| Basic Information | |
|---|---|
| Family ID | F070419 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKRSLQQIAEAVGARLQGDGSVEVGSVASIESASKDDLVFVEE |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.49 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 91.06 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.041 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.634 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.789 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 11.27% Coil/Unstructured: 77.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF04613 | LpxD | 17.89 |
| PF04012 | PspA_IM30 | 5.69 |
| PF04014 | MazE_antitoxin | 3.25 |
| PF05016 | ParE_toxin | 2.44 |
| PF13211 | DUF4019 | 0.81 |
| PF15975 | Flot | 0.81 |
| PF01590 | GAF | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 17.89 |
| COG1842 | Phage shock protein A | Transcription [K] | 11.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.04 % |
| Unclassified | root | N/A | 34.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y01EYIGV | Not Available | 611 | Open in IMG/M |
| 3300001175|JGI12649J13570_1014323 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300001305|C688J14111_10132099 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300001471|JGI12712J15308_10172494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300001593|JGI12635J15846_10582526 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300001867|JGI12627J18819_10411559 | Not Available | 551 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101134747 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300004080|Ga0062385_10167365 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300004082|Ga0062384_100161284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300004082|Ga0062384_100517976 | Not Available | 793 | Open in IMG/M |
| 3300004082|Ga0062384_101116905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300004092|Ga0062389_101221050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300005533|Ga0070734_10342658 | Not Available | 853 | Open in IMG/M |
| 3300005591|Ga0070761_10166985 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005602|Ga0070762_10937480 | Not Available | 591 | Open in IMG/M |
| 3300005879|Ga0075295_1014745 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005994|Ga0066789_10385432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300006041|Ga0075023_100426756 | Not Available | 580 | Open in IMG/M |
| 3300006174|Ga0075014_100743682 | Not Available | 574 | Open in IMG/M |
| 3300006175|Ga0070712_100524515 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300007788|Ga0099795_10484701 | Not Available | 574 | Open in IMG/M |
| 3300009623|Ga0116133_1055946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300009624|Ga0116105_1209462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009639|Ga0116122_1199459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300009683|Ga0116224_10483414 | Not Available | 590 | Open in IMG/M |
| 3300010043|Ga0126380_10031019 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300010379|Ga0136449_101733044 | Not Available | 939 | Open in IMG/M |
| 3300010379|Ga0136449_103586276 | Not Available | 589 | Open in IMG/M |
| 3300010398|Ga0126383_13562413 | Not Available | 508 | Open in IMG/M |
| 3300012096|Ga0137389_10833184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300012207|Ga0137381_10383190 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300012357|Ga0137384_10591202 | Not Available | 906 | Open in IMG/M |
| 3300012683|Ga0137398_10353144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300012927|Ga0137416_12050387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300014168|Ga0181534_10707452 | Not Available | 589 | Open in IMG/M |
| 3300014169|Ga0181531_10520205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300016445|Ga0182038_10939370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300017934|Ga0187803_10021982 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
| 3300017975|Ga0187782_10988758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300018003|Ga0187876_1033034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2285 | Open in IMG/M |
| 3300018034|Ga0187863_10011236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5779 | Open in IMG/M |
| 3300018043|Ga0187887_10469311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300018058|Ga0187766_10638246 | Not Available | 730 | Open in IMG/M |
| 3300018085|Ga0187772_10665237 | Not Available | 745 | Open in IMG/M |
| 3300018090|Ga0187770_11494114 | Not Available | 550 | Open in IMG/M |
| 3300020199|Ga0179592_10522142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300020580|Ga0210403_10076303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2695 | Open in IMG/M |
| 3300020582|Ga0210395_10160815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300021171|Ga0210405_10495214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300021181|Ga0210388_11142292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300021401|Ga0210393_10119766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2103 | Open in IMG/M |
| 3300021401|Ga0210393_10565843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300021402|Ga0210385_11203060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300021403|Ga0210397_10207559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1403 | Open in IMG/M |
| 3300021404|Ga0210389_10135635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
| 3300021405|Ga0210387_10052259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3294 | Open in IMG/M |
| 3300021407|Ga0210383_11427862 | Not Available | 575 | Open in IMG/M |
| 3300021420|Ga0210394_10928115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300021420|Ga0210394_11318128 | Not Available | 616 | Open in IMG/M |
| 3300021479|Ga0210410_10473293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300021559|Ga0210409_11552067 | Not Available | 538 | Open in IMG/M |
| 3300022509|Ga0242649_1022874 | Not Available | 759 | Open in IMG/M |
| 3300022712|Ga0242653_1026922 | Not Available | 839 | Open in IMG/M |
| 3300023056|Ga0233357_1022719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300024227|Ga0228598_1006514 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300024227|Ga0228598_1107134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300025501|Ga0208563_1038083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300025604|Ga0207930_1097751 | Not Available | 673 | Open in IMG/M |
| 3300026217|Ga0209871_1013873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1500 | Open in IMG/M |
| 3300026854|Ga0207727_105870 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300027575|Ga0209525_1110708 | Not Available | 646 | Open in IMG/M |
| 3300027591|Ga0209733_1177948 | Not Available | 505 | Open in IMG/M |
| 3300027629|Ga0209422_1125141 | Not Available | 586 | Open in IMG/M |
| 3300027648|Ga0209420_1105897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300027652|Ga0209007_1033136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1325 | Open in IMG/M |
| 3300027767|Ga0209655_10216437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300027783|Ga0209448_10038757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300027826|Ga0209060_10241745 | Not Available | 828 | Open in IMG/M |
| 3300027842|Ga0209580_10063153 | Not Available | 1747 | Open in IMG/M |
| 3300027853|Ga0209274_10122946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
| 3300027862|Ga0209701_10593123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300027874|Ga0209465_10499304 | Not Available | 607 | Open in IMG/M |
| 3300027879|Ga0209169_10098815 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300027884|Ga0209275_10168621 | Not Available | 1169 | Open in IMG/M |
| 3300027889|Ga0209380_10656461 | Not Available | 604 | Open in IMG/M |
| 3300027895|Ga0209624_10523241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300027895|Ga0209624_10765837 | Not Available | 635 | Open in IMG/M |
| 3300027908|Ga0209006_10071052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3103 | Open in IMG/M |
| 3300028017|Ga0265356_1004821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1634 | Open in IMG/M |
| 3300028536|Ga0137415_10654404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300028781|Ga0302223_10307965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300028882|Ga0302154_10618756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300028906|Ga0308309_10321928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300029903|Ga0247271_100179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17793 | Open in IMG/M |
| 3300029910|Ga0311369_10249760 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300029993|Ga0302304_10105892 | Not Available | 1075 | Open in IMG/M |
| 3300030007|Ga0311338_10830676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300030011|Ga0302270_10688308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300030053|Ga0302177_10151743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300030053|Ga0302177_10427079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300030490|Ga0302184_10104580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300030520|Ga0311372_11190166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300030520|Ga0311372_11567450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 806 | Open in IMG/M |
| 3300030659|Ga0316363_10126330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300030862|Ga0265753_1101972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031057|Ga0170834_105423058 | Not Available | 607 | Open in IMG/M |
| 3300031231|Ga0170824_110522886 | Not Available | 506 | Open in IMG/M |
| 3300031446|Ga0170820_16271462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300031708|Ga0310686_114395509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300031715|Ga0307476_10541221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300031716|Ga0310813_10380402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300031718|Ga0307474_10251788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
| 3300031754|Ga0307475_11313873 | Not Available | 560 | Open in IMG/M |
| 3300031823|Ga0307478_10064395 | Not Available | 2754 | Open in IMG/M |
| 3300031823|Ga0307478_10456857 | Not Available | 1062 | Open in IMG/M |
| 3300031823|Ga0307478_11674616 | Not Available | 524 | Open in IMG/M |
| 3300032160|Ga0311301_12276194 | Not Available | 618 | Open in IMG/M |
| 3300032515|Ga0348332_10779824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300032515|Ga0348332_12997234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300032805|Ga0335078_11664181 | Not Available | 702 | Open in IMG/M |
| 3300032805|Ga0335078_12574558 | Not Available | 523 | Open in IMG/M |
| 3300032828|Ga0335080_10449972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300033405|Ga0326727_10767915 | Not Available | 752 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.06% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_00883490 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MKCSLQQIAEALGIRLIGDSSLHVTGVASIESASADDLV |
| JGI12649J13570_10143232 | 3300001175 | Forest Soil | MKRTLQEIAVAIEARLQGDGSVPVSGVASILSASAVELVFVEEEKYL |
| C688J14111_101320991 | 3300001305 | Soil | MKRSLQQISDSVGARLIGDGSVEILSLASIESAGPSDLVFIDNQ |
| JGI12712J15308_101724941 | 3300001471 | Forest Soil | VKRKLQEIAEAVGARLQGDGNLEVSGVASIASASAYDLVFVEDG |
| JGI12635J15846_105825261 | 3300001593 | Forest Soil | MKRSLLQIAEAIEARVEGDGSIEVAGVASIGSASRQDLVFVE |
| JGI12627J18819_104115592 | 3300001867 | Forest Soil | MKRSLDQIAAAVGARLLGEGRVEVSSVASIQSASLADLVFVEDE |
| JGIcombinedJ26739_1011347473 | 3300002245 | Forest Soil | MKRSLQEIAEAVEARLQGDGSVEVEGVASTGSASKHDLVFV |
| Ga0062385_101673651 | 3300004080 | Bog Forest Soil | MKRSLQQIAEAVGARLIGEGRVEVSAVASLESASPDDLIFVEDEKHLA |
| Ga0062384_1001612841 | 3300004082 | Bog Forest Soil | MKRSLQEIAEAVEARLQGDGSVEVDDVASIGSASKHDLVFVEEEK |
| Ga0062384_1005179762 | 3300004082 | Bog Forest Soil | MKRSLQEIAEAVGVRLVGDGRVEVSGVASIESASKDDLVFVED |
| Ga0062384_1011169051 | 3300004082 | Bog Forest Soil | MKRSLQQIAEAVEARLEGDGSVEIGGVASIGSASPHDLVFVEDEK |
| Ga0062389_1012210503 | 3300004092 | Bog Forest Soil | MKRSLREIAEAVNARLHGDGSVEVGGVASIGSASQHDLVFV |
| Ga0070734_103426582 | 3300005533 | Surface Soil | MKRPLKQIADALGARLTGPVHGEASGVASIESASNEDLVFVE |
| Ga0070761_101669854 | 3300005591 | Soil | MKRSLQEIAEAVEARLHGDGKVEVEGVASIGSASKHDLVFVE |
| Ga0070762_109374801 | 3300005602 | Soil | MGRSLRKIAEAVGARLQGDGELEFSGVASIASASPDNLVF |
| Ga0075295_10147451 | 3300005879 | Rice Paddy Soil | MKRSLEEIAAALGLRLFGEPGLPISGVASIESACSEDLVFVENEKHL |
| Ga0066789_103854322 | 3300005994 | Soil | MKRTLQQIAEAVGARLLGDGRTEVSAVASMESAAAGDIVFVEDEKHLAA |
| Ga0075023_1004267562 | 3300006041 | Watersheds | MKRSLQEIAEAVGARLIGNGRVEVSAVASIQSASRDDLVFVEDEKHLGGA |
| Ga0075014_1007436822 | 3300006174 | Watersheds | MRSLQQIADTLEARVIGDGQVELTGVASIGSASPQDLVFVDEAKHFSAAVQSP |
| Ga0070712_1005245151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLQQIAEAVGARLIGDGRTLVSGVASLASASSGDL |
| Ga0099795_104847011 | 3300007788 | Vadose Zone Soil | MKRSLREIAEAVEARLQGDGSLALDGLASIHSASKNDLVFVEEEKYL |
| Ga0116133_10559461 | 3300009623 | Peatland | MKRTLQQIAESIGARLQGDGDVQVERVASLASACALDLVFVEEEKYLSR |
| Ga0116105_12094623 | 3300009624 | Peatland | MKRSLRQIAEVVEARLQGDGSVEIEGVASIGSASPLDLVFVEE |
| Ga0116122_11994592 | 3300009639 | Peatland | MKRSLQEIAEALEVGVHGDGSVQVSGVASMASASASD |
| Ga0116224_104834142 | 3300009683 | Peatlands Soil | MKRSLQQIAQAVGARLIGEGSAEVSAVASMESATPE |
| Ga0126380_100310197 | 3300010043 | Tropical Forest Soil | MKRSLKQIADALGARLIGPDQAEVSGVASIESASSTDLAF |
| Ga0136449_1017330442 | 3300010379 | Peatlands Soil | MKRSLQQIAEAVGARLIGEGRAEVSAVASMESATP |
| Ga0136449_1035862761 | 3300010379 | Peatlands Soil | MKRTVREIAEAVEARLQGDGSVQVSGVASIASASADDLV |
| Ga0126383_135624131 | 3300010398 | Tropical Forest Soil | MKRSLKQIADAVGARLVGSDQAEIGSVASIESASSNDLVFVEDEKHL |
| Ga0137389_108331843 | 3300012096 | Vadose Zone Soil | MKRSLQQIADAVAARLCGDGAVQVSGVASVASARSEDVVFVEERKHL |
| Ga0137381_103831903 | 3300012207 | Vadose Zone Soil | MKRSLQQIADALGIRLIGGPGLQVGGGASIESACSVDLVFVEDE |
| Ga0137384_105912021 | 3300012357 | Vadose Zone Soil | MKVSLHKIAEAVGARLIGEGRGEVSGVASMESATPQDL |
| Ga0137398_103531441 | 3300012683 | Vadose Zone Soil | MKRSLREIAEAVEARLQGDGSLAVDGVASIHSASKNDLVFVEEEKYLSR |
| Ga0137416_120503871 | 3300012927 | Vadose Zone Soil | MKRSLQQIAEAVGARLHGDGNVEVESVASIASASRHDLVFVED |
| Ga0181534_107074521 | 3300014168 | Bog | MKRPLQQIAEGVGARLIGDGGIAVTGVASMQSAGPDDLVFVEDEKHL |
| Ga0181531_105202053 | 3300014169 | Bog | MKRKLLQMAELVGARLQGDGSVLVGGVASIASATP |
| Ga0182038_109393701 | 3300016445 | Soil | MKRSLHAIAEALEVRLIGDGASEVSGVASLGSASRQDIV |
| Ga0187803_100219828 | 3300017934 | Freshwater Sediment | MKRSLQQVADAVAARLVGDGNVEVSGVGSIESGGAEDLIFVEDPK |
| Ga0187782_109887582 | 3300017975 | Tropical Peatland | MKRSLKELAESLGARLLGNSQAEISGVASIEGASAQDLVFVEDEKH |
| Ga0187876_10330344 | 3300018003 | Peatland | MKRTLQQIAEAVEACLQGDPSVQVSSVASVASASPDDLVFVE |
| Ga0187863_1001123610 | 3300018034 | Peatland | MKRSLQHIADAVGARLIGEGRVEVSAVASMESASPEDLVFVDDEKHLAAALQ |
| Ga0187887_104693111 | 3300018043 | Peatland | MCVVCYRVGAMKRSLQQIAEAVEARVEGDGNVEVSGVASIGSASRQDLVF |
| Ga0187766_106382462 | 3300018058 | Tropical Peatland | MKGRVTPRTLQQIAEATGARLVGDGSVEVSGVASIESASAGDVVFVEDEK |
| Ga0187772_106652371 | 3300018085 | Tropical Peatland | MNGRTTPRTLRLIAEATGARLVGDGSVEVSGVASIQSASQDD |
| Ga0187770_114941142 | 3300018090 | Tropical Peatland | MKSQGTPRSLQEIAETLGARLIGDGSIEVSRVASIESAAP |
| Ga0179592_105221421 | 3300020199 | Vadose Zone Soil | MKRSLREIAEAVEARLQGDGNLAVDGLASIHSASKSDLVFVE |
| Ga0210403_100763036 | 3300020580 | Soil | VSSLQQIADALGARLIGDGRMQVRAVASIESATPEDL |
| Ga0210395_101608151 | 3300020582 | Soil | MKRSLQEIAEAVEARLQGDGKVEVEGVASIGSASKCDLVFVEEEKYLTRALQSG |
| Ga0210405_104952141 | 3300021171 | Soil | MKRSLQEIAEAVEARLQGDGKVEVEGVASIGSASK |
| Ga0210388_111422921 | 3300021181 | Soil | MKRSLQQIAEAVGARLQGDGSVEVGSVASIESASKDDLVFVEE |
| Ga0210393_101197667 | 3300021401 | Soil | MKRSLQEIAEAVEARLQGDGKVEVEGVASIGSASKCDLVFV |
| Ga0210393_105658432 | 3300021401 | Soil | VKRKLQEIAEALGARLQGDGSAEVGGVASIASASALDLVFVEDGKYLSQALQSG |
| Ga0210385_112030603 | 3300021402 | Soil | MKRSLREIAEAVGARLQGDGSVEIECVASIESASPRDVVFVADEMR |
| Ga0210397_102075594 | 3300021403 | Soil | MKRSLKQIAEAVGAHLLGDGRAEVGAVASMDSATPQDLVFVDDEKHLSVALRS |
| Ga0210389_101356351 | 3300021404 | Soil | MKRSLQQIAEAVGARLIGEGRIEVSAVASIESASAEDLVFVE |
| Ga0210387_100522591 | 3300021405 | Soil | MKRSLQEIAGAVEVRLQGDPSVQVSGVASIASATQDDLVFVE |
| Ga0210383_114278622 | 3300021407 | Soil | MKRSLQEIAETVGARLMGDGRAEVSAVASIESATPE |
| Ga0210394_109281151 | 3300021420 | Soil | MKRSLQHIAEAVGARLIGEGRVEVSAVASIESASPSDLV |
| Ga0210394_113181281 | 3300021420 | Soil | MKRSLQQIAEAVGARLIGDGRAEVSAVASIESATPS |
| Ga0210410_104732932 | 3300021479 | Soil | VQHIAEAVGARLIGEGRVEVSAVASIASATPSDLAFVEDEKHLAAALRSR |
| Ga0210409_115520671 | 3300021559 | Soil | MKRSVQHIAEAVGARLIGEGRVEVSAVASLESATPEDLVFVEDEK |
| Ga0242649_10228741 | 3300022509 | Soil | MKRSLQQIADAVGARLIGEGGPEVRRLEVSGVSSPESAT |
| Ga0242653_10269222 | 3300022712 | Soil | MKRSLQQIAEAVGARLIGDGRAEMSAVASIESATPEDIVFVED |
| Ga0233357_10227191 | 3300023056 | Soil | MKRSLQQIAEAVGARLRGDGSVEIGGVASIGSALQH |
| Ga0228598_10065141 | 3300024227 | Rhizosphere | MKRSLQQIAEAVEARLQGDGSVKVGGVASIGSASEHDLVFVE |
| Ga0228598_11071342 | 3300024227 | Rhizosphere | MKRTLQEIAEQLEVRLQGDGSARVSGVASLASAAAGDLVFV |
| Ga0208563_10380832 | 3300025501 | Peatland | MKRSLQEIAEALEVGVHGDGSVQVSGVASMASASASDLVFVEEE |
| Ga0207930_10977512 | 3300025604 | Arctic Peat Soil | MKRSLQQIAEAVGARLIGDGHSEVGAVASMESATPQDLVFV |
| Ga0209871_10138734 | 3300026217 | Permafrost Soil | MKHSLQQISEAVGVRLIGDGRVEVGGVASIESASQDDLV |
| Ga0207727_1058701 | 3300026854 | Tropical Forest Soil | MKRSVQQIADAVGARLTGDSSVEVTGVASMESASQSEIVFVEDEKHLAAARQS |
| Ga0209525_11107082 | 3300027575 | Forest Soil | MKRSLEQIAEAVGARLIGEGRVEVSAVASIESASADDLVFVEDEKHLDEAL |
| Ga0209733_11779481 | 3300027591 | Forest Soil | MNRSLQEIAQTVEARLQGDGSLQVGGVASIGSASENDLVFVEEEKYLSR |
| Ga0209422_11251412 | 3300027629 | Forest Soil | MKRPVDQIAAAVGARLLGEGRVEVSSVASIESASHADLVFVEDEKHLA |
| Ga0209420_11058971 | 3300027648 | Forest Soil | MKRTLQEIAVAIEARLQGDGSVPVSGVASILSASAVELVFVEEEKYLSRALQSDAGA |
| Ga0209007_10331361 | 3300027652 | Forest Soil | MKRSLQEIAEAVEARLQGDGSVEVEGVASTGSASKHDLVFVE |
| Ga0209655_102164371 | 3300027767 | Bog Forest Soil | MKRSLQEIAEAVEARLHGDGKVAVAGVASIGSASSCDLV |
| Ga0209448_100387574 | 3300027783 | Bog Forest Soil | MKRSLEQIAGALGARLVGDRGVEVAGVASMASASKDDLVFVEDE |
| Ga0209060_102417451 | 3300027826 | Surface Soil | MKRPLKQIADALGARLTGPVHGEASGVASIESASNEDLVFVEDEK |
| Ga0209580_100631531 | 3300027842 | Surface Soil | MKRTLQQIAEAVGARVVGDARREVSGLSSLDSASADDVVFVEDEKH |
| Ga0209274_101229464 | 3300027853 | Soil | MKRSLQEIAEAVEARLHGDGKVEVEGVASIGSASKHDLVFVEEEKYLARALQPGAG |
| Ga0209701_105931233 | 3300027862 | Vadose Zone Soil | MKRSLQQIAEAVGARLLGDGSVEVESVASIASASPHDLVF |
| Ga0209465_104993041 | 3300027874 | Tropical Forest Soil | MKRSLQQIAEAVGARLIGDASREVNGVASLESASERDLVFV |
| Ga0209169_100988153 | 3300027879 | Soil | MKRSLQEIAEALEVRLLGEGSVEVSAVASLASASPHDLVFVEEQKY |
| Ga0209275_101686213 | 3300027884 | Soil | MKRSLQQIAEAVGARLIGEGGPEVRRLEVSGVSSPESATPDDLVFVDDDKHL |
| Ga0209380_106564612 | 3300027889 | Soil | MKRSLQQIAEAVGARLIGEGGPEVRRLEVSGVSSPESATPDDLV |
| Ga0209624_105232412 | 3300027895 | Forest Soil | MKRSLEQIAEAVGARLIGEGRVEVSAVASIESASADDL |
| Ga0209624_107658371 | 3300027895 | Forest Soil | MKRSLQYIAEAVGARLLGDGRVEISGVASIASASPA |
| Ga0209006_100710521 | 3300027908 | Forest Soil | MKRSLQHIAEAVRARLIGDGRVEISGVASIASASPADLVF |
| Ga0265356_10048211 | 3300028017 | Rhizosphere | MKRSLRQIAEAVEGRLQGGDERVEIEGVASIGAASARDLVF |
| Ga0137415_106544041 | 3300028536 | Vadose Zone Soil | MKRSLQQIAEAVGARLHGDGNVEVESVASIASASRHDLVFV |
| Ga0302223_103079652 | 3300028781 | Palsa | MRHKLQEIAEAVGARLEGDGSVEVGGVASIASASASEIV |
| Ga0302154_106187562 | 3300028882 | Bog | MCVVCYRVGAMKRSLQQIAEAVEARVEGDGNVEVSGVASIGSASKQNLVFVED |
| Ga0308309_103219281 | 3300028906 | Soil | VKRKLQEIAEALGARLQGDGSAEVGGVASIASASALDLVFVED |
| Ga0247271_10017912 | 3300029903 | Soil | MKRSLQQIAEAVGARLIGDSHLEVSAVASTESATPSDLVFVXXXXX |
| Ga0311369_102497604 | 3300029910 | Palsa | MKRSLQQIAEAVDACVQGDGSVEVGGVASIGSASQHDLVFVE |
| Ga0302304_101058921 | 3300029993 | Palsa | MKRSLQQIAEAVDACVQGDGSVEVGGVASIGSASQHDLVCVE |
| Ga0311338_108306762 | 3300030007 | Palsa | MKRSLQQIAQAVGARLEGDGSVEVAGVASIASASPQDLVFVED |
| Ga0302270_106883082 | 3300030011 | Bog | MCVVCYRVGAMKRSLQQIAEAVEARVEGDGNVEVSGVASIGSASKQNLVFVEDEK |
| Ga0302177_101517431 | 3300030053 | Palsa | MKRSLQQIAEAVGARLLAGGAVEVSGVASIGTAGPEHLVFVDDQKHLE |
| Ga0302177_104270791 | 3300030053 | Palsa | MKRSLQQIAEAVDARLQGDGSVEVGGVASIGSASEHDLVFVEEE |
| Ga0302184_101045801 | 3300030490 | Palsa | MRHKLQEIAEAVGARLEGDGSVEVGGVASIASASASEIVFVEDEKYLS |
| Ga0311372_111901661 | 3300030520 | Palsa | MSGLCYRVGAMKRSLQQIAEAVDARLQGDGRVEVGGVASIGSASQHDLVFVEEEKYLLRALESATGAVI |
| Ga0311372_115674503 | 3300030520 | Palsa | MKRSLQQIAEAVGARLLAGGAVEVSGVASIGTAGP |
| Ga0316363_101263301 | 3300030659 | Peatlands Soil | MKRSLLQIAKAVEARLQGDGSVEVEGVASIGSASPHDL |
| Ga0265753_11019721 | 3300030862 | Soil | MSVLCDTVGAMKRSLQQIAEAVDARLQGDGSVEVGRVASISSASQHDLVFVEEEKYLQR |
| Ga0170834_1054230583 | 3300031057 | Forest Soil | MKRSLQEIAEAVGARLQGDGSLQVGGVASIGAASKNDLVFVEEEK |
| Ga0170824_1105228862 | 3300031231 | Forest Soil | VGARKRSLQQIAEAVGARLIGEGSVEVSAVAGSESATPDDLS |
| Ga0170820_162714622 | 3300031446 | Forest Soil | MKRSLHQIAEAVGARLLGEGRVEVSAVASIASATPDDLVFVDDAKHLA |
| Ga0310686_1143955091 | 3300031708 | Soil | MEQIKTRTLREIAEAVDAHLHGDGNVQVSGVASVESAAAGDLVFVEN |
| Ga0307476_105412211 | 3300031715 | Hardwood Forest Soil | MKRSLQQIANAVGARLIGPGLGEVSGVASIESASAADLVFVEDEKHLA |
| Ga0310813_103804023 | 3300031716 | Soil | MKCSLQHIAEALGMRLIGDSSLHVTGVASIESASAADLVFVEDEKHLGHALQS |
| Ga0307474_102517884 | 3300031718 | Hardwood Forest Soil | MKRSLRQIAEAVEARLQGDGGVEVWGVASIGSASEHDLVFVEEEK |
| Ga0307475_113138732 | 3300031754 | Hardwood Forest Soil | MKRSVQHIAEAVGARLIGEGRVEVSAVASLESATPEDLVFVEDEKHLA |
| Ga0307478_100643956 | 3300031823 | Hardwood Forest Soil | MKRSLRDISDAVEARLEGDGSLQLQGVASIDSASENDLVFVEEEKYFPAALKC |
| Ga0307478_104568573 | 3300031823 | Hardwood Forest Soil | MRSLQQVAATIDARLEGDSGVEVGGVASLGSASKYDLVFV |
| Ga0307478_116746162 | 3300031823 | Hardwood Forest Soil | MKRSLQQIAEAVGVRLIGDGSAEVSGVASIGSATPDDLVFVEDE |
| Ga0311301_122761942 | 3300032160 | Peatlands Soil | MKHQVKPRSLHEIAEAVGARLIGDGHIAVTGVASIESAAQEDLVFVEDEKHLAAALR |
| Ga0348332_107798241 | 3300032515 | Plant Litter | MKRSLQHIAEAVGARLIGEGRVEVSAVASIESASPSDLVFVEDEKHLP |
| Ga0348332_129972341 | 3300032515 | Plant Litter | MKRSLQEIADAVGAHLCGDGSVEIGGVASIGSASQHDLVF |
| Ga0335078_116641812 | 3300032805 | Soil | MKRSLREIADALGARLIGDGQVEVGAVASVESATRGDLIFVEDEKHLNAAD |
| Ga0335078_125745581 | 3300032805 | Soil | MKRSLQQIADAVGARLLGDKGEVAGVASIASATPEDLVFV |
| Ga0335080_104499721 | 3300032828 | Soil | MKVASRQIAEATGARLIGPGDVEISGIASFESATAQDLVFVENEKH |
| Ga0326727_107679152 | 3300033405 | Peat Soil | MKRSVRQIADAVGARLLGGDSIAVGSVEVSGVSSLESASPEDLVFVDDDKHLAAALQ |
| ⦗Top⦘ |