NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070449

Metagenome / Metatranscriptome Family F070449

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070449
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 38 residues
Representative Sequence EAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN
Number of Associated Samples 110
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.46 %
% of genes near scaffold ends (potentially truncated) 95.12 %
% of genes from short scaffolds (< 2000 bps) 85.37 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.374 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.951 % of family members)
Environment Ontology (ENVO) Unclassified
(26.829 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.220 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.52%    β-sheet: 0.00%    Coil/Unstructured: 48.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF13180PDZ_2 43.90
PF13365Trypsin_2 31.71
PF02882THF_DHG_CYH_C 2.44
PF00144Beta-lactamase 1.63
PF04028DUF374 1.63
PF01182Glucosamine_iso 0.81
PF00291PALP 0.81
PF07883Cupin_2 0.81
PF08241Methyltransf_11 0.81
PF10282Lactonase 0.81
PF14534DUF4440 0.81
PF00809Pterin_bind 0.81
PF13620CarboxypepD_reg 0.81
PF13586DDE_Tnp_1_2 0.81
PF00174Oxidored_molyb 0.81
PF13474SnoaL_3 0.81
PF01121CoaE 0.81
PF13561adh_short_C2 0.81
PF10861DUF2784 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG01905,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolaseCoenzyme transport and metabolism [H] 2.44
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 2.44
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.63
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.63
COG2121Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamilyFunction unknown [S] 1.63
COG2367Beta-lactamase class ADefense mechanisms [V] 1.63
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.81
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.81
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.81
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.37 %
UnclassifiedrootN/A1.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17002675All Organisms → cellular organisms → Bacteria → Acidobacteria1810Open in IMG/M
3300000567|JGI12270J11330_10122138All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300002245|JGIcombinedJ26739_100253811All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300005180|Ga0066685_10017568All Organisms → cellular organisms → Bacteria4213Open in IMG/M
3300005363|Ga0008090_10157662All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300005555|Ga0066692_10599032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300005556|Ga0066707_10834214All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005568|Ga0066703_10091297All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300005598|Ga0066706_10021237All Organisms → cellular organisms → Bacteria3945Open in IMG/M
3300005764|Ga0066903_104673190All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005843|Ga0068860_102836146All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006034|Ga0066656_10328286All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300006057|Ga0075026_100306637All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300006162|Ga0075030_100177321All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300006162|Ga0075030_100243428All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300006173|Ga0070716_101792554All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300006176|Ga0070765_100432409All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300006804|Ga0079221_10306934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium934Open in IMG/M
3300006804|Ga0079221_11331998All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300006954|Ga0079219_10028510All Organisms → cellular organisms → Bacteria2175Open in IMG/M
3300007258|Ga0099793_10686166All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009088|Ga0099830_11661589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300009089|Ga0099828_10080960All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300009090|Ga0099827_10951035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae745Open in IMG/M
3300009525|Ga0116220_10111506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1163Open in IMG/M
3300010046|Ga0126384_11380526All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300010159|Ga0099796_10294861All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300010341|Ga0074045_10118568All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300010358|Ga0126370_10197277All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300010358|Ga0126370_12077666All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300010360|Ga0126372_11857529All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010360|Ga0126372_12785352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300010366|Ga0126379_10753225All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300010366|Ga0126379_12609313All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300011269|Ga0137392_11641695All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300011270|Ga0137391_11508957All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300012189|Ga0137388_11849894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300012202|Ga0137363_10624795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300012203|Ga0137399_10730588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300012205|Ga0137362_11737818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012363|Ga0137390_11489506All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012683|Ga0137398_10220547All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300012922|Ga0137394_11499714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300012924|Ga0137413_10793030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300012925|Ga0137419_10315687All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300012929|Ga0137404_12086262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012948|Ga0126375_11537854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300013308|Ga0157375_11116316All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300014157|Ga0134078_10523567All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300014157|Ga0134078_10592484All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300014495|Ga0182015_10659164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi661Open in IMG/M
3300015054|Ga0137420_1395554All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300015241|Ga0137418_10309932All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300015241|Ga0137418_11171206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300015242|Ga0137412_10050946All Organisms → cellular organisms → Bacteria3375Open in IMG/M
3300016270|Ga0182036_11199294All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300016341|Ga0182035_11890155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300016404|Ga0182037_11317124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300016422|Ga0182039_11587449All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300017932|Ga0187814_10454114All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300017933|Ga0187801_10000244All Organisms → cellular organisms → Bacteria13576Open in IMG/M
3300017943|Ga0187819_10420492All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300018006|Ga0187804_10015304All Organisms → cellular organisms → Bacteria2711Open in IMG/M
3300018026|Ga0187857_10543694All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018062|Ga0187784_10197337All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300018090|Ga0187770_10602335All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300019275|Ga0187798_1193078All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300019788|Ga0182028_1538767All Organisms → cellular organisms → Bacteria → Acidobacteria2384Open in IMG/M
3300020580|Ga0210403_10652347All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300020580|Ga0210403_10774500All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300020580|Ga0210403_11047417All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300021168|Ga0210406_10416318All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300021171|Ga0210405_10204404All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300021180|Ga0210396_10008832All Organisms → cellular organisms → Bacteria9547Open in IMG/M
3300021181|Ga0210388_10046325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3617Open in IMG/M
3300021401|Ga0210393_10559664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium934Open in IMG/M
3300021401|Ga0210393_11396460All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300021405|Ga0210387_10460781All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300021407|Ga0210383_10011008All Organisms → cellular organisms → Bacteria → Acidobacteria7685Open in IMG/M
3300021432|Ga0210384_10306615All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300021477|Ga0210398_10415115All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300021559|Ga0210409_10723289All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300022726|Ga0242654_10128455All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300024290|Ga0247667_1014677All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300024347|Ga0179591_1242456All Organisms → cellular organisms → Bacteria3123Open in IMG/M
3300025922|Ga0207646_10475854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1126Open in IMG/M
3300025939|Ga0207665_11172089All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300026529|Ga0209806_1124649All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300026551|Ga0209648_10029571All Organisms → cellular organisms → Bacteria4788Open in IMG/M
3300026555|Ga0179593_1183572All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300027042|Ga0207766_1005955All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300027645|Ga0209117_1112295All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300027773|Ga0209810_1041648All Organisms → cellular organisms → Bacteria2527Open in IMG/M
3300027846|Ga0209180_10210452All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300027857|Ga0209166_10617978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300028293|Ga0247662_1038423All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300028747|Ga0302219_10003562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6092Open in IMG/M
3300029636|Ga0222749_10457024All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300031057|Ga0170834_106697890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M
3300031170|Ga0307498_10482055Not Available504Open in IMG/M
3300031545|Ga0318541_10638162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300031573|Ga0310915_10028869All Organisms → cellular organisms → Bacteria3444Open in IMG/M
3300031681|Ga0318572_10961444All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300031708|Ga0310686_107256980All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300031720|Ga0307469_10175087All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300031740|Ga0307468_100641758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300031744|Ga0306918_11126810All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300031754|Ga0307475_11308119All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300031770|Ga0318521_10128163All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300031797|Ga0318550_10462626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300031897|Ga0318520_10670423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300031962|Ga0307479_10009204All Organisms → cellular organisms → Bacteria9157Open in IMG/M
3300031962|Ga0307479_10540351All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300032094|Ga0318540_10133850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1182Open in IMG/M
3300032174|Ga0307470_10969051All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300032180|Ga0307471_101242214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300032828|Ga0335080_11438304All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300032892|Ga0335081_11928077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300032893|Ga0335069_11105778All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300033004|Ga0335084_11741880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300033289|Ga0310914_11194125All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300033289|Ga0310914_11398653All Organisms → cellular organisms → Bacteria602Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027042Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_006216602088090014SoilMEVKHHEMQKELERVRDIAEAWFTLPESDRNRYRAEFGS
JGI12270J11330_1012213833300000567Peatlands SoilEEMQKALERVRDIAENWYTMSEDERNRYRAELGP*
JGIcombinedJ26739_10025381113300002245Forest SoilVLEAKHAQMQRELERLRDIAESWFSLDEKARTRYRDEFGRLAPK*
Ga0066685_1001756853300005180SoilMEAKHAEMQRALERVRHIAEGWFLLSPDARDKHRAEFNR*
Ga0008090_1015766223300005363Tropical Rainforest SoilIRAKHEEMQKALEHVRDLTEGWFQLTEQERNRHRAEIGP*
Ga0066692_1059903223300005555SoilHAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ*
Ga0066707_1083421423300005556SoilEAKHAEMQRELERVRDLAESWFSLSQEARARHQAQFDR*
Ga0066703_1009129733300005568SoilAEMQHELERVRDLAEGWFSLSDSERDKIRADFNR*
Ga0066706_1002123713300005598SoilAEMQRELERVRDIAESWFWLGEEARAKHRAEFNH*
Ga0066903_10467319023300005764Tropical Forest SoilNEMQKELERVRDIAEGWFALAESERNRYRAEFGL*
Ga0068860_10283614613300005843Switchgrass RhizosphereSKHQEMQKELERVRDIAEGWFALPESERNRYRAEFGK*
Ga0066656_1032828613300006034SoilDASAEVMEAKHTEMQRELERVRDIAEGWYLLSPDAREKHRAEFSR*
Ga0075026_10030663713300006057WatershedsTNASQETVQAKHLEMQRALEHVRDLAEGWFAMTEEQRQRLRVEIGP*
Ga0075030_10017732113300006162WatershedsERKHAEMQKILEQVRYVAEEWFSLTEEERERKRAVWDA*
Ga0075030_10024342833300006162WatershedsAKHEEMQQELERVRDLAESWFSLTEDQRSRYRTEFGP*
Ga0070716_10179255423300006173Corn, Switchgrass And Miscanthus RhizosphereKHAEMQKELERVRDIAEGWFALSESERDRYRAAIGR*
Ga0070765_10043240913300006176SoilHAEMQRELERVRDIGESWFTLTDSQRNSHRTEFNQ*
Ga0079221_1030693413300006804Agricultural SoilLLEAKHQEMQRELERVRDIAESWFSLSESDRQNFRAEFSK*
Ga0079221_1133199823300006804Agricultural SoilHAEMQRELERVRDIAEGWFLLSPDARDKHRAEFNR*
Ga0079219_1002851013300006954Agricultural SoilAKHAEMQRELERVRDIAEGWFLLSPDARDKHRAEFNR*
Ga0099793_1068616623300007258Vadose Zone SoilELERVRDIAESWFSLSDEARAEHRAEFSRSNPQT*
Ga0099830_1166158923300009088Vadose Zone SoilKHAEMQRELERVRDIAEGWFSLSEAEREKYRAKFQS*
Ga0099828_1008096043300009089Vadose Zone SoilAEMQRELERVRDIAEGWFALSDAERERNRSEFGK*
Ga0099827_1095103513300009090Vadose Zone SoilAEMQRELERVRDIAESWFLLSEAEREKYRAEFSA*
Ga0116220_1011150613300009525Peatlands SoilPEMIKARHEEMQKALERVRDIAEGWFAMSEDERNRYRAEFGP*
Ga0126384_1138052613300010046Tropical Forest SoilHAEMQKALERVRDIAEGWFSLSEDQRNRWRAEIGP*
Ga0099796_1029486113300010159Vadose Zone SoilGKHAEMQRELERVRDIAEAWFSLSDSDREKYRAEFARRP*
Ga0074045_1011856833300010341Bog Forest SoilAKHEEMQKALERVRDIAEGWFTMSEGERNRYRAEFGP*
Ga0126370_1019727733300010358Tropical Forest SoilEMQRELERVRDIAESWFGLSESGRQKHRSEFSTRAQQ*
Ga0126370_1207766623300010358Tropical Forest SoilMEQKHAEMQRELERVRDIAEGWYLLSPDAREKHRAEFNS*
Ga0126372_1185752913300010360Tropical Forest SoilAEMQKELERVRDIAEAWFSASEDERGRHRAEFGK*
Ga0126372_1278535213300010360Tropical Forest SoilAEMQRELERVRDIAEGWFLLSEDARAKHRAEFNRQ*
Ga0126379_1075322513300010366Tropical Forest SoilAEMQRELERVRDIAEGWYLLGPDAREKHRAQFNRS*
Ga0126379_1260931323300010366Tropical Forest SoilEKHAEMQRELERVRDIAEGWYLLSPDAREKHRAEFNS*
Ga0137392_1164169513300011269Vadose Zone SoilQLEAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN*
Ga0137391_1150895723300011270Vadose Zone SoilEAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN*
Ga0137388_1184989413300012189Vadose Zone SoilNAVVMETKHEEMQLELERVRDIAEGWFLLTEEARAKYRLEFNRSSSRV*
Ga0137363_1062479513300012202Vadose Zone SoilKHEEMQQELERVRDIAEGWFLLTEEARAKYRLEFNRSSSRV*
Ga0137399_1073058823300012203Vadose Zone SoilEMQRELERVRDIAESWFSLSDEERTKHRAEFNRSNP*
Ga0137362_1173781813300012205Vadose Zone SoilHAEMQRELERVRDIAEVWFALSDSERARHRSEFNQ*
Ga0137390_1148950623300012363Vadose Zone SoilADATLLEAKHAEMQRELERVRDIAEGWFCLGDEERNLHRQAIGK*
Ga0137398_1022054723300012683Vadose Zone SoilVIEAKHAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ*
Ga0137398_1048981723300012683Vadose Zone SoilADANQEMLEAKHAAMQRGLERVRDIAEAWFSLSDSDREKYRAEFARRP*
Ga0137394_1149971423300012922Vadose Zone SoilAEMQRELERVRDIAEGWFSLREEDRGKLRAQFNL*
Ga0137413_1079303023300012924Vadose Zone SoilEAKHAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ*
Ga0137419_1031568713300012925Vadose Zone SoilEMQKELERVRDIAEGWFGLSEAERDAHRLAIRRR*
Ga0137404_1208626213300012929Vadose Zone SoilADAEVMEAKHGEMQRELERVRDIAEGWFALSEDERGKLRAQFNS*
Ga0126375_1153785413300012948Tropical Forest SoilMAAEMQRELERVRDIAEGWFLLSEQARASHRGAFNT*
Ga0157375_1111631613300013308Miscanthus RhizosphereHNEMQKELERVRDIAEGWFALPESERNRYRAEFGS*
Ga0134078_1052356723300014157Grasslands SoilAKHAEMQKELERVRDVAEDWFSLSKAERERFRKKIGK*
Ga0134078_1059248423300014157Grasslands SoilAEVMEAKHTEMQRELERVRDIAEGWYLLSPDAREKHRAEFSR*
Ga0182015_1065916413300014495PalsaAEMQHVLERVRDLAEGWFQMTEAQRNALRAEFNGT*
Ga0137420_139555413300015054Vadose Zone SoilMQRELERVRDIAEGWFSLSDSDREKYRTEFGVQTVK*
Ga0137418_1030993213300015241Vadose Zone SoilGADATVLEAKHAEMQRELERVRDIAEGWFGLSESERNAHRAAIGA*
Ga0137418_1117120623300015241Vadose Zone SoilELERVRDIAESWFSVGDAEREKHRAEFSRSNPQA*
Ga0137412_1005094643300015242Vadose Zone SoilMEAKHADMQRELERVRDIAEGWFSLNEGARAQHRAAFQQ*
Ga0182036_1119929413300016270SoilKHQEMQKELERVRDIAEAWFALAETERDRYRAEFGK
Ga0182035_1189015513300016341SoilKHEEMQKALENVRDLTEGWFTLTEEERNRHRTEIGP
Ga0182037_1131712423300016404SoilLIKAKHQEMQKELERVRDLAESWFAMSEEQRNRLRAEIGQ
Ga0182039_1158744913300016422SoilHAEMQRELERGRDIAERWFLMSGDTREKLRAEFNR
Ga0187814_1045411413300017932Freshwater SedimentHEEMQKALERVRDITEGWFGLTEDERNRYRAEIGP
Ga0187801_1000024413300017933Freshwater SedimentIKAKHEEMQKTLERVRDIAEAWFSFTEEERDRYRVEIGP
Ga0187819_1042049213300017943Freshwater SedimentMVKAKHAEMQKELERVRDIAEGWFSFTEDERNRYRAEIGP
Ga0187804_1001530413300018006Freshwater SedimentAKHAEMQRELERVRDIAEGWFSLSEEERKNHRADFGQ
Ga0187857_1054369413300018026PeatlandPKQLEAKHAEMQRELERVRDIAESWFDLADADRDLHRAAFNL
Ga0187784_1019733723300018062Tropical PeatlandMIKAKHEEMQKALERVRDITEGWFSLTEEERNRYRGEIGP
Ga0187770_1060233513300018090Tropical PeatlandEMIKAKHEEMQKALERVRDIAEGWFTMSEDERNRYRAEFGP
Ga0187798_119307813300019275PeatlandAKHEEMQKALERVRDIAEGWFTMSEDERNRYRAEFGP
Ga0182028_153876723300019788FenMIKAKHEEMQKALERVRDIAEGWYAMSEDERNRYRAEFGP
Ga0210403_1065234713300020580SoilETKHQEMQKELERVRDIAEGWFSFTDEEREEYRVEFGR
Ga0210403_1077450013300020580SoilAVMIDTKHQEMQKELERVRDIAEGWFSFTEAEREKYRAEFGM
Ga0210403_1104741723300020580SoilKHAEMQSELERVRDIAESWFSLSEADRQKHRAEFAR
Ga0210406_1041631813300021168SoilKHAEMQRELERVRDIAESWFSLPEAEREKQRAEFGVTSS
Ga0210405_1020440413300021171SoilKQAEMQRELERVRDIAESWFSMSDKERDLYRAEFDL
Ga0210396_10008832103300021180SoilETKHQEMQKELERVRDIAEGWFSFSEEEKEKYRTEFGW
Ga0210388_1004632543300021181SoilQAKHQEMQKALERVRDITEGWFALSEEERNRYRAEIGP
Ga0210393_1055966413300021401SoilHAEMQHELERVRDIAESWFSLSASDRQKLRAEFSI
Ga0210393_1139646013300021401SoilGMIEAKQAEMQRELERVRDVAEAWFSLSEAERARHRKEFNR
Ga0210387_1046078123300021405SoilKHAEMQRALEHVRDLAEGWFSFSEEERQRIRAEIGP
Ga0210383_1001100893300021407SoilTKHQEMQKELERVRDIAEGWFSFSEEEKEKYRTEFGE
Ga0210384_1030661513300021432SoilDANADGMEAKQAEMQRELERVRDIAEEWFALGEEERAKYRVRFNS
Ga0210398_1041511513300021477SoilAKHQEMQKELERVRDIAEGWFSCTDDEREKYRAEFGW
Ga0210409_1072328913300021559SoilEAKHAEMQRELERVRDIAESWFSLSDADRATHRAQFSG
Ga0242654_1012845523300022726SoilDMIRAKHEEMQKALECVRDIAEGWFSLSEEERNRLRAEIGP
Ga0247667_101467733300024290SoilRHAEMQSELERVRDIAESWFSLSETDRQNFRAEFSK
Ga0179591_124245663300024347Vadose Zone SoilMQRELERVRDIAEAWFTLSDSDREKYRAEFGVSSKQ
Ga0207646_1047585413300025922Corn, Switchgrass And Miscanthus RhizosphereKHAEMQAGLERVRDIAESWFVLRPEERERYRAEYNS
Ga0207665_1117208913300025939Corn, Switchgrass And Miscanthus RhizosphereQRELGRVRDIAESWFSLGEEQRAVYRAQFGRGAGT
Ga0209806_112464913300026529SoilHAEMQRELERVRDIAESWFSLSEIEHQRYREEFGS
Ga0209648_1002957113300026551Grasslands SoilDQGMLEAKHAEMQREFERVRDIAENWFSLSGAEREKHRKEFTR
Ga0179593_118357223300026555Vadose Zone SoilHQEMQKELERVRDLAEGWFSFTDAEREKYRAEFEK
Ga0207766_100595513300027042Tropical Forest SoilRAKHEEMQKALENVRDLTEGWFKLTEEERNRHRAEIGP
Ga0209117_111229523300027645Forest SoilLLEAKHAEMQKELERVRDIAEGWFGLSEAERDARRLAIGR
Ga0209810_104164813300027773Surface SoilPNADSALMKEKHLRMQKELERVRDIAENWFTMSEAERGRYRAEFGK
Ga0209180_1021045223300027846Vadose Zone SoilAKHAEMQRKLERVRDIAESWYSLSEAEREKHRAEFDQ
Ga0209166_1061797823300027857Surface SoilAMIETKHQEMQKELERVRDIAEGWFSFTDEQRQKYRAEFGQ
Ga0247662_103842313300028293SoilKAKHNEMQKELERVRDIAEGWFGLPESDRNRYRAEFGK
Ga0302219_1000356293300028747PalsaSMEAKHAEMQRELERVRDLAEGWYSLSESDREKHRAQFAI
Ga0222749_1045702423300029636SoilDAAMIETKHQEMQKELERVRDIAEGWYSFTDGEREKYRAEFGW
Ga0170834_10669789023300031057Forest SoilLESKHAEMQSALERVRDIAESWYSLKESDRETFRAEFSK
Ga0307498_1048205513300031170SoilVLEAKHAEMQKELERVRDIAEGWFGFGEEARDAYRSEFGK
Ga0318541_1063816213300031545SoilIKVKHEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP
Ga0310915_1002886943300031573SoilDMIKVKHEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP
Ga0318572_1096144423300031681SoilDLEMIRAKHEEMQKALEHVRDLTEGWFKLTEEERNCHRAEIGP
Ga0310686_10725698023300031708SoilAMEAKHAEMQRELERVRDLAEGWFAMSDSEREQHRAAFAM
Ga0307469_1017508713300031720Hardwood Forest SoilHQEMQKELERVRDIAEGWFALPESERNRYRAEFGK
Ga0307468_10064175823300031740Hardwood Forest SoilEAKHADVQRELERVRDIAEGWFALSEEEREKLRAQFNS
Ga0306918_1112681013300031744SoilGMEAKHNQMQKELERVRDIAEAWFTLPESERDRYRAEFGK
Ga0307475_1130811923300031754Hardwood Forest SoilHEEMQKALERVRDLAEGWFQLTEDERNRHRAEIGP
Ga0318521_1012816313300031770SoilSEMIRAKHEEMQKALEHVRDLTEGWFQLTEQERNRHRAEIGP
Ga0318550_1046262623300031797SoilHNEMQKELERVRDIAEGWFALPESERDRYRAEFGP
Ga0318520_1067042313300031897SoilSDTIKAKHEQMQKELERVRDLAEGWFALSEEERNRLRAEIGK
Ga0307479_10009204133300031962Hardwood Forest SoilKHAEMQKELERVRDIAEGWFALSESERESYRAAIGS
Ga0307479_1054035113300031962Hardwood Forest SoilMIEAKHEEMQKELERVRDLAEGWFSFTDTEREKYRAEFGW
Ga0318540_1013385023300032094SoilHEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP
Ga0307470_1096905123300032174Hardwood Forest SoilMEAKHVEMQRELERVRDIAESWFSLSEAERAQHRAEFSR
Ga0307471_10124221413300032180Hardwood Forest SoilMIEAKHQEMQKELERVRDIAESWFSFTDEQMEKYRAEFGA
Ga0335080_1143830413300032828SoilMIKLKHEEMQKELERVRDIAEGWFSLSEEERNRYREQIGP
Ga0335081_1192807723300032892SoilKHAEMQRELERVRDIAEGWFALREEEREKYRAEFSKP
Ga0335069_1110577823300032893SoilHAEMQKALERVRDIAEAWFSLTEEARNAHRAEFSK
Ga0335084_1174188023300033004SoilKAKHQEMQRELERVRDLAEGWFSMSEEEKNRHRKEIGP
Ga0310914_1119412513300033289SoilEMIRAKHEEMQKALEHVRDLTEGWFHLTEEERNRHRAEIGP
Ga0310914_1139865313300033289SoilAKHEEMQKALEQVRDLTEGWFQLTEQERNRHRAEIGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.