| Basic Information | |
|---|---|
| Family ID | F070436 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.40 % |
| % of genes near scaffold ends (potentially truncated) | 23.58 % |
| % of genes from short scaffolds (< 2000 bps) | 75.61 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.049 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.984 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF06904 | Extensin-like_C | 16.26 |
| PF04317 | DUF463 | 5.69 |
| PF00355 | Rieske | 4.07 |
| PF03401 | TctC | 1.63 |
| PF13458 | Peripla_BP_6 | 1.63 |
| PF04392 | ABC_sub_bind | 1.63 |
| PF00400 | WD40 | 1.63 |
| PF07690 | MFS_1 | 1.63 |
| PF00216 | Bac_DNA_binding | 0.81 |
| PF13193 | AMP-binding_C | 0.81 |
| PF00165 | HTH_AraC | 0.81 |
| PF00291 | PALP | 0.81 |
| PF13505 | OMP_b-brl | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF12704 | MacB_PCD | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF13229 | Beta_helix | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF04442 | CtaG_Cox11 | 0.81 |
| PF00005 | ABC_tran | 0.81 |
| PF01471 | PG_binding_1 | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF07045 | DUF1330 | 0.81 |
| PF02900 | LigB | 0.81 |
| PF00501 | AMP-binding | 0.81 |
| PF13191 | AAA_16 | 0.81 |
| PF00072 | Response_reg | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG3921 | Uncharacterized conserved protein, contains Extensin-like_C domain | Function unknown [S] | 16.26 |
| COG3106 | Ras-like GTP-binding stress-induced protein YcjX, DUF463 family | Signal transduction mechanisms [T] | 5.69 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.63 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.63 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.81 |
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.05 % |
| Unclassified | root | N/A | 21.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10079608 | Not Available | 1558 | Open in IMG/M |
| 3300000567|JGI12270J11330_10109801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1165 | Open in IMG/M |
| 3300001619|JGI20250J16331_100459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1514 | Open in IMG/M |
| 3300005538|Ga0070731_10154011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1525 | Open in IMG/M |
| 3300005538|Ga0070731_10333382 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005538|Ga0070731_10422553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 887 | Open in IMG/M |
| 3300005591|Ga0070761_10030712 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
| 3300005591|Ga0070761_10061076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2129 | Open in IMG/M |
| 3300005602|Ga0070762_10501607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 796 | Open in IMG/M |
| 3300005610|Ga0070763_10007190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4418 | Open in IMG/M |
| 3300005610|Ga0070763_10383230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 788 | Open in IMG/M |
| 3300005610|Ga0070763_10561163 | Not Available | 659 | Open in IMG/M |
| 3300005712|Ga0070764_10146676 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005921|Ga0070766_10119909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1580 | Open in IMG/M |
| 3300005921|Ga0070766_10253911 | Not Available | 1116 | Open in IMG/M |
| 3300005921|Ga0070766_10481173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
| 3300006028|Ga0070717_11127469 | Not Available | 714 | Open in IMG/M |
| 3300006050|Ga0075028_100032016 | Not Available | 2417 | Open in IMG/M |
| 3300006174|Ga0075014_100319413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300006176|Ga0070765_100369981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1334 | Open in IMG/M |
| 3300006176|Ga0070765_100814409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300006176|Ga0070765_101658256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300006176|Ga0070765_101881300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300006893|Ga0073928_10030288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5221 | Open in IMG/M |
| 3300009519|Ga0116108_1018077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 2462 | Open in IMG/M |
| 3300009519|Ga0116108_1072433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1064 | Open in IMG/M |
| 3300009521|Ga0116222_1390533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
| 3300009523|Ga0116221_1486250 | Not Available | 540 | Open in IMG/M |
| 3300009524|Ga0116225_1121900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1199 | Open in IMG/M |
| 3300009636|Ga0116112_1236816 | Not Available | 503 | Open in IMG/M |
| 3300010343|Ga0074044_10299138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1058 | Open in IMG/M |
| 3300010379|Ga0136449_103953145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
| 3300010379|Ga0136449_104291553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
| 3300010880|Ga0126350_12104250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300011120|Ga0150983_11938846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 575 | Open in IMG/M |
| 3300011120|Ga0150983_16077504 | Not Available | 554 | Open in IMG/M |
| 3300012004|Ga0120134_1117978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 503 | Open in IMG/M |
| 3300014156|Ga0181518_10016507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5292 | Open in IMG/M |
| 3300014158|Ga0181521_10140302 | Not Available | 1405 | Open in IMG/M |
| 3300014159|Ga0181530_10004200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15476 | Open in IMG/M |
| 3300014164|Ga0181532_10072979 | Not Available | 2194 | Open in IMG/M |
| 3300014164|Ga0181532_10099635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300014165|Ga0181523_10007189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8703 | Open in IMG/M |
| 3300014165|Ga0181523_10012442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 6019 | Open in IMG/M |
| 3300014200|Ga0181526_10349606 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300014489|Ga0182018_10055459 | Not Available | 2410 | Open in IMG/M |
| 3300014489|Ga0182018_10453659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 681 | Open in IMG/M |
| 3300014501|Ga0182024_10168746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3042 | Open in IMG/M |
| 3300015089|Ga0167643_1003775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2030 | Open in IMG/M |
| 3300016702|Ga0181511_1122367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1320 | Open in IMG/M |
| 3300017938|Ga0187854_10254567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 760 | Open in IMG/M |
| 3300017940|Ga0187853_10143292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300017946|Ga0187879_10038555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2857 | Open in IMG/M |
| 3300019786|Ga0182025_1265120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1737 | Open in IMG/M |
| 3300019881|Ga0193707_1027795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1856 | Open in IMG/M |
| 3300019888|Ga0193751_1082650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1279 | Open in IMG/M |
| 3300020021|Ga0193726_1000013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626205 | Open in IMG/M |
| 3300020579|Ga0210407_10664723 | Not Available | 809 | Open in IMG/M |
| 3300020579|Ga0210407_10789427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300020579|Ga0210407_11411952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 516 | Open in IMG/M |
| 3300020580|Ga0210403_11095378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 619 | Open in IMG/M |
| 3300020582|Ga0210395_10002854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13365 | Open in IMG/M |
| 3300020583|Ga0210401_10147281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2202 | Open in IMG/M |
| 3300020583|Ga0210401_10540789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 64-17 | 1027 | Open in IMG/M |
| 3300021088|Ga0210404_10078087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1624 | Open in IMG/M |
| 3300021170|Ga0210400_10873936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 735 | Open in IMG/M |
| 3300021171|Ga0210405_10208931 | Not Available | 1547 | Open in IMG/M |
| 3300021171|Ga0210405_10228251 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300021171|Ga0210405_10879593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 682 | Open in IMG/M |
| 3300021178|Ga0210408_10146914 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300021401|Ga0210393_10113870 | Not Available | 2159 | Open in IMG/M |
| 3300021403|Ga0210397_10752550 | Not Available | 751 | Open in IMG/M |
| 3300021407|Ga0210383_10078384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2765 | Open in IMG/M |
| 3300021407|Ga0210383_10203483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1694 | Open in IMG/M |
| 3300021407|Ga0210383_11005627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 707 | Open in IMG/M |
| 3300021420|Ga0210394_10016520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6975 | Open in IMG/M |
| 3300021420|Ga0210394_10208871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1703 | Open in IMG/M |
| 3300021420|Ga0210394_11585362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 551 | Open in IMG/M |
| 3300021420|Ga0210394_11778780 | Not Available | 514 | Open in IMG/M |
| 3300021432|Ga0210384_10824948 | Not Available | 826 | Open in IMG/M |
| 3300021474|Ga0210390_10427444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
| 3300021475|Ga0210392_10089590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2000 | Open in IMG/M |
| 3300021477|Ga0210398_10000684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 37843 | Open in IMG/M |
| 3300021478|Ga0210402_11264496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 665 | Open in IMG/M |
| 3300021478|Ga0210402_11508426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 599 | Open in IMG/M |
| 3300021479|Ga0210410_11359173 | Not Available | 603 | Open in IMG/M |
| 3300021559|Ga0210409_10427698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1183 | Open in IMG/M |
| 3300022523|Ga0242663_1103092 | Not Available | 571 | Open in IMG/M |
| 3300022709|Ga0222756_1088010 | Not Available | 516 | Open in IMG/M |
| 3300023672|Ga0247553_103978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 738 | Open in IMG/M |
| 3300024271|Ga0224564_1096497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300025320|Ga0209171_10355901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 763 | Open in IMG/M |
| 3300027090|Ga0208604_1025556 | Not Available | 557 | Open in IMG/M |
| 3300027334|Ga0209529_1011384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1474 | Open in IMG/M |
| 3300027439|Ga0209332_1006515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2396 | Open in IMG/M |
| 3300027567|Ga0209115_1014863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1690 | Open in IMG/M |
| 3300027660|Ga0209736_1103922 | Not Available | 771 | Open in IMG/M |
| 3300027678|Ga0209011_1024498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1945 | Open in IMG/M |
| 3300027854|Ga0209517_10008773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11750 | Open in IMG/M |
| 3300027855|Ga0209693_10131436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1238 | Open in IMG/M |
| 3300027869|Ga0209579_10016328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4293 | Open in IMG/M |
| 3300027869|Ga0209579_10464409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 687 | Open in IMG/M |
| 3300027879|Ga0209169_10059668 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300027889|Ga0209380_10016638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4187 | Open in IMG/M |
| 3300027908|Ga0209006_10691377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 836 | Open in IMG/M |
| 3300027910|Ga0209583_10261632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 768 | Open in IMG/M |
| 3300028047|Ga0209526_10034334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3570 | Open in IMG/M |
| 3300028906|Ga0308309_10612084 | Not Available | 945 | Open in IMG/M |
| 3300030659|Ga0316363_10435800 | Not Available | 505 | Open in IMG/M |
| 3300030763|Ga0265763_1000147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3546 | Open in IMG/M |
| 3300030814|Ga0265741_121795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
| 3300031090|Ga0265760_10168643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 726 | Open in IMG/M |
| 3300031231|Ga0170824_116162029 | Not Available | 685 | Open in IMG/M |
| 3300031708|Ga0310686_111061049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300031715|Ga0307476_10000879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20290 | Open in IMG/M |
| 3300032120|Ga0316053_115437 | Not Available | 568 | Open in IMG/M |
| 3300032120|Ga0316053_120772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300032160|Ga0311301_10458580 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300032160|Ga0311301_10474858 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300032160|Ga0311301_12348941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
| 3300032515|Ga0348332_12148300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
| 3300032756|Ga0315742_12401039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300032892|Ga0335081_11007796 | Not Available | 970 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 14.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.06% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.63% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001619 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100796083 | 3300000567 | Peatlands Soil | MHDWHDWMLIAAPLAAVLYFLAFQDQFRELLSWVSTLVN* |
| JGI12270J11330_101098012 | 3300000567 | Peatlands Soil | VHRSSTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| JGI20250J16331_1004592 | 3300001619 | Forest Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWISALVN* |
| Ga0070731_101540112 | 3300005538 | Surface Soil | MQDWMLIAAPLALTVYFLAFQDQFRMVLSWLSMLVN* |
| Ga0070731_103333822 | 3300005538 | Surface Soil | MQDWMLITAPLALTLYFLAFQDQFRALLSWLSALVN* |
| Ga0070731_104225532 | 3300005538 | Surface Soil | MQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN* |
| Ga0070761_100307121 | 3300005591 | Soil | SKGDLCWAALMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0070761_100610761 | 3300005591 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLAWLSALVN* |
| Ga0070762_105016072 | 3300005602 | Soil | MQDWMLISAPLALTLYFLAFQDQFRMLLSWLSALVN* |
| Ga0070763_100071902 | 3300005610 | Soil | LAHRAGEGDFCWATLMQDWMLITAPLALTLYFLAFQDQFRAVLAWLSALVN* |
| Ga0070763_103832302 | 3300005610 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLGALVN* |
| Ga0070763_105611632 | 3300005610 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0070764_101466762 | 3300005712 | Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWLSALVN* |
| Ga0070766_101199092 | 3300005921 | Soil | MQDWMLISAPLALTVYFLAFQDQFRTLLSWLTALID* |
| Ga0070766_102539113 | 3300005921 | Soil | MQDWMLITAPLAISVYFLAFQDQFRALLSWLGTLVN* |
| Ga0070766_104811732 | 3300005921 | Soil | SEGDLCWAGLMQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN* |
| Ga0070717_111274691 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGDLCWATLVQDWMLISAPLALTLYFLAFQDQFRAVLSWLTALVN* |
| Ga0075028_1000320165 | 3300006050 | Watersheds | LCRVTPMHDWVLITAPLAAVLYFLAFHDQFRELLSWVNALVN* |
| Ga0075014_1003194132 | 3300006174 | Watersheds | VQDTAKCDLCRVTPMQDWVLITAPLAAVVYFLAFQDQFRELLSWVSTLVN* |
| Ga0070765_1003699813 | 3300006176 | Soil | LGHRPTKGDFCWAGLMQDWMLITAPLALTLYFLAFQDQFRAVLAWLGALVN* |
| Ga0070765_1008144092 | 3300006176 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLSGLVN* |
| Ga0070765_1016582562 | 3300006176 | Soil | MQDWMLISAPLAITVYFLAFQDQFRAVLSWLSTLVN* |
| Ga0070765_1018813001 | 3300006176 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLGALVN* |
| Ga0073928_100302884 | 3300006893 | Iron-Sulfur Acid Spring | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLSALVN* |
| Ga0116108_10180772 | 3300009519 | Peatland | MHDWHDWMLIAAPLAAVLYFLAFQDQFRELLSWVSALVN* |
| Ga0116108_10724331 | 3300009519 | Peatland | VHLSDTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0116222_13905332 | 3300009521 | Peatlands Soil | MQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0116221_14862501 | 3300009523 | Peatlands Soil | VHRSSTGDLCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0116225_11219001 | 3300009524 | Peatlands Soil | VHRSSTGDFCWAALMQDWMLLTAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0116112_12368162 | 3300009636 | Peatland | MGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0074044_102991382 | 3300010343 | Bog Forest Soil | MQDWMLIAAPLALTVYFLAFQDQFRVVLSWLGALVN* |
| Ga0136449_1039531452 | 3300010379 | Peatlands Soil | MQDWMLIAAPLALTVYFLAFQDQFRAVLSWLGALVN* |
| Ga0136449_1042915531 | 3300010379 | Peatlands Soil | RPSKGDFCWATLMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0126350_121042502 | 3300010880 | Boreal Forest Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWLSALIN* |
| Ga0150983_119388461 | 3300011120 | Forest Soil | QDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN* |
| Ga0150983_160775041 | 3300011120 | Forest Soil | FCWAGLMQDWMLISAPLALTLYFLAFQDQFRMLLSWLSALVN* |
| Ga0120134_11179781 | 3300012004 | Permafrost | MQDWVLISAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0181518_100165072 | 3300014156 | Bog | MHDWVLITAPLAAVLYFLAFQDQFRELLSWVSALVN* |
| Ga0181521_101403021 | 3300014158 | Bog | MHDWVLITAPLAAVLYFLAFQDQFRELLSWVSTLVN* |
| Ga0181530_100042004 | 3300014159 | Bog | MHDWHDWMLIAAPLAAVLYFLAFQDQFRELLFWVSTLVN* |
| Ga0181532_100729792 | 3300014164 | Bog | MQDFILITAPLAAVLYFLAFQDQFRELLSWAAALIN* |
| Ga0181532_100996353 | 3300014164 | Bog | VHRSNTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0181523_100071891 | 3300014165 | Bog | GDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN* |
| Ga0181523_100124426 | 3300014165 | Bog | MGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLS |
| Ga0181526_103496062 | 3300014200 | Bog | LGHHPTEGDFCWATLMQDWMLITAPLALTLYFLAFQDQFRAVLSWLGALVN* |
| Ga0182018_100554593 | 3300014489 | Palsa | MQDWMLISAPLAITVYFLAFQDQFRAVLSWLGALVN* |
| Ga0182018_104536592 | 3300014489 | Palsa | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLSVLVN* |
| Ga0182024_101687462 | 3300014501 | Permafrost | MPDWMLISAPLGLTVYFLAFQDQFRAVLSWLGTLVN* |
| Ga0167643_10037752 | 3300015089 | Glacier Forefield Soil | MQDWMLISAPLALTLYFVAFQDQFRTLLSWLSALVN* |
| Ga0181511_11223674 | 3300016702 | Peatland | VHRSSTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSW |
| Ga0187854_102545671 | 3300017938 | Peatland | VHLSDTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0187853_101432922 | 3300017940 | Peatland | VHRSSTGDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0187879_100385554 | 3300017946 | Peatland | VHLSDTGDFCWAALMQEWMLLTAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0182025_12651204 | 3300019786 | Permafrost | MQDWMLISAPLAITVYFLAFQDQFRAVLSWLGALVN |
| Ga0193707_10277952 | 3300019881 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLGALVN |
| Ga0193751_10826502 | 3300019888 | Soil | MQDWMLISAPLALTLYFLAFQDQFRMLLSWLGALVN |
| Ga0193726_100001315 | 3300020021 | Soil | MQDWMLITAPLALTLYFLAFQDQFRALLSWLGALVN |
| Ga0210407_106647232 | 3300020579 | Soil | MQDWMLISAPLALTVYFLAFQDQFRTLLSWLTALID |
| Ga0210407_107894272 | 3300020579 | Soil | LGAPSHEGDFCWATLMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0210407_114119522 | 3300020579 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLGALVN |
| Ga0210403_110953782 | 3300020580 | Soil | MQGWMLISAPLALTLYFLAFQDQFRTLLSWLGALVN |
| Ga0210395_1000285412 | 3300020582 | Soil | MQDWVLITAPLAAVFYFLAFQDQFRELLSWVNAIVN |
| Ga0210401_101472813 | 3300020583 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLNALVN |
| Ga0210401_105407893 | 3300020583 | Soil | MQDWMLISAPLALTLYFLAFQDQFRMLLSWLSALVN |
| Ga0210404_100780871 | 3300021088 | Soil | AGLMQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN |
| Ga0210400_108739362 | 3300021170 | Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWISALVN |
| Ga0210405_102089313 | 3300021171 | Soil | MQDWMLIAAPLALTVYFLAFQDQFRMVLSWLSMLVN |
| Ga0210405_102282512 | 3300021171 | Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWLSALVS |
| Ga0210405_108795931 | 3300021171 | Soil | SSEGDFCWAGLMQDWMLISAPLALTLYFLAFQDQFRALLSWISALVN |
| Ga0210408_101469142 | 3300021178 | Soil | MQDWMLISAPLALTLYFLAFQDQFRALLSWLSALVN |
| Ga0210393_101138703 | 3300021401 | Soil | MQDWMLITAPLGLTVYFMVFQDQFRAVLSWLSALVN |
| Ga0210397_107525501 | 3300021403 | Soil | MHDWVLITVPLAAVLYFLAFQDQFRALLSWVSALVN |
| Ga0210383_100783845 | 3300021407 | Soil | LGHRPTKGDFCWAGLMQDWMLITAPLALTLYFLAFQDQFRAVLAWLSAL |
| Ga0210383_102034831 | 3300021407 | Soil | MQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0210383_110056271 | 3300021407 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0210394_100165206 | 3300021420 | Soil | MQDWMLIAAPLALTLYFLTFQDQFRAVLSWLSTLVN |
| Ga0210394_102088712 | 3300021420 | Soil | MRDWMLISAPLALTIYFVAFQDQFGTLVSWLTALID |
| Ga0210394_115853622 | 3300021420 | Soil | WAALMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0210394_117787801 | 3300021420 | Soil | MQDWMLIAAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0210384_108249482 | 3300021432 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTVLSWLSTLVN |
| Ga0210390_104274442 | 3300021474 | Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLGTLVN |
| Ga0210392_100895904 | 3300021475 | Soil | AGLMQDWMLISAPLALTLYFLAFQDQFRALLSWLSALVN |
| Ga0210398_1000068418 | 3300021477 | Soil | MQDWVLITAPLAAVLYFLAFQDQFRELLSWVSTMIN |
| Ga0210402_112644961 | 3300021478 | Soil | SSEGDFCWATLMQDWMLISAPLALTLYFLAFQDQFRTLLSWLSGLVN |
| Ga0210402_115084262 | 3300021478 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLSALVN |
| Ga0210410_113591731 | 3300021479 | Soil | MQEWMLITAPLALTVYFLAFQDQFRAVLSWLGTLVN |
| Ga0210409_104276981 | 3300021559 | Soil | MQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN |
| Ga0242663_11030921 | 3300022523 | Soil | EGDFCWAGLMQDWMLISAPLALTLYFLAFQDQFRMLLSWLSALVN |
| Ga0222756_10880101 | 3300022709 | Soil | LGASSQQGDLCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSVLVN |
| Ga0247553_1039781 | 3300023672 | Soil | EIWAHRSSKGDFCWAALMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0224564_10964971 | 3300024271 | Soil | MQDWMLIAAPLALTVYFLAFQDQFRAVLSWVSTLVN |
| Ga0209171_103559011 | 3300025320 | Iron-Sulfur Acid Spring | DFCWATLMQDWMLISAPLALTLYFLAFQDQFRTLLSWLSALVN |
| Ga0208604_10255562 | 3300027090 | Forest Soil | LGAPSHEGDFCWAMLMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0209529_10113842 | 3300027334 | Forest Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLSWLSVLVN |
| Ga0209332_10065154 | 3300027439 | Forest Soil | MRDWMLISAPLALTIYFVAFQDQFGTLLSWLTALID |
| Ga0209115_10148634 | 3300027567 | Forest Soil | MQDWMLITAPLALTLYFLAFQDQFRAVLAWLGALVN |
| Ga0209736_11039222 | 3300027660 | Forest Soil | MQDWVLITAPLAAMLYFLAFQDQFRALLSWVSTLVN |
| Ga0209011_10244981 | 3300027678 | Forest Soil | MQDWVLISAPLAITLYFLAFQDQFRAVLSWLGTLVN |
| Ga0209517_100087735 | 3300027854 | Peatlands Soil | MHDWHDWMLIAAPLAAVLYFLAFQDQFRELLSWVSTLVN |
| Ga0209693_101314363 | 3300027855 | Soil | LAHRAGEGDFCWATLMQDWMLITAPLALTLYFLAFQDQFRAVLAWLSALVN |
| Ga0209579_100163283 | 3300027869 | Surface Soil | MQDWMLIAAPLALTVYFLAFQDQFRTVLSWLSMLVN |
| Ga0209579_104644092 | 3300027869 | Surface Soil | GDLCWAGLMQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN |
| Ga0209169_100596683 | 3300027879 | Soil | LGHRPTKGDFCWAGLMQDWMLITAPLALTLYFLAFQDQFRAVLAW |
| Ga0209380_100166383 | 3300027889 | Soil | MQDWMLITAPLAISVYFLAFQDQFRALLSWLGTLVN |
| Ga0209006_106913772 | 3300027908 | Forest Soil | MQDWMLISAPLALTLYFLAFQDQFRALLAWLSALIN |
| Ga0209583_102616322 | 3300027910 | Watersheds | MQDWVLITAPLAAALYFLAFQDQFRAVLSWVSTLVN |
| Ga0209526_100343342 | 3300028047 | Forest Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLSALFN |
| Ga0308309_106120842 | 3300028906 | Soil | MQDWMLISAPLALTLYFLAFQDQFRTLLSWLSGLVN |
| Ga0316363_104358001 | 3300030659 | Peatlands Soil | VHRSSTGDLCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0265763_10001472 | 3300030763 | Soil | MQDWMLISAPLALTLYFLAFQDQFRALLFWISALVN |
| Ga0265741_1217951 | 3300030814 | Soil | MHDWVLITAPLAAVLYFLAFQDQFRTLLSWLSALVN |
| Ga0265760_101686432 | 3300031090 | Soil | GDLCWAALMQDWMLISAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0170824_1161620293 | 3300031231 | Forest Soil | GEGDCCWAGLMQDWMLISAPLALTLYFLAFQDQFRMLLSWLSALVN |
| Ga0310686_1110610492 | 3300031708 | Soil | LAHRPIEGDLCWAKLMQDWMLIAAPLALTVYFLAFQDQFRAVLSWVSTLVN |
| Ga0307476_1000087917 | 3300031715 | Hardwood Forest Soil | LAHCAAKGDLGWAALMQDWMLISAPLALTVYFVAFQDQFGMLLSWLTALID |
| Ga0316053_1154371 | 3300032120 | Soil | LCWAGLMQDWMLIAAPLALTLYFLAFQDQFRALLSWVSALVN |
| Ga0316053_1207721 | 3300032120 | Soil | LVQAWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0311301_104585801 | 3300032160 | Peatlands Soil | MQDWMLITAPLALTVYFLAFQDQFRAVLSWLGALVN |
| Ga0311301_104748581 | 3300032160 | Peatlands Soil | DFCWATLMQDWMLITAPLALTLYFLAFQDQFRAVLSWLSALVN |
| Ga0311301_123489412 | 3300032160 | Peatlands Soil | LMQDWILIAAPLALTVYFLAFQDQFRAVLSWLGALVN |
| Ga0348332_121483002 | 3300032515 | Plant Litter | FCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLSWLNALVN |
| Ga0315742_124010391 | 3300032756 | Forest Soil | GDFCWAALMQDWMLITAPLALTLYFLAFQDQFRAVLAWLSALVN |
| Ga0335081_110077962 | 3300032892 | Soil | MQDWMLIAAPLALTLYFLAFQDQFRMVLSWLSALVN |
| ⦗Top⦘ |