| Basic Information | |
|---|---|
| Family ID | F070420 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MALENCTLCRGTGWKLVPRPDGAAGSVAVACDCGMQERATRV |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.93 % |
| % of genes near scaffold ends (potentially truncated) | 95.12 % |
| % of genes from short scaffolds (< 2000 bps) | 87.80 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.041 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.472 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.14% β-sheet: 14.29% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13411 | MerR_1 | 48.78 |
| PF01556 | DnaJ_C | 10.57 |
| PF01625 | PMSR | 9.76 |
| PF00012 | HSP70 | 1.63 |
| PF07995 | GSDH | 0.81 |
| PF01695 | IstB_IS21 | 0.81 |
| PF02900 | LigB | 0.81 |
| PF06210 | DUF1003 | 0.81 |
| PF13302 | Acetyltransf_3 | 0.81 |
| PF02663 | FmdE | 0.81 |
| PF13591 | MerR_2 | 0.81 |
| PF00717 | Peptidase_S24 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 10.57 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 9.76 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 1.63 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.81 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 0.81 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.04 % |
| Unclassified | root | N/A | 34.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100201412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1021 | Open in IMG/M |
| 3300005177|Ga0066690_10419642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 907 | Open in IMG/M |
| 3300005332|Ga0066388_104526559 | Not Available | 708 | Open in IMG/M |
| 3300005537|Ga0070730_10373561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300005541|Ga0070733_10006583 | All Organisms → cellular organisms → Bacteria | 7568 | Open in IMG/M |
| 3300005586|Ga0066691_10546470 | Not Available | 691 | Open in IMG/M |
| 3300006162|Ga0075030_100886477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300006174|Ga0075014_100703596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 588 | Open in IMG/M |
| 3300006176|Ga0070765_100092658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2592 | Open in IMG/M |
| 3300006755|Ga0079222_11388165 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006794|Ga0066658_10202977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300006797|Ga0066659_10029426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3265 | Open in IMG/M |
| 3300006804|Ga0079221_10130125 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300007255|Ga0099791_10104939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300007255|Ga0099791_10114749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
| 3300007788|Ga0099795_10464984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009038|Ga0099829_10112111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2137 | Open in IMG/M |
| 3300009038|Ga0099829_11734617 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009090|Ga0099827_10275498 | Not Available | 1419 | Open in IMG/M |
| 3300009137|Ga0066709_104202301 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009143|Ga0099792_11248419 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009700|Ga0116217_10042497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3361 | Open in IMG/M |
| 3300010335|Ga0134063_10689664 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010336|Ga0134071_10493382 | Not Available | 632 | Open in IMG/M |
| 3300010359|Ga0126376_10104881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2166 | Open in IMG/M |
| 3300010362|Ga0126377_13127513 | Not Available | 535 | Open in IMG/M |
| 3300010376|Ga0126381_102964878 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010376|Ga0126381_103378595 | Not Available | 629 | Open in IMG/M |
| 3300010376|Ga0126381_105023029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010379|Ga0136449_100353189 | Not Available | 2640 | Open in IMG/M |
| 3300010398|Ga0126383_11702755 | Not Available | 719 | Open in IMG/M |
| 3300011120|Ga0150983_12266454 | Not Available | 928 | Open in IMG/M |
| 3300011269|Ga0137392_11259419 | Not Available | 598 | Open in IMG/M |
| 3300011271|Ga0137393_10410265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300011271|Ga0137393_10703993 | Not Available | 865 | Open in IMG/M |
| 3300012189|Ga0137388_10641021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 987 | Open in IMG/M |
| 3300012205|Ga0137362_10864001 | Not Available | 773 | Open in IMG/M |
| 3300012205|Ga0137362_11206686 | Not Available | 641 | Open in IMG/M |
| 3300012207|Ga0137381_11518539 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012357|Ga0137384_11146261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 621 | Open in IMG/M |
| 3300012359|Ga0137385_10531768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300012361|Ga0137360_10151522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1838 | Open in IMG/M |
| 3300012363|Ga0137390_11883231 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012924|Ga0137413_10505271 | Not Available | 890 | Open in IMG/M |
| 3300012929|Ga0137404_11139080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300012930|Ga0137407_12234566 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012957|Ga0164303_10330776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300012972|Ga0134077_10356489 | Not Available | 624 | Open in IMG/M |
| 3300014151|Ga0181539_1230227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300015053|Ga0137405_1273520 | Not Available | 693 | Open in IMG/M |
| 3300015203|Ga0167650_1084430 | Not Available | 735 | Open in IMG/M |
| 3300015264|Ga0137403_10778876 | Not Available | 813 | Open in IMG/M |
| 3300016270|Ga0182036_10364855 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300016294|Ga0182041_11710749 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300016357|Ga0182032_10468698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300017822|Ga0187802_10110456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300017932|Ga0187814_10237312 | Not Available | 689 | Open in IMG/M |
| 3300017973|Ga0187780_10055447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2740 | Open in IMG/M |
| 3300018038|Ga0187855_10788052 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018058|Ga0187766_10529825 | Not Available | 796 | Open in IMG/M |
| 3300018088|Ga0187771_10261263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1446 | Open in IMG/M |
| 3300020140|Ga0179590_1024761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1439 | Open in IMG/M |
| 3300020580|Ga0210403_10478606 | Not Available | 1013 | Open in IMG/M |
| 3300020580|Ga0210403_11368468 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300020581|Ga0210399_11348803 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300020583|Ga0210401_10648348 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300020583|Ga0210401_10906763 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300020583|Ga0210401_11316603 | Not Available | 580 | Open in IMG/M |
| 3300021170|Ga0210400_10091790 | Not Available | 2397 | Open in IMG/M |
| 3300021180|Ga0210396_10488272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300021403|Ga0210397_10428955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300021403|Ga0210397_11121421 | Not Available | 611 | Open in IMG/M |
| 3300021405|Ga0210387_10224561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1637 | Open in IMG/M |
| 3300021407|Ga0210383_11319971 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021420|Ga0210394_10596126 | Not Available | 971 | Open in IMG/M |
| 3300021433|Ga0210391_10308931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300021474|Ga0210390_10588265 | Not Available | 934 | Open in IMG/M |
| 3300021477|Ga0210398_10415124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1097 | Open in IMG/M |
| 3300021559|Ga0210409_11735705 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021560|Ga0126371_12362215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300026309|Ga0209055_1152907 | Not Available | 781 | Open in IMG/M |
| 3300026557|Ga0179587_10363032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300026557|Ga0179587_10778322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300026809|Ga0207820_114155 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026981|Ga0207822_1023416 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300027000|Ga0207803_1006192 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300027010|Ga0207839_1005815 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300027381|Ga0208983_1036011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300027603|Ga0209331_1056600 | Not Available | 987 | Open in IMG/M |
| 3300027651|Ga0209217_1063754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300027663|Ga0208990_1159245 | Not Available | 593 | Open in IMG/M |
| 3300027667|Ga0209009_1122835 | Not Available | 659 | Open in IMG/M |
| 3300027787|Ga0209074_10157922 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300027862|Ga0209701_10706440 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027867|Ga0209167_10500652 | Not Available | 665 | Open in IMG/M |
| 3300027903|Ga0209488_10136903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1848 | Open in IMG/M |
| 3300027911|Ga0209698_10978319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 632 | Open in IMG/M |
| 3300030730|Ga0307482_1096900 | Not Available | 801 | Open in IMG/M |
| 3300031446|Ga0170820_15778041 | Not Available | 760 | Open in IMG/M |
| 3300031544|Ga0318534_10090476 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300031716|Ga0310813_11554531 | Not Available | 617 | Open in IMG/M |
| 3300031720|Ga0307469_10314813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300031720|Ga0307469_12044254 | Not Available | 556 | Open in IMG/M |
| 3300031740|Ga0307468_100391947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1056 | Open in IMG/M |
| 3300031768|Ga0318509_10343878 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031771|Ga0318546_10735149 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031821|Ga0318567_10435783 | Not Available | 743 | Open in IMG/M |
| 3300031833|Ga0310917_10934745 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031880|Ga0318544_10016981 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300031893|Ga0318536_10462437 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031897|Ga0318520_10366319 | Not Available | 877 | Open in IMG/M |
| 3300031897|Ga0318520_10962496 | Not Available | 539 | Open in IMG/M |
| 3300031941|Ga0310912_10565481 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031947|Ga0310909_10659180 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031962|Ga0307479_11788819 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300032076|Ga0306924_10675500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1162 | Open in IMG/M |
| 3300032180|Ga0307471_103953495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300033289|Ga0310914_10798572 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1002014123 | 3300000955 | Soil | MAREDCALCRGTGWKLVARKDGTPGNMAVACECGMEERAGVVMERARIPK |
| Ga0066673_100189514 | 3300005175 | Soil | MLFGAGKSTGLIMALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVMERAHI |
| Ga0066690_104196422 | 3300005177 | Soil | MALENCTLCRGTGWKLVPRGDGAAGSVAVACDCGMEERASQVMERARIPKRY |
| Ga0066690_105578081 | 3300005177 | Soil | MLFGAGKSTGLIMALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVMERAHIPKR |
| Ga0066388_1045265591 | 3300005332 | Tropical Forest Soil | MALENCRLCRGTGYKMVARPDGPGTMAVACDCGMEERASR |
| Ga0066681_109738392 | 3300005451 | Soil | MLFGAGKSTGLIMALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVMERAHIP |
| Ga0070730_103735613 | 3300005537 | Surface Soil | MALENCTLCRGTGWKLVPRVDGAAGKVAVPCDCGMQERAVRVMERARIPK |
| Ga0070733_100065831 | 3300005541 | Surface Soil | MPLENCQLCRGTGYKLVPRPDGAGKFAVPCDCGMEDRA |
| Ga0066691_105464701 | 3300005586 | Soil | MALENCKLCRGTGWQLVPREDGAAGSVAVACDCGMEE |
| Ga0075030_1008864771 | 3300006162 | Watersheds | LCKGTGWKLVPRKDGAAGQMAAACECGMEERAEKVMERARV |
| Ga0075014_1007035961 | 3300006174 | Watersheds | MPIDDCTLCRGTGWKMVPRPDGAGLAALPCDCGMQD |
| Ga0070765_1000926584 | 3300006176 | Soil | MALENCSLCRGTGWKLVPRPDGAAGRIAVACDCGMEERSERVIERAHIPK |
| Ga0079222_113881651 | 3300006755 | Agricultural Soil | MALENCTLCRGTGWKLVPRADGAAGKVAVPCDCGTQERSVRVMER |
| Ga0066658_102029773 | 3300006794 | Soil | MALENCKLCRGSGWKLVPRGDGAAGSVGVACDCGMEERASRVME |
| Ga0066659_100294263 | 3300006797 | Soil | MALENCTLCRGTGWKLVPRGDGAAGSVAVACDCGMEERASGVMGRARIP* |
| Ga0066660_107623611 | 3300006800 | Soil | MLFDAGKSSGLTMALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVMERAHIP |
| Ga0079221_101301253 | 3300006804 | Agricultural Soil | MALENCTLCRGTGWKLVPRADGAAGKVAVPCDCGMQDRAVRVME |
| Ga0099791_101049391 | 3300007255 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRPYGAAGSVAVACDCGMQERATRVMER |
| Ga0099791_101147493 | 3300007255 | Vadose Zone Soil | MALENCTLCRGTGWRLVPRPDGAGGSVAVACDCGMQDRATRVMDRARIPKRYE |
| Ga0099795_104649842 | 3300007788 | Vadose Zone Soil | MALENCTLCRGTGWKLVARVDGVAGKVAVACDCGMEARASLV |
| Ga0099829_101121111 | 3300009038 | Vadose Zone Soil | MALENCTLCRGTGWKLVTRVDGAAGRVAVACDCGMEQRASLVMERARIPKR |
| Ga0099829_117346171 | 3300009038 | Vadose Zone Soil | MRPYAVGMALEDCPLCKGTGWKLVPRGDGSAGRMAAACDCGMNERAARVVERARIPK |
| Ga0099827_102754984 | 3300009090 | Vadose Zone Soil | MALENCKLCRGTGWKLVTRGDGAAGSVAVACDCGMEERASRVMGRARIPKR |
| Ga0066709_1042023012 | 3300009137 | Grasslands Soil | MALENCKLCRGSGWKLVPRGDGAAGSVVVACDCGMEERAWRVMERARIPK |
| Ga0099792_112484192 | 3300009143 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRSDGVRGNVAVACDCGMEERAT |
| Ga0116217_100424971 | 3300009700 | Peatlands Soil | MAREDCAICRGTGWKLVARKDGAPGSVAVACECGMEERAGLVMERA |
| Ga0134063_106896642 | 3300010335 | Grasslands Soil | MALENCTLCRGTGWKLVPRPDGAVGKVAVRCDCGIEERST |
| Ga0134071_104933821 | 3300010336 | Grasslands Soil | MALENCTLCRGTGWKLVPRGDGAGGSVAVACDCGMEDRASRVMERAR |
| Ga0126376_101048813 | 3300010359 | Tropical Forest Soil | MALENCTLCRGTGWKLMPRADGTAGKVAVPCDCGMQER |
| Ga0126377_131275132 | 3300010362 | Tropical Forest Soil | MALENCRLCHGTGYKMVARPDGAGTMAVACDCGMEERASRVM |
| Ga0126381_1029648782 | 3300010376 | Tropical Forest Soil | MAREDCPLCKGTGWKLVPRKDRTPGQVAVACDCGMEERAEKVMERARVPKRYE |
| Ga0126381_1033785952 | 3300010376 | Tropical Forest Soil | MPLENCQLCRGTGWKLVTRPDGAGKFAVACDCGMEDR |
| Ga0126381_1050230292 | 3300010376 | Tropical Forest Soil | MAIENCQLCRGTGWKMVPRADGAGRVATPCDCGMEDRA |
| Ga0136449_1003531894 | 3300010379 | Peatlands Soil | MAREDCAICRGTGWKLVARKDGAPGSVAVACECGMEERAGLVMERARIPKKYQ |
| Ga0126383_117027552 | 3300010398 | Tropical Forest Soil | MARKDCPLCKGTGWKLMPRKEGAPGQMAVACECGMEERAGK |
| Ga0150983_122664541 | 3300011120 | Forest Soil | MAQENCTLCRGTGWKLVPRPDGAGGSVAVACDCGMEERAARVV |
| Ga0137392_112594192 | 3300011269 | Vadose Zone Soil | MALESCTLCRGTGWKLVPRPDGAAGSVAVPCDCGMQERAERVMERARIPKR |
| Ga0137393_104102653 | 3300011271 | Vadose Zone Soil | MAREDCALCKGTGWKLVPRKDGPAGQMAVACECGMEERAEKVMERARVP |
| Ga0137393_107039933 | 3300011271 | Vadose Zone Soil | MTVYVAGSMALENCTLCRGTGWKLVQRPDGAAGSVAVACD |
| Ga0137388_106410211 | 3300012189 | Vadose Zone Soil | MALENCPHYHGTGWKLVPRKDGLANKVAVACGCGAEDRATQVFERAHIPKRYEH |
| Ga0137362_108640013 | 3300012205 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRPDGAGGSVAVACDCGMQDRATRVM |
| Ga0137362_112066862 | 3300012205 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRPDGAAGSVAVACDCGMQERATRV |
| Ga0137381_115185391 | 3300012207 | Vadose Zone Soil | MPVENCTLCRGTGWKLVPRQDGAAGSVAVACDCGMEERASR |
| Ga0137384_111462612 | 3300012357 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRADGVAGRVAVACDCGMEQR |
| Ga0137385_105317683 | 3300012359 | Vadose Zone Soil | MAREDCALCKGTGWKMVPRKDGAAGQMAVACECGMEERAEKVMERARVPKRYE |
| Ga0137360_101515221 | 3300012361 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRADGAAGRVAVACDCGMEQRASLVM |
| Ga0137390_118832311 | 3300012363 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRADGSAGKVAVACDCGMEERASRVMGRAR |
| Ga0137413_105052711 | 3300012924 | Vadose Zone Soil | MTREDCALCKGTGWKLVPRKDGAAGQMAVACECGMEERAEK |
| Ga0137404_111390802 | 3300012929 | Vadose Zone Soil | MTREDCALCKGTGWKMVPRKDGAAGQMAVACECGMEERAEKVMERA |
| Ga0137407_122345662 | 3300012930 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRGDGAAGKVAVACDCGMEKRASLVMERARI |
| Ga0164303_103307763 | 3300012957 | Soil | MALENCTLCRGTGWKLVPRLDGTAGSVAVACDCGMQDRATRVMERAR |
| Ga0134077_103564892 | 3300012972 | Grasslands Soil | MALENCTLCRGTGWKLVPRADGAAGKVAVPCDCGMRERAGRVMER |
| Ga0181539_12302271 | 3300014151 | Bog | MAREDCAVCRGTGWKLVARKDGTPGSVAVACECGMEERAG |
| Ga0137405_12735202 | 3300015053 | Vadose Zone Soil | MPIENCTLCRGTGWKLVPRPDGAGGSVAVACDCGMQDRATRVMDRARIPKRYE |
| Ga0167650_10844301 | 3300015203 | Glacier Forefield Soil | MAREDCALCHGTGWKLVPRAADTPGKMAVACECGMQERAGMV |
| Ga0137403_107788762 | 3300015264 | Vadose Zone Soil | MTREDCALCKGTGWKMLPRKDGAAGQMAAACECGMEERAEKVMERA |
| Ga0182036_103648552 | 3300016270 | Soil | MAKEDCPLCRGTSWKLVARKDGMPGNVAVPCECGLEERAEVA |
| Ga0182041_117107492 | 3300016294 | Soil | MAKEDCPLCRGTGWKLVPRKDVMPGNVAVACQCDLKERALIVMGRARIPKRY |
| Ga0182032_104686981 | 3300016357 | Soil | MAREDCALCKGTGWRLMPRKAGAPGQVAVPCECGSEERAEKVMERAR |
| Ga0187802_101104561 | 3300017822 | Freshwater Sediment | MAREDCLLCRGTGWKLVRKDGTPGEMAVACECGMEERAEIVMERARIP |
| Ga0187814_102373122 | 3300017932 | Freshwater Sediment | MAREDCPHCRGTGWKLVARTDGASGNVAVACECGAVERADKIM |
| Ga0187780_100554474 | 3300017973 | Tropical Peatland | MAREDCPLCRGTGWKLVARNDGTSGSVAVACECGMEERAEKVMERARIPKR |
| Ga0187855_107880521 | 3300018038 | Peatland | MAREDCTVCRGTGWKLVARKDGAPGSMAVACDCGMEERAGLVMERARIPRR |
| Ga0187766_105298252 | 3300018058 | Tropical Peatland | MALENCTLCRGTGWKLVPRPDGAEGTVAVACDCGMQERAARVMERARI |
| Ga0187771_102612633 | 3300018088 | Tropical Peatland | MAREDCPYCRGTGWKLVARTDGTPGNVAVACECSMEERAEKVMERARIPKRY |
| Ga0179590_10247613 | 3300020140 | Vadose Zone Soil | MAREDCALCKGTGWKLVPRKDGAAGQMAVACECGMEERAEKVMERARVPK |
| Ga0210403_104786062 | 3300020580 | Soil | MAREDCALCKGTGWKLVRRKDGAAGQMAVACECGMEERAEKIM |
| Ga0210403_113684681 | 3300020580 | Soil | MTLDNCTLCRGTGWKMVARADGAPGKVAVACDCGMEERAVRVMERARIPKRY |
| Ga0210399_113488032 | 3300020581 | Soil | MAREDCALCKGTGWRLVPRKDGAAGQMAVACECGMEER |
| Ga0210401_106483481 | 3300020583 | Soil | MALENCTLCRGTGWKLVPRADGAAGSMAVACDCGMQDRAMRVMER |
| Ga0210401_109067633 | 3300020583 | Soil | MAKEDCGICRGTGWKMVGRKDGLPGQVAAPCECGMEERAEKVMERARIP |
| Ga0210401_113166031 | 3300020583 | Soil | MALENCTLCRGTGWRLVPRADGAAGSMAVACDCGMQDRATRVMER |
| Ga0210400_100917901 | 3300021170 | Soil | MAREDCALCKGTGWKLVPRKEGAAGQMAVACECGMEERAEKVMERARVPKRYE |
| Ga0210396_104882723 | 3300021180 | Soil | MAREDCALCKETGWKLVPRKDGVAGQMAVACECGMEERAEKVMERARVPKRY |
| Ga0210397_104289551 | 3300021403 | Soil | MALENCTLCRGTGWKLVPRLDGAAGSVAVACDCGMQDRASRVME |
| Ga0210397_111214211 | 3300021403 | Soil | MALENCLLCRGTGWKLVARPDGARGTVAVACDCGMEERATRAMERAR |
| Ga0210387_102245611 | 3300021405 | Soil | MAREDCALCKGTGWKLVPRNDGAAGQMAVACECGMEERAEKVMERARVPKRYE |
| Ga0210383_113199712 | 3300021407 | Soil | MAREDCALCKGTGWKMVPRKEGTVGQMAVACECGMEERAEKLMERARVPKRYE |
| Ga0210394_105961263 | 3300021420 | Soil | MAREDCALCKGTGWKLVPRKDGAAGQMAVACECGMEERAEKV |
| Ga0210391_103089313 | 3300021433 | Soil | MAREDCAQCKGTGWKMVPRKEGTVGQMAVACECGMEERAEKLMERARVPK |
| Ga0210390_105882651 | 3300021474 | Soil | MALENCSLCKGTGWKLVPRRDGAAGKVAVACDCGMQDRAERVIERAHIP |
| Ga0210398_104151243 | 3300021477 | Soil | MAREDCALCKGTGWKLVPRKDGAAGQMAVACECGME |
| Ga0210409_117357051 | 3300021559 | Soil | MAREDCALCKETGWKLVPRKDGVAGQMAVACECGMEERAEKV |
| Ga0126371_123622151 | 3300021560 | Tropical Forest Soil | MPREDCPYCRGTGFKLIARKEGTGNVAIACECGMEERAEKVMERARIPKR |
| Ga0209055_11529071 | 3300026309 | Soil | MALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVM |
| Ga0209471_12345811 | 3300026318 | Soil | MLFGAGKSTGLIMALENCTLCRGTGWKLVPRADGAGKVALACDCGMEARASLVM |
| Ga0179587_103630322 | 3300026557 | Vadose Zone Soil | MALENCLRCRGTGWKLVPRPDGAAGKVAVPCDCGMQDRAERV |
| Ga0179587_107783222 | 3300026557 | Vadose Zone Soil | MALENCALCRGTGWKLVPRSDGVRGNVAVACDCGMEERAT |
| Ga0207820_1141551 | 3300026809 | Tropical Forest Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDL |
| Ga0207822_10234162 | 3300026981 | Tropical Forest Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDLKVRAEIV |
| Ga0207803_10061921 | 3300027000 | Tropical Forest Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDLKVRAEIVMGRARIPKRY |
| Ga0207839_10058153 | 3300027010 | Tropical Forest Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDLKVR |
| Ga0208983_10360111 | 3300027381 | Forest Soil | MENCPLCRGTGWRLEQRVNGAPGTVATACDCGMEERALRVMERAR |
| Ga0209331_10566001 | 3300027603 | Forest Soil | MALENCSLCRGTGWKLVPRTDGTRGNVAVACDCGMEERAT |
| Ga0209217_10637543 | 3300027651 | Forest Soil | MAREDCPHCSGTGWKLVARKHSVPGKMAVPCECGTEERAEKVMDRA |
| Ga0208990_11592452 | 3300027663 | Forest Soil | MALENCTLCRGTGWKLVPRGDGVAGKVAVACDCGM |
| Ga0209009_11228351 | 3300027667 | Forest Soil | MAKEDCGICRGTGWKMVGRKDGLPGQVAAPCECGMEERAEKVMERARI |
| Ga0209074_101579221 | 3300027787 | Agricultural Soil | MALENCTLCRGTGWKLVPRPDGAGGNVAVPCDCGMQERAVR |
| Ga0209701_107064403 | 3300027862 | Vadose Zone Soil | MALENCKLCRGTGWKLVTRGDGAAGSVAVACDCGMEERASRVMWR |
| Ga0209167_105006522 | 3300027867 | Surface Soil | MAREDCALCKGTGWKMVPRKDGAAGQMAVACECGMEERA |
| Ga0209488_101369031 | 3300027903 | Vadose Zone Soil | MALENCTLCRGTGWKLVPRSDGVRGNVAVACDCGMEE |
| Ga0209698_109783191 | 3300027911 | Watersheds | MAREDCALCKGTGWKLVPRKDGAAGQMAAACECGMEERAEKVMERARVPKR |
| Ga0307482_10969003 | 3300030730 | Hardwood Forest Soil | MALENCTLCRGTGWKLVARADGAAGSVAVACDCGMRER |
| Ga0170820_157780412 | 3300031446 | Forest Soil | MAREDCALCRGTGWKLVARKDGTPGNMAVACECGLEERAGVVMERAR |
| Ga0318534_100904761 | 3300031544 | Soil | MAKEDCPLCRGTSWKLVARKDGMPGNVAVPCDCGLE |
| Ga0310813_115545311 | 3300031716 | Soil | MALENCSLCRGTGWKLVPRPDGAAGKVAVACDCGMEERSERV |
| Ga0307469_103148131 | 3300031720 | Hardwood Forest Soil | MAREDCALCKGTGWKLVPRKDGAAGQMAVACECGMEERAEKVMG |
| Ga0307469_120442541 | 3300031720 | Hardwood Forest Soil | MALENCTLCRGTGWKLVARPDGAGGSVAVACDCGMQDRATR |
| Ga0307468_1003919473 | 3300031740 | Hardwood Forest Soil | MALENCSLCRGTGWKLVPRADGLRGNVAVACDCGMEERAGRVMER |
| Ga0318509_103438782 | 3300031768 | Soil | MAKEDCPLCRGTGWKLVPRKDGTPGKVAVACECDLKVRAEIV |
| Ga0318546_107351492 | 3300031771 | Soil | MAKEDCPLCRGTSWKLVARKDGIPGNVAVPCDCGLEERAEVAMGR |
| Ga0318567_104357832 | 3300031821 | Soil | MAREDCPLCRGTGWKMIPREDDTPSRVAVACECGIEERAERVMARARIPKRYE |
| Ga0310917_109347451 | 3300031833 | Soil | MALENCARCRGTGWKLVPRTDGAAGKLAVPCDCGIEQRAGRAMERARIPKHYE |
| Ga0318544_100169811 | 3300031880 | Soil | MAKEDCPLCRGTSWKLVARKDGMPGNVAVPCDCGLEERAEVAMGRARIPRRYEN |
| Ga0318536_104624372 | 3300031893 | Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDLK |
| Ga0318520_103663193 | 3300031897 | Soil | MALENCTMCRGTGWKLVPRADGAAGKVAVPCDCGMRERAGRVMERARIPKHYEE |
| Ga0318520_109624961 | 3300031897 | Soil | MPREDCPYCRGTGFKLIARKEGTGNVAIACECGMEERAEKVMER |
| Ga0310912_105654812 | 3300031941 | Soil | MAKEDCPLCRGTGWKLVPRKDGTPGKVAVACECDLKVRAEIVMGRARIPK |
| Ga0310909_106591801 | 3300031947 | Soil | MAKEDCPLCRGTSWKLVARKDGMPGNVAVPCDCGLEE |
| Ga0307479_117888191 | 3300031962 | Hardwood Forest Soil | MTLENCTLCRGTGWKLVSRADGAPGRVAVACDCGMEERAVRVMERARIPKR |
| Ga0306924_106755003 | 3300032076 | Soil | MAREDCPLCRGTGWKMIPREDDTPSRVAVACECGIEERAERVMA |
| Ga0307471_1039534951 | 3300032180 | Hardwood Forest Soil | MALENCSLCRGTGWKLVPRPDGAPGKVAVACDCGMQDRAERVIERAHIPKR |
| Ga0310914_107985722 | 3300033289 | Soil | MAKEDCPLCRGTGWKLVPRKDGTPGNVAVACECDLKERALI |
| ⦗Top⦘ |