADLIVDGKSDPDLTPISVERFGESYRNPGTLESACVAQYARRYTH*
Ga0070696_10135926613300005546Corn, Switchgrass And Miscanthus RhizosphereLSLSPAAGRALADLIVDGKSDPDLGPISVERFGAAPRDPAALEAACVAQYARRYTH*
Ga0068857_10232100613300005577Corn RhizosphereLIVDGKSDPDLAPLSVRRFAGAARDGAALEAACVAQYARRYTH*
Ga0066691_1054727533300005586SoilDGKSDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH*
Ga0068852_10024730013300005616Corn RhizosphereSLSPAAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALQAACVAQYARRYTH*
Ga0068861_10025046013300005719Switchgrass RhizosphereLSLSPAAGRALADLIVDGKSDPDLAPLSVERFRGRWEDAAELEAACVGQYARKYTH*
Ga0075294_100029213300005881Rice Paddy SoilTGRALADLIADGKSDPDLAPISMERFADGSRDPAALEAACVAQYARRYTH*
Ga0070716_10147742323300006173Corn, Switchgrass And Miscanthus RhizosphereGLSLSPAAGRALANLIVDGKSDPDLAPLSVERFAGVARDGAALEAACVAQYARRYTH*
Ga0075021_1001080063300006354WatershedsPDLAPISVERFGAAPRDPAALEAACIAQYARRYTH*
Ga0079221_1166685023300006804Agricultural SoilDGKSDPDLAPLSVERFAGAARDGAALEAACVAQYARRYTH*
Ga0079220_1106778623300006806Agricultural SoilDLIVDGKSDPDLGPLSVERFGAAPRDPAALEAACVAQYARRYTH*
Ga0068865_10029437613300006881Miscanthus RhizospherePAAGRALADLVVDGRSDPDLTPLSVERFRGRLDDPSALEAACVAQYARRYTR*
Ga0075424_10272396923300006904Populus RhizosphereDLILDGRSEPDLGPWSVERFRGRFEDKAALEAACVAHYARKYIK*
Ga0075435_10076986523300007076Populus RhizosphereVGGLSLSPAAGRALADLIVDGKSEPDLAPLSVQRFAGAARDGAALEAACVAQYARRYTH*
Ga0099794_1019458413300007265Vadose Zone SoilDLIVDGKSDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH*
Ga0066710_10312613923300009012Grasslands SoilPSAGRALADLILDGKSDPDLGPLSVERFRGRYAEPRELESACIGQYARKYTH
Ga0099829_1114940813300009038Vadose Zone SoilDPDLGPLSVERFRGRYENPRELEAACVGEYARKYLH*
Ga0111539_1132925813300009094Populus RhizosphereRALADLILDGKSDPDLAPLSVERFQGRYPDAAALEAVCVEHYARKYIK*
Ga0075423_1068482423300009162Populus RhizosphereRALADLILDGRSEPDLGPWSVERFRGRFEDKAALEAACVAHYARKYIK*
Ga0105237_1068655813300009545Corn RhizosphereDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0105063_105892523300009804Groundwater SandVDGKSDPDLAPISVERFGEGYREPAALESACVAQYARRYMH*
Ga0105068_110507723300009836Groundwater SandDGKSDPDLAPISVERFGEGYREPAALESACVAQYARRYMH*
Ga0105074_105389213300010029Groundwater SandDGKSDPDLGPLSVERFRGRYTAAAELEAACVGQYARRYTR*
Ga0134067_1014600023300010321Grasslands SoilGGLSISPALGRALADLILDGRTEPDLRPYYVERFGEAYRDGAELAAACRYAYARKYVK*
Ga0126376_1011474713300010359Tropical Forest SoilAVGRTLADLILDGKSDPDLGPLSVERFRNRWDDTAGLTEACVRQYARRYTR*
Ga0126376_1118871713300010359Tropical Forest SoilSDPDLSPLSVDRFRGRLEDGAALEAACVAQYARRYVR*
Ga0126372_1256624613300010360Tropical Forest SoilDLIVDGKSDPDLSPLSVERFGERYRDQRELESICVAQYARRYTH*
Ga0126372_1288076913300010360Tropical Forest SoilPLARRGRTLADLILDGKSDPDLGPLSVERFRNRWDDTAGLTEACVRQYARRYTR*
Ga0105239_1201140013300010375Corn RhizosphereDLIVDGKSDPDLGPLSVERFRGRWEDAAGLEAACVGQYARKYTH*
Ga0126381_10299101213300010376Tropical Forest SoilGRALADLIVDGKSEPDLAPLSVERFRGRYEDTGALEAACVGQYARRYTR*
Ga0126383_1170347623300010398Tropical Forest SoilDGKSDPDLGPLSVERFKGRYEGAAELTAACLSQYARKYTH*
Ga0126383_1285883513300010398Tropical Forest SoilPAAGRALADLIVDGKSEPDLAPLSVERFRGHYEDTGALEAACVGQYARRYTR*
Ga0105246_1183688213300011119Miscanthus RhizosphereIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0137388_1021169933300012189Vadose Zone SoilADLIVDGKSEPDLAPISVERFGAATRDPAALDAACVAQYARRYTH*
Ga0137383_1120587613300012199Vadose Zone SoilAGRALADLIVDGKSDPDPAPISVERIGPAPRDPPALEAACVAQYARRYTH*
Ga0137465_106673423300012231SoilSPAAGRALADLIVDGRSDPDLAPLGVERFRGRLEDAAALEAACVAQYARRYMR*
Ga0137366_1113328423300012354Vadose Zone SoilGKSDPDLTPLSVERFRGRFAGARELESACVAQYARKYIH*
Ga0137390_1048645713300012363Vadose Zone SoilTGRALADLIVDGKSDPDLAPISVERFADGYRDPAQLEAACVAQYARRYTH*
Ga0157305_1015601613300012891SoilLADLIVDGKSDPDLAPISVERFGGAHRDPAALESACVAQYARRYTH*
Ga0157282_1037816613300012904SoilPAAGRALADLIVDGKSDPDLGPLSVERFRGRWEDAAGLEAACVGQYARKYTH*
Ga0137416_1064544233300012927Vadose Zone SoilDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH*
Ga0137410_1027044633300012944Vadose Zone SoilLSPAAGRALADLIVDGKSDPDLAPISVERFADGYRDPAALEAACVAQYARRYTH*
Ga0126375_1081861913300012948Tropical Forest SoilSDPDLSPLSVERFAGRHETPGDLEAACVRQYARKYTH*
Ga0164309_1101950633300012984SoilDLGPLSVGRLAGAARDPGALEAACVAQYARRYTH*
Ga0164308_1156560713300012985SoilDLIVDGKSDPDLGPLSVERFRGRWEDAADLEAACVGQYARRYTR*
Ga0157375_1301928923300013308Miscanthus RhizosphereGLSLSPAAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH*
Ga0075301_116728713300014262Natural And Restored WetlandsDGKSDPDLAPISVERFGTGDRDAATLESACVAQYARRYTH*
Ga0157379_1140288133300014968Switchgrass RhizospherePDLAPLSVERFRGRWEDAAGLEAACVGQYARRYTR*
Ga0134085_1059625023300015359Grasslands SoilRALADLILDGKSDPDLTPLSVERFRGRFADARELESACVGQYARKYMH*
Ga0132258_1058204013300015371Arabidopsis RhizosphereKSDPDLGPLSVERFRGRWEDAADLEAACVGQYARRYTR*
Ga0132255_10011944153300015374Arabidopsis RhizosphereALADLILDGKSDPDLAPLSVERFAGRHETQADLEAACVRQYARKYTH*
Ga0136617_1029209413300017789Polar Desert SandGGLSLSPAAGRALADLIVDGRSVPDLAPLSVERFRGRYEDPAELEAACVRAYARKYTK
Ga0136617_1046654833300017789Polar Desert SandRALADLIVDGKCEPDLAPLSVERFGAYADDPAALTAACVDHYARKYMK
Ga0187824_1004037623300017927Freshwater SedimentPDLAPVSVERFAGVGRDPAALEAACVAQYARRYTH
Ga0184621_1010122713300018054Groundwater SedimentVDGRSDPDLAPLGVERFRGRLEDAAALEAACVAQYARRYTR
Ga0184609_1006584633300018076Groundwater SedimentLADLVVDGRSDPDLAPLGVERFRGRLEDAAALEAACVAQYARRYTR
Ga0184609_1045095913300018076Groundwater SedimentGLSPAAGRVLADLILDSKSDPDLTPLSVERFRGRYENARELEAACVGEYARKYRH
Ga0190265_1046136313300018422SoilAGRALADLVLDGKSDPDLTPISVARFAEGDRDPAALEAACVAQYARRYTH
Ga0066662_1256119223300018468Grasslands SoilDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH
Ga0190270_1188449613300018469SoilDLVVDGRSDPDLAPLGVERFRGRLEDAAALEAACVAQYARRYTR
Ga0193725_103736433300019883SoilRALADLIVDGKSEPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH
Ga0193727_111992133300019886SoilLIVDGKSDPDLAPISVERFADGYRDPAQLEAACVAQYARRYTH
Ga0193711_104622923300019997SoilPAAGRALADLIVDGKSDPDLAPISVERFADSYRDAAALEAACVAQYARRYTH
Ga0193721_108378633300020018SoilPDLAPISVERFADSYRDPVALEAACVAQYARRYTH
Ga0206354_1008279123300020081Corn, Switchgrass And Miscanthus RhizosphereADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH
Ga0210403_1116408723300020580SoilADLIVDGKSDPDLTPISVERFAAAPRDAAALEAACVAQYARRYTH
Ga0222623_1008306433300022694Groundwater SedimentGKSDPDLAPISVERFADSYRDPVALEAACVAQYARRYTH
Ga0207423_108330323300025535Natural And Restored WetlandsADLILDGRSDPDLGPLSVERFGCRFDAPAELRATCVAQYARKYTH
Ga0207645_1032874213300025907Miscanthus RhizosphereVGGLGLSPAAGRALADLVVDGRSDPDLTPLSVERFRGRLEDPSALEAACVAQYARRYTR
Ga0207684_1141547113300025910Corn, Switchgrass And Miscanthus RhizosphereLIVDGKSEPDLAPLSVQRFAGAARDGAALEAACVAQYARRYTH
Ga0207695_1174910613300025913Corn RhizosphereVGGLSLSPAAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH
Ga0207671_1045521313300025914Corn RhizosphereDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH
Ga0207693_1035183713300025915Corn, Switchgrass And Miscanthus RhizosphereAAGRALADLIVDGKSDPDLGPLSVGRFAGAARDPGALEAACVAQYARRYTH
Ga0207660_1077681513300025917Corn RhizosphereGRALADLIVDGKSDPDLTPISVERFADGYRDPAALEAACVAQYARRYTH
Ga0207687_1069338833300025927Miscanthus RhizosphereLSLSPSTGRALADLIVDGKSDPDLAPLSVERFTDGYRDPAALKAACVAQYARRYTH
Ga0207679_1143855323300025945Corn RhizosphereDGKSEPDLAPLSVQRFAGAARDGAALEAACVAQYARRYTH
Ga0207712_1091188613300025961Switchgrass RhizosphereLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH
Ga0207658_1142542223300025986Switchgrass RhizospherePAAGRALADLIVDGKSDPDLAPLSVERLAAASRDGAALEAACVAQYARRYTH
Ga0207703_1203820713300026035Switchgrass RhizospherePDLAPLSVERFRGRWEDAAGLEAACVGQYARRYTR
Ga0207648_1029039413300026089Miscanthus RhizosphereRALADLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH
Ga0207648_1095731633300026089Miscanthus RhizosphereIVDGKSDPDLGPLSVERFRGRWEDAAGLEAACVGQYARKYTH
Ga0209438_104939013300026285Grasslands SoilGRSDPDLAPLGVERFRGRLEDAAALEAACVAQYARRYTR
Ga0257179_101263913300026371SoilAGRALADLIVDGKSDPDLGPISVERFGAAPRDPAALEAACVAQYARRYTH
Ga0257168_106253833300026514SoilIVDGKSDPDLGPISVERFGAAPRDPAALEAACVAQYARRYTH
Ga0209161_1035386223300026548SoilALADLILDGKSDPDLTPLSVERFRGRFADARELESACVGQYARKYMH
Ga0209846_105092223300027277Groundwater SandPDLTPLSVERFQDRYDDPTELEAACVGRYARKYLK
Ga0209984_104553013300027424Arabidopsis Thaliana RhizosphereAAGRALADLIVDGKSDPDLAPISVERFGGAHRDPAALESACVAQYARRYTH
Ga0209588_113829513300027671Vadose Zone SoilADLIVDGKSDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH
Ga0209998_1017722113300027717Arabidopsis Thaliana RhizosphereFSILAAAALADLIVDGASDPDLAPLSVERFRGRLEDRAALEAACVAQYARRYTR
Ga0209177_1029063813300027775Agricultural SoilDGKSDPDLGPLSVERFAGAARDGGALEAACVAQYARRYTH
Ga0209177_1040936823300027775Agricultural SoilSLSPAAGRALADLIVDGKSDPDLAPLSVERFAGAARDGAALEAACVAQYARRYTH
Ga0209068_1000800813300027894WatershedsIVDGKSDPDLAPISVERFGAAPRDPAALEAACIAQYARRYTH
Ga0207428_1103856313300027907Populus RhizosphereLTLSPAAGRALADLILDGKSDPDLAPLSVERFQGRYPDAAALEAVCVEHYARKYIK
Ga0209859_107081723300027954Groundwater SandGRSEPDLTPLSVERFQDRYDDPTELEAACVGRYARKYLK
(restricted) Ga0233417_1004941033300028043SedimentSPAAGRALADLIVDGKSDPDLTPLAVERFADGYRDPAALEAACVAQYARRYTH
Ga0268264_1072720013300028381Switchgrass RhizosphereGLSPAAGRALADLVVDGRSDPDLTPLSVERFRGRLEDPSALEAACVAQYARRYTR
Ga0137415_1060911013300028536Vadose Zone SoilPAAGRALADLIVDGKSDPDLAPISVERFGAAPRDPAALEAACVAQYARRYTH
Ga0247828_1073762013300028587SoilLSPSTGRALADLIVDGKSDPDLAPLSVERFTDGYRDPAALEAACVAQYARRYTH
Ga0307302_1059745013300028814SoilADLVVDGRSDPDLAPLSVERFRGRLEDTAALEAACVAQYARRYTR
Ga0222749_1022476913300029636SoilPDLTPISVERFAAAPRDAAALEAACVAQYARRYTH
Ga0307473_1134417823300031820Hardwood Forest SoilVGGLSLSPAAGRALADLIVDGKSDPDLAPLSVERFAGAARDGAALEAACVAQYARRYTH
Ga0307478_1161030113300031823Hardwood Forest SoilAAGRTLADLIVDGKSDPDLTPISVERFAAAPRDAAALEAACVAQYARRYTH
Ga0310890_1124266023300032075SoilLIVDGKSDPDLAPLAVERFGAAPRDPAALEAACVAQYARRYTH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.