Basic Information | |
---|---|
Family ID | F070453 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 41 residues |
Representative Sequence | DRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.37 % |
% of genes from short scaffolds (< 2000 bps) | 91.87 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.122 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.024 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.033 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.528 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 70.00% β-sheet: 0.00% Coil/Unstructured: 30.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF01979 | Amidohydro_1 | 6.50 |
PF03401 | TctC | 2.44 |
PF09084 | NMT1 | 2.44 |
PF02586 | SRAP | 2.44 |
PF07813 | LTXXQ | 2.44 |
PF00857 | Isochorismatase | 2.44 |
PF07883 | Cupin_2 | 1.63 |
PF16694 | Cytochrome_P460 | 1.63 |
PF00805 | Pentapeptide | 1.63 |
PF04392 | ABC_sub_bind | 1.63 |
PF09351 | DUF1993 | 0.81 |
PF13340 | DUF4096 | 0.81 |
PF13531 | SBP_bac_11 | 0.81 |
PF08241 | Methyltransf_11 | 0.81 |
PF13683 | rve_3 | 0.81 |
PF02796 | HTH_7 | 0.81 |
PF13460 | NAD_binding_10 | 0.81 |
PF07995 | GSDH | 0.81 |
PF13551 | HTH_29 | 0.81 |
PF00111 | Fer2 | 0.81 |
PF00011 | HSP20 | 0.81 |
PF00118 | Cpn60_TCP1 | 0.81 |
PF12680 | SnoaL_2 | 0.81 |
PF10908 | DUF2778 | 0.81 |
PF00072 | Response_reg | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 9.76 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.44 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 2.44 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.44 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 2.44 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.44 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.44 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.63 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.63 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.12 % |
Unclassified | root | N/A | 4.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_109345304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
3300005166|Ga0066674_10170027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1033 | Open in IMG/M |
3300005166|Ga0066674_10331771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 715 | Open in IMG/M |
3300005332|Ga0066388_100829206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1513 | Open in IMG/M |
3300005437|Ga0070710_10183742 | Not Available | 1311 | Open in IMG/M |
3300005445|Ga0070708_100356952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1377 | Open in IMG/M |
3300005467|Ga0070706_101663857 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005518|Ga0070699_100327904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300005764|Ga0066903_100712439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1772 | Open in IMG/M |
3300005764|Ga0066903_103380416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
3300005764|Ga0066903_103443902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
3300005764|Ga0066903_103737396 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005764|Ga0066903_104277926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
3300005764|Ga0066903_104299968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
3300005764|Ga0066903_104779558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 720 | Open in IMG/M |
3300005764|Ga0066903_106322062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300005764|Ga0066903_106571584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300005764|Ga0066903_108946720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300006034|Ga0066656_10393510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
3300006173|Ga0070716_101668303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300006844|Ga0075428_100144314 | Not Available | 2587 | Open in IMG/M |
3300009088|Ga0099830_11742711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
3300009090|Ga0099827_11804976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
3300010047|Ga0126382_10387359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1085 | Open in IMG/M |
3300010048|Ga0126373_11422932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
3300010303|Ga0134082_10519442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300010326|Ga0134065_10200541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
3300010333|Ga0134080_10243581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300010361|Ga0126378_10899224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
3300010361|Ga0126378_12530757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
3300010362|Ga0126377_13139398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300010366|Ga0126379_11522521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
3300010366|Ga0126379_13458003 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010366|Ga0126379_13689902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300010376|Ga0126381_100154006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3022 | Open in IMG/M |
3300010376|Ga0126381_101943793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
3300012199|Ga0137383_10673482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
3300012199|Ga0137383_11212830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300012201|Ga0137365_10216116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1431 | Open in IMG/M |
3300012201|Ga0137365_10998310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300012205|Ga0137362_11543329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300012208|Ga0137376_11633157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300012211|Ga0137377_10290775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1568 | Open in IMG/M |
3300012582|Ga0137358_10305046 | Not Available | 1081 | Open in IMG/M |
3300012948|Ga0126375_11695565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300012948|Ga0126375_12045307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300012977|Ga0134087_10271893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
3300012977|Ga0134087_10340703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 714 | Open in IMG/M |
3300016270|Ga0182036_10703195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
3300016270|Ga0182036_11218251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300016294|Ga0182041_10901595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
3300016294|Ga0182041_12194351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300016341|Ga0182035_10511927 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300016357|Ga0182032_11212499 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300016371|Ga0182034_11321538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
3300016387|Ga0182040_11014890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300016422|Ga0182039_11758568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300016445|Ga0182038_12166511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300020579|Ga0210407_10759794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300021372|Ga0213877_10146826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
3300021479|Ga0210410_10536389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1043 | Open in IMG/M |
3300021560|Ga0126371_11596083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 779 | Open in IMG/M |
3300022756|Ga0222622_11364824 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300025898|Ga0207692_10225819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1112 | Open in IMG/M |
3300025910|Ga0207684_10577449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300027874|Ga0209465_10465107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
3300027909|Ga0209382_11189332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
3300029636|Ga0222749_10635741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 584 | Open in IMG/M |
3300031545|Ga0318541_10480541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
3300031546|Ga0318538_10077236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1684 | Open in IMG/M |
3300031546|Ga0318538_10727355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
3300031561|Ga0318528_10162833 | Not Available | 1190 | Open in IMG/M |
3300031561|Ga0318528_10192145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
3300031572|Ga0318515_10758442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300031573|Ga0310915_10179087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1476 | Open in IMG/M |
3300031640|Ga0318555_10202058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
3300031680|Ga0318574_10049090 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
3300031680|Ga0318574_10859403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300031681|Ga0318572_10059462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2081 | Open in IMG/M |
3300031682|Ga0318560_10773288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300031713|Ga0318496_10698580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300031719|Ga0306917_10084920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2233 | Open in IMG/M |
3300031723|Ga0318493_10584328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300031744|Ga0306918_10744188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
3300031747|Ga0318502_10056208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2084 | Open in IMG/M |
3300031747|Ga0318502_10247072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
3300031747|Ga0318502_10953072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300031748|Ga0318492_10288868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
3300031763|Ga0318537_10345372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300031765|Ga0318554_10394188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
3300031768|Ga0318509_10327529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 857 | Open in IMG/M |
3300031770|Ga0318521_10406619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
3300031771|Ga0318546_11347282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300031780|Ga0318508_1073476 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300031793|Ga0318548_10404113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300031798|Ga0318523_10306202 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300031799|Ga0318565_10395144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
3300031833|Ga0310917_10163725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1474 | Open in IMG/M |
3300031879|Ga0306919_10533271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
3300031880|Ga0318544_10001677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6128 | Open in IMG/M |
3300031890|Ga0306925_10111116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2925 | Open in IMG/M |
3300031897|Ga0318520_10126737 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300031897|Ga0318520_10663281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300031897|Ga0318520_10874612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300031910|Ga0306923_10479474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1408 | Open in IMG/M |
3300031910|Ga0306923_10712587 | Not Available | 1116 | Open in IMG/M |
3300031910|Ga0306923_10963884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
3300031941|Ga0310912_10194764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1548 | Open in IMG/M |
3300031942|Ga0310916_10108622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2239 | Open in IMG/M |
3300031945|Ga0310913_10165393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1534 | Open in IMG/M |
3300031946|Ga0310910_10686375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
3300031981|Ga0318531_10107750 | Not Available | 1231 | Open in IMG/M |
3300031981|Ga0318531_10583362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300032009|Ga0318563_10777111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300032059|Ga0318533_10829724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300032066|Ga0318514_10370182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300032066|Ga0318514_10399429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
3300032068|Ga0318553_10165666 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300032076|Ga0306924_10433366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1503 | Open in IMG/M |
3300032089|Ga0318525_10481192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300032180|Ga0307471_103468889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300032261|Ga0306920_100131171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 3729 | Open in IMG/M |
3300033289|Ga0310914_10325697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1387 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1093453041 | 3300000955 | Soil | EMVRKHIANEHNETMPPSMYEYFHGAVWRRKKLP* |
Ga0066674_101700271 | 3300005166 | Soil | RFLYSEMVRKHIANEHNETMPPSMYEYLHGAVWRRKKLP* |
Ga0066674_103317711 | 3300005166 | Soil | RFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0066388_1008292063 | 3300005332 | Tropical Forest Soil | CGASFLYSETVRKHIANEHDETMPPTMYEYFQGAVWQRKKLP* |
Ga0070710_101837421 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YSETVRKHIANEHNETMPPSMYEYFQGAVWQRKKLPWIWP* |
Ga0070708_1003569521 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0070706_1016638571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RICGDRFLYSEMVRKHIANEHNETMPPSIYEYFHGAVWQRKKLP* |
Ga0070699_1003279041 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGCGDRFLYSEMVRKHIANEHNEAMPPSMYEYFHGAIWQRKKLPNLA* |
Ga0066903_1007124391 | 3300005764 | Tropical Forest Soil | RICGESFLYSETVRKHITNEHDETMPPSMYEYFQGAVWQRKKFP* |
Ga0066903_1033804163 | 3300005764 | Tropical Forest Soil | DRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0066903_1034439023 | 3300005764 | Tropical Forest Soil | DRFQYSETVRKHIANEHNETIPPSMYEYFRGVVWHRKKIP* |
Ga0066903_1037373962 | 3300005764 | Tropical Forest Soil | HCRICGDRFLYSEMVRKHIGNEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0066903_1042779263 | 3300005764 | Tropical Forest Soil | RFQYSETVRKHIAHAHDENMPPSMYEYFRDEVWQRKKIP* |
Ga0066903_1042999681 | 3300005764 | Tropical Forest Soil | CRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLP* |
Ga0066903_1047795582 | 3300005764 | Tropical Forest Soil | HCRICGDRFQNSEMVRKHIANEHNEIMPPSMYEYFHGAIWQRKKLP* |
Ga0066903_1063220621 | 3300005764 | Tropical Forest Soil | FLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKRP* |
Ga0066903_1065715842 | 3300005764 | Tropical Forest Soil | HCRICGDRFLYSEMVRKHIGNEHNETMPPSMYEYFHGAVWERKKLP* |
Ga0066903_1089467201 | 3300005764 | Tropical Forest Soil | SEAVRKHIANEHNETMPPSMYEYFRGAVWQRKKIP* |
Ga0066656_103935101 | 3300006034 | Soil | CRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0070716_1016683032 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YSEMVRKHIANEHKETMPPMYEYFHGAIWQRKKLP* |
Ga0075428_1001443141 | 3300006844 | Populus Rhizosphere | CGDRFQYSETVRKHIADAHDESMPPSMYEYFRGAVWRRKKT* |
Ga0099830_117427112 | 3300009088 | Vadose Zone Soil | SETVRNHIADAHDENMPPSMYEYFRGAVWRRKKIP* |
Ga0099827_118049761 | 3300009090 | Vadose Zone Soil | FLYSEMVRKHIANEHNETMPPSMYEYFHGAVWRRKKLP* |
Ga0126382_103873591 | 3300010047 | Tropical Forest Soil | DRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRRKLP* |
Ga0126373_114229321 | 3300010048 | Tropical Forest Soil | MALPHCGDRFQYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0134082_105194422 | 3300010303 | Grasslands Soil | GDRFLYSEMVRKHIANEHNETMPPSMYEYFQGAVWQRKKLP* |
Ga0134065_102005411 | 3300010326 | Grasslands Soil | LYSEMVRKHIANEHNDTMPPSMSEYFHGAVWERKKLP* |
Ga0134080_102435811 | 3300010333 | Grasslands Soil | GDRFLYSEMVRKHIADAHDENMPPSMYEYFSGAFWQRKKIP* |
Ga0126378_108992242 | 3300010361 | Tropical Forest Soil | FQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP* |
Ga0126378_125307571 | 3300010361 | Tropical Forest Soil | SEMVRKHIANEHNETMPPSMYEYFRGAVWQRKKLP* |
Ga0126377_131393981 | 3300010362 | Tropical Forest Soil | HCRICGDRFQYSEAVRKHVAHAHHENMPPSMYEYFRGAVWHRKKIP* |
Ga0126379_115225212 | 3300010366 | Tropical Forest Soil | YSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP* |
Ga0126379_134580031 | 3300010366 | Tropical Forest Soil | ICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGAVWQRKKIP* |
Ga0126379_136899021 | 3300010366 | Tropical Forest Soil | ICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRSEVWQRKKLP* |
Ga0126381_1001540065 | 3300010376 | Tropical Forest Soil | HCRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFQGAVWQRKQLP* |
Ga0126381_1019437931 | 3300010376 | Tropical Forest Soil | FPYSEAVRKHVAHAHHENMPPSMYEYFRGAVWHRKKIP* |
Ga0137383_106734822 | 3300012199 | Vadose Zone Soil | CRICGDRFQYSEAVRKHIAHAHDENMPPSMYEYFRGAVWQRKKIP* |
Ga0137383_112128302 | 3300012199 | Vadose Zone Soil | CRICGDRFQYSEAVRKHIAHAHDENMPPSMYEYFRGAVWQRRHSD* |
Ga0137365_102161164 | 3300012201 | Vadose Zone Soil | HCRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWHRKKLP* |
Ga0137365_109983101 | 3300012201 | Vadose Zone Soil | RICGDRFLYSEMVRKHIANEHDETMPPSMYEYFHGAVWQRKKLP* |
Ga0137362_115433291 | 3300012205 | Vadose Zone Soil | RICGDRFLYSEMVRKHIADEHDENMPPSMYEYFRGAVWQRKKMP* |
Ga0137376_116331571 | 3300012208 | Vadose Zone Soil | SQLHCRICGDRVVYSEMGRKHSANEHNETMPPSMYEYFHGAVWQRKKRP* |
Ga0137377_102907754 | 3300012211 | Vadose Zone Soil | FLYSEMVRKHIANEHNETTPPSMYEYFRGAVWQRKKLP* |
Ga0137358_103050463 | 3300012582 | Vadose Zone Soil | LYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP* |
Ga0126375_116955651 | 3300012948 | Tropical Forest Soil | CGDRFQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLP* |
Ga0126375_120453071 | 3300012948 | Tropical Forest Soil | DRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP* |
Ga0134087_102718932 | 3300012977 | Grasslands Soil | FLYSEMVRKHIASEHNETMPPTMYEYFRGAVWHRKKLP* |
Ga0134087_103407032 | 3300012977 | Grasslands Soil | FLYSEMVPKHIANEHDETMPPSMYEYCHGAVWQRKKLP* |
Ga0182036_107031952 | 3300016270 | Soil | ICGERFRYSETVRKHIADAHDENMPPSMYEYFRGAVWQRKKTP |
Ga0182036_112182511 | 3300016270 | Soil | SETVRKHIADAHDENLPPSMYEYFRGAVWQRKKAP |
Ga0182041_109015951 | 3300016294 | Soil | DRFQYSEAVRKHVAHAHHENMPPSMYEYFRGAVWHRKKIP |
Ga0182041_121943511 | 3300016294 | Soil | FQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLP |
Ga0182035_105119272 | 3300016341 | Soil | CGERFRYSETVRKHIADAHDENMPPSMYEYFRGAVWQRKKTP |
Ga0182032_112124991 | 3300016357 | Soil | RFQHSETVRKHIAHAHDENIPPSMYEYFRGAAWQRKKIP |
Ga0182034_113215382 | 3300016371 | Soil | FQYSETVRKHIADAHDENMPPSMYEYFRGAAWRRKKLS |
Ga0182040_110148901 | 3300016387 | Soil | HCRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLP |
Ga0182039_117585682 | 3300016422 | Soil | ESFLYSEMVRKHIANEHNETMPPSMYEYFDGAVWQRKKLP |
Ga0182038_121665111 | 3300016445 | Soil | ICGDRFQYSETVRKHIAHAHDENIPPSMYEYFRGAVWQRKKIP |
Ga0210407_107597942 | 3300020579 | Soil | RFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0213877_101468261 | 3300021372 | Bulk Soil | PRPMALPHLCGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0210410_105363893 | 3300021479 | Soil | HCRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGAVWQRKKIP |
Ga0126371_115960832 | 3300021560 | Tropical Forest Soil | HCRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFQGAVWQRKQLP |
Ga0222622_113648242 | 3300022756 | Groundwater Sediment | RICGDRFLYSEMVRKHIVNEHKETMPPSMYEYFHGAVWQRKKLT |
Ga0207692_102258191 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TVRKHIANEHNETMPPSMYEYFQGAVWQRKKLPWIWP |
Ga0207684_105774491 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLISPSEW |
Ga0209465_104651071 | 3300027874 | Tropical Forest Soil | YSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKIP |
Ga0209382_111893321 | 3300027909 | Populus Rhizosphere | SEMVRKHSADEHDENMPPSMYEYFRGAVWQRKKIS |
Ga0222749_106357412 | 3300029636 | Soil | DRFLYSEMVRKHIANEHNEAVPPSMYEYFHGAIWQRKKLPNLA |
Ga0318541_104805412 | 3300031545 | Soil | FLYSEMVRKHIANEHNETMPPSMYEYFHGAIWQRKKLP |
Ga0318538_100772364 | 3300031546 | Soil | CRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318538_107273551 | 3300031546 | Soil | FLYSEMVRKHIANVHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318528_101628333 | 3300031561 | Soil | YSETVRKHIADAHDENMPPSMYEYFRGAVWQRKKGQ |
Ga0318528_101921454 | 3300031561 | Soil | LYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318515_107584422 | 3300031572 | Soil | HCRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLL |
Ga0310915_101790871 | 3300031573 | Soil | DRFQYSETVRKHIADAHDENLPPSMYEYFRGAVWQRKKVP |
Ga0318555_102020582 | 3300031640 | Soil | GDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318574_100490904 | 3300031680 | Soil | DRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318574_108594031 | 3300031680 | Soil | DRFLYSEMVRKHIANEHNEAMPPSMYEYFHGAIWQRKKLPNLA |
Ga0318572_100594624 | 3300031681 | Soil | SETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318560_107732882 | 3300031682 | Soil | YSETVRKHIAHAHDENTPPSMYEYFHGAVWQRKKLL |
Ga0318496_106985802 | 3300031713 | Soil | FQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLL |
Ga0306917_100849201 | 3300031719 | Soil | FQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318493_105843282 | 3300031723 | Soil | HCRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0306918_107441881 | 3300031744 | Soil | ICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318502_100562084 | 3300031747 | Soil | DRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318502_102470721 | 3300031747 | Soil | VRKHIANEHNEAMPPSMYEYFHGAIWQRKKLPNLA |
Ga0318502_109530721 | 3300031747 | Soil | YSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318492_102888683 | 3300031748 | Soil | SEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318537_103453721 | 3300031763 | Soil | PYIFARDQWHCRICGDRFLYSETVRKRIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318554_103941881 | 3300031765 | Soil | ICGDRFQYSEAVRKHVAHAHHENMPPSMYEYFRGAVWHRKKIP |
Ga0318509_103275292 | 3300031768 | Soil | FQYSETVRKHIPHAHDENMPPSMYEYFHGAVWQRKKLL |
Ga0318521_104066192 | 3300031770 | Soil | CGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318546_113472821 | 3300031771 | Soil | HCRICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318508_10734761 | 3300031780 | Soil | SEMVRKHIANKHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318548_104041131 | 3300031793 | Soil | YSEMVRKHIANKHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318523_103062021 | 3300031798 | Soil | LYSEMVRKHIANKHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318565_103951441 | 3300031799 | Soil | YLETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKLL |
Ga0310917_101637251 | 3300031833 | Soil | CGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0306919_105332711 | 3300031879 | Soil | QYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0318544_100016771 | 3300031880 | Soil | YSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0306925_101111165 | 3300031890 | Soil | GDRFQYSEAVRKHVAHAHHENMPPSMYEYFRGAVWHRKKIP |
Ga0318520_101267372 | 3300031897 | Soil | FLYSEMVRKHIANKHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318520_106632811 | 3300031897 | Soil | RFLYSEMVRKHIANEHNETMPPSMYEYFHGAIWQRKKLP |
Ga0318520_108746121 | 3300031897 | Soil | GDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0306923_104794743 | 3300031910 | Soil | RICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0306923_107125871 | 3300031910 | Soil | RICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKMP |
Ga0306923_109638841 | 3300031910 | Soil | CRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0310912_101947641 | 3300031941 | Soil | ICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAIWQRKKLP |
Ga0310916_101086221 | 3300031942 | Soil | DRFQYSETVHKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
Ga0310913_101653933 | 3300031945 | Soil | ICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0310910_106863751 | 3300031946 | Soil | DRFLYSEMVRKHIANEHNETMPPSMYEYFHGAIWQRKKLP |
Ga0318531_101077503 | 3300031981 | Soil | FLYSEMVRKHIANEHNETMPPSMYEYFHGAVWQRKKLP |
Ga0318531_105833621 | 3300031981 | Soil | SEMVRKHIANEHNEAMPPSMYEYFHGAIWQRKKLPNLA |
Ga0318563_107771111 | 3300032009 | Soil | CRICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKIP |
Ga0318533_108297243 | 3300032059 | Soil | LYSEMVRKHIANEHNETMPPSMYEYFHGAIWQRKKLP |
Ga0318514_103701822 | 3300032066 | Soil | HCRICGESFLYSEMVRKHIANEHNETMPPSMYEYFDGAVWQRKKLP |
Ga0318514_103994292 | 3300032066 | Soil | CLICGDRFLYSEMVRKHIANEHNETMPPSMYEYFHGAVWRRKKLP |
Ga0318553_101656661 | 3300032068 | Soil | CGDRFLYSEMVRKHIANKHNETMPPSMYEYFHGAVWQRKKLP |
Ga0306924_104333663 | 3300032076 | Soil | GERFRYSETVRKHIADAHDENMPPSMYEYFRGAVWQRKKGQ |
Ga0318525_104811922 | 3300032089 | Soil | CGDRFQYSETVRKHIAHAHDENMPPSMYEYFHGAVWQRKKSS |
Ga0307471_1034688891 | 3300032180 | Hardwood Forest Soil | HCRICGDRFLYSEMVRKHVANEHHENMPPSMYEYFHGAVWQRKKLP |
Ga0306920_1001311711 | 3300032261 | Soil | SEMVRKHIANEHNETMPPSMYEYFHGAVWRRKKLP |
Ga0310914_103256972 | 3300033289 | Soil | RICGDRFQYSETVRKHIAHAHDENMPPSMYEYFRGEVWQRKKLP |
⦗Top⦘ |