| Basic Information | |
|---|---|
| Family ID | F070449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 38 residues |
| Representative Sequence | EAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.46 % |
| % of genes near scaffold ends (potentially truncated) | 95.12 % |
| % of genes from short scaffolds (< 2000 bps) | 85.37 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.829 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.220 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13180 | PDZ_2 | 43.90 |
| PF13365 | Trypsin_2 | 31.71 |
| PF02882 | THF_DHG_CYH_C | 2.44 |
| PF00144 | Beta-lactamase | 1.63 |
| PF04028 | DUF374 | 1.63 |
| PF01182 | Glucosamine_iso | 0.81 |
| PF00291 | PALP | 0.81 |
| PF07883 | Cupin_2 | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF10282 | Lactonase | 0.81 |
| PF14534 | DUF4440 | 0.81 |
| PF00809 | Pterin_bind | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| PF13586 | DDE_Tnp_1_2 | 0.81 |
| PF00174 | Oxidored_molyb | 0.81 |
| PF13474 | SnoaL_3 | 0.81 |
| PF01121 | CoaE | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF10861 | DUF2784 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 2.44 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 2.44 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.63 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 1.63 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.63 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.81 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.37 % |
| Unclassified | root | N/A | 1.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17002675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1810 | Open in IMG/M |
| 3300000567|JGI12270J11330_10122138 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100253811 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300005180|Ga0066685_10017568 | All Organisms → cellular organisms → Bacteria | 4213 | Open in IMG/M |
| 3300005363|Ga0008090_10157662 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300005555|Ga0066692_10599032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005556|Ga0066707_10834214 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005568|Ga0066703_10091297 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300005598|Ga0066706_10021237 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
| 3300005764|Ga0066903_104673190 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005843|Ga0068860_102836146 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006034|Ga0066656_10328286 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006057|Ga0075026_100306637 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006162|Ga0075030_100177321 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300006162|Ga0075030_100243428 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300006173|Ga0070716_101792554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300006176|Ga0070765_100432409 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300006804|Ga0079221_10306934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300006804|Ga0079221_11331998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300006954|Ga0079219_10028510 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300007258|Ga0099793_10686166 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009088|Ga0099830_11661589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300009089|Ga0099828_10080960 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300009090|Ga0099827_10951035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 745 | Open in IMG/M |
| 3300009525|Ga0116220_10111506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300010046|Ga0126384_11380526 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010159|Ga0099796_10294861 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010341|Ga0074045_10118568 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300010358|Ga0126370_10197277 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300010358|Ga0126370_12077666 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300010360|Ga0126372_11857529 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010360|Ga0126372_12785352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010366|Ga0126379_10753225 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300010366|Ga0126379_12609313 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300011269|Ga0137392_11641695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300011270|Ga0137391_11508957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012189|Ga0137388_11849894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300012202|Ga0137363_10624795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300012203|Ga0137399_10730588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300012205|Ga0137362_11737818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012363|Ga0137390_11489506 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012683|Ga0137398_10220547 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300012922|Ga0137394_11499714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012924|Ga0137413_10793030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300012925|Ga0137419_10315687 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300012929|Ga0137404_12086262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012948|Ga0126375_11537854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300013308|Ga0157375_11116316 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300014157|Ga0134078_10523567 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014157|Ga0134078_10592484 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300014495|Ga0182015_10659164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 661 | Open in IMG/M |
| 3300015054|Ga0137420_1395554 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300015241|Ga0137418_10309932 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300015241|Ga0137418_11171206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300015242|Ga0137412_10050946 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| 3300016270|Ga0182036_11199294 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300016341|Ga0182035_11890155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300016404|Ga0182037_11317124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300016422|Ga0182039_11587449 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017932|Ga0187814_10454114 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300017933|Ga0187801_10000244 | All Organisms → cellular organisms → Bacteria | 13576 | Open in IMG/M |
| 3300017943|Ga0187819_10420492 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018006|Ga0187804_10015304 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300018026|Ga0187857_10543694 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018062|Ga0187784_10197337 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300018090|Ga0187770_10602335 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300019275|Ga0187798_1193078 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300019788|Ga0182028_1538767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2384 | Open in IMG/M |
| 3300020580|Ga0210403_10652347 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300020580|Ga0210403_10774500 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300020580|Ga0210403_11047417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300021168|Ga0210406_10416318 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300021171|Ga0210405_10204404 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300021180|Ga0210396_10008832 | All Organisms → cellular organisms → Bacteria | 9547 | Open in IMG/M |
| 3300021181|Ga0210388_10046325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3617 | Open in IMG/M |
| 3300021401|Ga0210393_10559664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300021401|Ga0210393_11396460 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021405|Ga0210387_10460781 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300021407|Ga0210383_10011008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7685 | Open in IMG/M |
| 3300021432|Ga0210384_10306615 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300021477|Ga0210398_10415115 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300021559|Ga0210409_10723289 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300022726|Ga0242654_10128455 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300024290|Ga0247667_1014677 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300024347|Ga0179591_1242456 | All Organisms → cellular organisms → Bacteria | 3123 | Open in IMG/M |
| 3300025922|Ga0207646_10475854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 1126 | Open in IMG/M |
| 3300025939|Ga0207665_11172089 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026529|Ga0209806_1124649 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300026551|Ga0209648_10029571 | All Organisms → cellular organisms → Bacteria | 4788 | Open in IMG/M |
| 3300026555|Ga0179593_1183572 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300027042|Ga0207766_1005955 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300027645|Ga0209117_1112295 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300027773|Ga0209810_1041648 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300027846|Ga0209180_10210452 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300027857|Ga0209166_10617978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300028293|Ga0247662_1038423 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300028747|Ga0302219_10003562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6092 | Open in IMG/M |
| 3300029636|Ga0222749_10457024 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031057|Ga0170834_106697890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300031170|Ga0307498_10482055 | Not Available | 504 | Open in IMG/M |
| 3300031545|Ga0318541_10638162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300031573|Ga0310915_10028869 | All Organisms → cellular organisms → Bacteria | 3444 | Open in IMG/M |
| 3300031681|Ga0318572_10961444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300031708|Ga0310686_107256980 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031720|Ga0307469_10175087 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300031740|Ga0307468_100641758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300031744|Ga0306918_11126810 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031754|Ga0307475_11308119 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300031770|Ga0318521_10128163 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300031797|Ga0318550_10462626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300031897|Ga0318520_10670423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300031962|Ga0307479_10009204 | All Organisms → cellular organisms → Bacteria | 9157 | Open in IMG/M |
| 3300031962|Ga0307479_10540351 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300032094|Ga0318540_10133850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1182 | Open in IMG/M |
| 3300032174|Ga0307470_10969051 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032180|Ga0307471_101242214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300032828|Ga0335080_11438304 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300032892|Ga0335081_11928077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300032893|Ga0335069_11105778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300033004|Ga0335084_11741880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300033289|Ga0310914_11194125 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300033289|Ga0310914_11398653 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00621660 | 2088090014 | Soil | MEVKHHEMQKELERVRDIAEAWFTLPESDRNRYRAEFGS |
| JGI12270J11330_101221383 | 3300000567 | Peatlands Soil | EEMQKALERVRDIAENWYTMSEDERNRYRAELGP* |
| JGIcombinedJ26739_1002538111 | 3300002245 | Forest Soil | VLEAKHAQMQRELERLRDIAESWFSLDEKARTRYRDEFGRLAPK* |
| Ga0066685_100175685 | 3300005180 | Soil | MEAKHAEMQRALERVRHIAEGWFLLSPDARDKHRAEFNR* |
| Ga0008090_101576622 | 3300005363 | Tropical Rainforest Soil | IRAKHEEMQKALEHVRDLTEGWFQLTEQERNRHRAEIGP* |
| Ga0066692_105990322 | 3300005555 | Soil | HAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ* |
| Ga0066707_108342142 | 3300005556 | Soil | EAKHAEMQRELERVRDLAESWFSLSQEARARHQAQFDR* |
| Ga0066703_100912973 | 3300005568 | Soil | AEMQHELERVRDLAEGWFSLSDSERDKIRADFNR* |
| Ga0066706_100212371 | 3300005598 | Soil | AEMQRELERVRDIAESWFWLGEEARAKHRAEFNH* |
| Ga0066903_1046731902 | 3300005764 | Tropical Forest Soil | NEMQKELERVRDIAEGWFALAESERNRYRAEFGL* |
| Ga0068860_1028361461 | 3300005843 | Switchgrass Rhizosphere | SKHQEMQKELERVRDIAEGWFALPESERNRYRAEFGK* |
| Ga0066656_103282861 | 3300006034 | Soil | DASAEVMEAKHTEMQRELERVRDIAEGWYLLSPDAREKHRAEFSR* |
| Ga0075026_1003066371 | 3300006057 | Watersheds | TNASQETVQAKHLEMQRALEHVRDLAEGWFAMTEEQRQRLRVEIGP* |
| Ga0075030_1001773211 | 3300006162 | Watersheds | ERKHAEMQKILEQVRYVAEEWFSLTEEERERKRAVWDA* |
| Ga0075030_1002434283 | 3300006162 | Watersheds | AKHEEMQQELERVRDLAESWFSLTEDQRSRYRTEFGP* |
| Ga0070716_1017925542 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KHAEMQKELERVRDIAEGWFALSESERDRYRAAIGR* |
| Ga0070765_1004324091 | 3300006176 | Soil | HAEMQRELERVRDIGESWFTLTDSQRNSHRTEFNQ* |
| Ga0079221_103069341 | 3300006804 | Agricultural Soil | LLEAKHQEMQRELERVRDIAESWFSLSESDRQNFRAEFSK* |
| Ga0079221_113319982 | 3300006804 | Agricultural Soil | HAEMQRELERVRDIAEGWFLLSPDARDKHRAEFNR* |
| Ga0079219_100285101 | 3300006954 | Agricultural Soil | AKHAEMQRELERVRDIAEGWFLLSPDARDKHRAEFNR* |
| Ga0099793_106861662 | 3300007258 | Vadose Zone Soil | ELERVRDIAESWFSLSDEARAEHRAEFSRSNPQT* |
| Ga0099830_116615892 | 3300009088 | Vadose Zone Soil | KHAEMQRELERVRDIAEGWFSLSEAEREKYRAKFQS* |
| Ga0099828_100809604 | 3300009089 | Vadose Zone Soil | AEMQRELERVRDIAEGWFALSDAERERNRSEFGK* |
| Ga0099827_109510351 | 3300009090 | Vadose Zone Soil | AEMQRELERVRDIAESWFLLSEAEREKYRAEFSA* |
| Ga0116220_101115061 | 3300009525 | Peatlands Soil | PEMIKARHEEMQKALERVRDIAEGWFAMSEDERNRYRAEFGP* |
| Ga0126384_113805261 | 3300010046 | Tropical Forest Soil | HAEMQKALERVRDIAEGWFSLSEDQRNRWRAEIGP* |
| Ga0099796_102948611 | 3300010159 | Vadose Zone Soil | GKHAEMQRELERVRDIAEAWFSLSDSDREKYRAEFARRP* |
| Ga0074045_101185683 | 3300010341 | Bog Forest Soil | AKHEEMQKALERVRDIAEGWFTMSEGERNRYRAEFGP* |
| Ga0126370_101972773 | 3300010358 | Tropical Forest Soil | EMQRELERVRDIAESWFGLSESGRQKHRSEFSTRAQQ* |
| Ga0126370_120776662 | 3300010358 | Tropical Forest Soil | MEQKHAEMQRELERVRDIAEGWYLLSPDAREKHRAEFNS* |
| Ga0126372_118575291 | 3300010360 | Tropical Forest Soil | AEMQKELERVRDIAEAWFSASEDERGRHRAEFGK* |
| Ga0126372_127853521 | 3300010360 | Tropical Forest Soil | AEMQRELERVRDIAEGWFLLSEDARAKHRAEFNRQ* |
| Ga0126379_107532251 | 3300010366 | Tropical Forest Soil | AEMQRELERVRDIAEGWYLLGPDAREKHRAQFNRS* |
| Ga0126379_126093132 | 3300010366 | Tropical Forest Soil | EKHAEMQRELERVRDIAEGWYLLSPDAREKHRAEFNS* |
| Ga0137392_116416951 | 3300011269 | Vadose Zone Soil | QLEAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN* |
| Ga0137391_115089572 | 3300011270 | Vadose Zone Soil | EAKHAEMQRELGRVRDIAEGWFSLSEAEREKYRAEFGN* |
| Ga0137388_118498941 | 3300012189 | Vadose Zone Soil | NAVVMETKHEEMQLELERVRDIAEGWFLLTEEARAKYRLEFNRSSSRV* |
| Ga0137363_106247951 | 3300012202 | Vadose Zone Soil | KHEEMQQELERVRDIAEGWFLLTEEARAKYRLEFNRSSSRV* |
| Ga0137399_107305882 | 3300012203 | Vadose Zone Soil | EMQRELERVRDIAESWFSLSDEERTKHRAEFNRSNP* |
| Ga0137362_117378181 | 3300012205 | Vadose Zone Soil | HAEMQRELERVRDIAEVWFALSDSERARHRSEFNQ* |
| Ga0137390_114895062 | 3300012363 | Vadose Zone Soil | ADATLLEAKHAEMQRELERVRDIAEGWFCLGDEERNLHRQAIGK* |
| Ga0137398_102205472 | 3300012683 | Vadose Zone Soil | VIEAKHAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ* |
| Ga0137398_104898172 | 3300012683 | Vadose Zone Soil | ADANQEMLEAKHAAMQRGLERVRDIAEAWFSLSDSDREKYRAEFARRP* |
| Ga0137394_114997142 | 3300012922 | Vadose Zone Soil | AEMQRELERVRDIAEGWFSLREEDRGKLRAQFNL* |
| Ga0137413_107930302 | 3300012924 | Vadose Zone Soil | EAKHAEMQRELERVRDIAEGWFSLNEEARAQHRAAFKQ* |
| Ga0137419_103156871 | 3300012925 | Vadose Zone Soil | EMQKELERVRDIAEGWFGLSEAERDAHRLAIRRR* |
| Ga0137404_120862621 | 3300012929 | Vadose Zone Soil | ADAEVMEAKHGEMQRELERVRDIAEGWFALSEDERGKLRAQFNS* |
| Ga0126375_115378541 | 3300012948 | Tropical Forest Soil | MAAEMQRELERVRDIAEGWFLLSEQARASHRGAFNT* |
| Ga0157375_111163161 | 3300013308 | Miscanthus Rhizosphere | HNEMQKELERVRDIAEGWFALPESERNRYRAEFGS* |
| Ga0134078_105235672 | 3300014157 | Grasslands Soil | AKHAEMQKELERVRDVAEDWFSLSKAERERFRKKIGK* |
| Ga0134078_105924842 | 3300014157 | Grasslands Soil | AEVMEAKHTEMQRELERVRDIAEGWYLLSPDAREKHRAEFSR* |
| Ga0182015_106591641 | 3300014495 | Palsa | AEMQHVLERVRDLAEGWFQMTEAQRNALRAEFNGT* |
| Ga0137420_13955541 | 3300015054 | Vadose Zone Soil | MQRELERVRDIAEGWFSLSDSDREKYRTEFGVQTVK* |
| Ga0137418_103099321 | 3300015241 | Vadose Zone Soil | GADATVLEAKHAEMQRELERVRDIAEGWFGLSESERNAHRAAIGA* |
| Ga0137418_111712062 | 3300015241 | Vadose Zone Soil | ELERVRDIAESWFSVGDAEREKHRAEFSRSNPQA* |
| Ga0137412_100509464 | 3300015242 | Vadose Zone Soil | MEAKHADMQRELERVRDIAEGWFSLNEGARAQHRAAFQQ* |
| Ga0182036_111992941 | 3300016270 | Soil | KHQEMQKELERVRDIAEAWFALAETERDRYRAEFGK |
| Ga0182035_118901551 | 3300016341 | Soil | KHEEMQKALENVRDLTEGWFTLTEEERNRHRTEIGP |
| Ga0182037_113171242 | 3300016404 | Soil | LIKAKHQEMQKELERVRDLAESWFAMSEEQRNRLRAEIGQ |
| Ga0182039_115874491 | 3300016422 | Soil | HAEMQRELERGRDIAERWFLMSGDTREKLRAEFNR |
| Ga0187814_104541141 | 3300017932 | Freshwater Sediment | HEEMQKALERVRDITEGWFGLTEDERNRYRAEIGP |
| Ga0187801_100002441 | 3300017933 | Freshwater Sediment | IKAKHEEMQKTLERVRDIAEAWFSFTEEERDRYRVEIGP |
| Ga0187819_104204921 | 3300017943 | Freshwater Sediment | MVKAKHAEMQKELERVRDIAEGWFSFTEDERNRYRAEIGP |
| Ga0187804_100153041 | 3300018006 | Freshwater Sediment | AKHAEMQRELERVRDIAEGWFSLSEEERKNHRADFGQ |
| Ga0187857_105436941 | 3300018026 | Peatland | PKQLEAKHAEMQRELERVRDIAESWFDLADADRDLHRAAFNL |
| Ga0187784_101973372 | 3300018062 | Tropical Peatland | MIKAKHEEMQKALERVRDITEGWFSLTEEERNRYRGEIGP |
| Ga0187770_106023351 | 3300018090 | Tropical Peatland | EMIKAKHEEMQKALERVRDIAEGWFTMSEDERNRYRAEFGP |
| Ga0187798_11930781 | 3300019275 | Peatland | AKHEEMQKALERVRDIAEGWFTMSEDERNRYRAEFGP |
| Ga0182028_15387672 | 3300019788 | Fen | MIKAKHEEMQKALERVRDIAEGWYAMSEDERNRYRAEFGP |
| Ga0210403_106523471 | 3300020580 | Soil | ETKHQEMQKELERVRDIAEGWFSFTDEEREEYRVEFGR |
| Ga0210403_107745001 | 3300020580 | Soil | AVMIDTKHQEMQKELERVRDIAEGWFSFTEAEREKYRAEFGM |
| Ga0210403_110474172 | 3300020580 | Soil | KHAEMQSELERVRDIAESWFSLSEADRQKHRAEFAR |
| Ga0210406_104163181 | 3300021168 | Soil | KHAEMQRELERVRDIAESWFSLPEAEREKQRAEFGVTSS |
| Ga0210405_102044041 | 3300021171 | Soil | KQAEMQRELERVRDIAESWFSMSDKERDLYRAEFDL |
| Ga0210396_1000883210 | 3300021180 | Soil | ETKHQEMQKELERVRDIAEGWFSFSEEEKEKYRTEFGW |
| Ga0210388_100463254 | 3300021181 | Soil | QAKHQEMQKALERVRDITEGWFALSEEERNRYRAEIGP |
| Ga0210393_105596641 | 3300021401 | Soil | HAEMQHELERVRDIAESWFSLSASDRQKLRAEFSI |
| Ga0210393_113964601 | 3300021401 | Soil | GMIEAKQAEMQRELERVRDVAEAWFSLSEAERARHRKEFNR |
| Ga0210387_104607812 | 3300021405 | Soil | KHAEMQRALEHVRDLAEGWFSFSEEERQRIRAEIGP |
| Ga0210383_100110089 | 3300021407 | Soil | TKHQEMQKELERVRDIAEGWFSFSEEEKEKYRTEFGE |
| Ga0210384_103066151 | 3300021432 | Soil | DANADGMEAKQAEMQRELERVRDIAEEWFALGEEERAKYRVRFNS |
| Ga0210398_104151151 | 3300021477 | Soil | AKHQEMQKELERVRDIAEGWFSCTDDEREKYRAEFGW |
| Ga0210409_107232891 | 3300021559 | Soil | EAKHAEMQRELERVRDIAESWFSLSDADRATHRAQFSG |
| Ga0242654_101284552 | 3300022726 | Soil | DMIRAKHEEMQKALECVRDIAEGWFSLSEEERNRLRAEIGP |
| Ga0247667_10146773 | 3300024290 | Soil | RHAEMQSELERVRDIAESWFSLSETDRQNFRAEFSK |
| Ga0179591_12424566 | 3300024347 | Vadose Zone Soil | MQRELERVRDIAEAWFTLSDSDREKYRAEFGVSSKQ |
| Ga0207646_104758541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KHAEMQAGLERVRDIAESWFVLRPEERERYRAEYNS |
| Ga0207665_111720891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QRELGRVRDIAESWFSLGEEQRAVYRAQFGRGAGT |
| Ga0209806_11246491 | 3300026529 | Soil | HAEMQRELERVRDIAESWFSLSEIEHQRYREEFGS |
| Ga0209648_100295711 | 3300026551 | Grasslands Soil | DQGMLEAKHAEMQREFERVRDIAENWFSLSGAEREKHRKEFTR |
| Ga0179593_11835722 | 3300026555 | Vadose Zone Soil | HQEMQKELERVRDLAEGWFSFTDAEREKYRAEFEK |
| Ga0207766_10059551 | 3300027042 | Tropical Forest Soil | RAKHEEMQKALENVRDLTEGWFKLTEEERNRHRAEIGP |
| Ga0209117_11122952 | 3300027645 | Forest Soil | LLEAKHAEMQKELERVRDIAEGWFGLSEAERDARRLAIGR |
| Ga0209810_10416481 | 3300027773 | Surface Soil | PNADSALMKEKHLRMQKELERVRDIAENWFTMSEAERGRYRAEFGK |
| Ga0209180_102104522 | 3300027846 | Vadose Zone Soil | AKHAEMQRKLERVRDIAESWYSLSEAEREKHRAEFDQ |
| Ga0209166_106179782 | 3300027857 | Surface Soil | AMIETKHQEMQKELERVRDIAEGWFSFTDEQRQKYRAEFGQ |
| Ga0247662_10384231 | 3300028293 | Soil | KAKHNEMQKELERVRDIAEGWFGLPESDRNRYRAEFGK |
| Ga0302219_100035629 | 3300028747 | Palsa | SMEAKHAEMQRELERVRDLAEGWYSLSESDREKHRAQFAI |
| Ga0222749_104570242 | 3300029636 | Soil | DAAMIETKHQEMQKELERVRDIAEGWYSFTDGEREKYRAEFGW |
| Ga0170834_1066978902 | 3300031057 | Forest Soil | LESKHAEMQSALERVRDIAESWYSLKESDRETFRAEFSK |
| Ga0307498_104820551 | 3300031170 | Soil | VLEAKHAEMQKELERVRDIAEGWFGFGEEARDAYRSEFGK |
| Ga0318541_106381621 | 3300031545 | Soil | IKVKHEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP |
| Ga0310915_100288694 | 3300031573 | Soil | DMIKVKHEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP |
| Ga0318572_109614442 | 3300031681 | Soil | DLEMIRAKHEEMQKALEHVRDLTEGWFKLTEEERNCHRAEIGP |
| Ga0310686_1072569802 | 3300031708 | Soil | AMEAKHAEMQRELERVRDLAEGWFAMSDSEREQHRAAFAM |
| Ga0307469_101750871 | 3300031720 | Hardwood Forest Soil | HQEMQKELERVRDIAEGWFALPESERNRYRAEFGK |
| Ga0307468_1006417582 | 3300031740 | Hardwood Forest Soil | EAKHADVQRELERVRDIAEGWFALSEEEREKLRAQFNS |
| Ga0306918_111268101 | 3300031744 | Soil | GMEAKHNQMQKELERVRDIAEAWFTLPESERDRYRAEFGK |
| Ga0307475_113081192 | 3300031754 | Hardwood Forest Soil | HEEMQKALERVRDLAEGWFQLTEDERNRHRAEIGP |
| Ga0318521_101281631 | 3300031770 | Soil | SEMIRAKHEEMQKALEHVRDLTEGWFQLTEQERNRHRAEIGP |
| Ga0318550_104626262 | 3300031797 | Soil | HNEMQKELERVRDIAEGWFALPESERDRYRAEFGP |
| Ga0318520_106704231 | 3300031897 | Soil | SDTIKAKHEQMQKELERVRDLAEGWFALSEEERNRLRAEIGK |
| Ga0307479_1000920413 | 3300031962 | Hardwood Forest Soil | KHAEMQKELERVRDIAEGWFALSESERESYRAAIGS |
| Ga0307479_105403511 | 3300031962 | Hardwood Forest Soil | MIEAKHEEMQKELERVRDLAEGWFSFTDTEREKYRAEFGW |
| Ga0318540_101338502 | 3300032094 | Soil | HEEMQKTLERVRDIAEGWFSLNEAERNRYRVEIGP |
| Ga0307470_109690512 | 3300032174 | Hardwood Forest Soil | MEAKHVEMQRELERVRDIAESWFSLSEAERAQHRAEFSR |
| Ga0307471_1012422141 | 3300032180 | Hardwood Forest Soil | MIEAKHQEMQKELERVRDIAESWFSFTDEQMEKYRAEFGA |
| Ga0335080_114383041 | 3300032828 | Soil | MIKLKHEEMQKELERVRDIAEGWFSLSEEERNRYREQIGP |
| Ga0335081_119280772 | 3300032892 | Soil | KHAEMQRELERVRDIAEGWFALREEEREKYRAEFSKP |
| Ga0335069_111057782 | 3300032893 | Soil | HAEMQKALERVRDIAEAWFSLTEEARNAHRAEFSK |
| Ga0335084_117418802 | 3300033004 | Soil | KAKHQEMQRELERVRDLAEGWFSMSEEEKNRHRKEIGP |
| Ga0310914_111941251 | 3300033289 | Soil | EMIRAKHEEMQKALEHVRDLTEGWFHLTEEERNRHRAEIGP |
| Ga0310914_113986531 | 3300033289 | Soil | AKHEEMQKALEQVRDLTEGWFQLTEQERNRHRAEIGP |
| ⦗Top⦘ |