Basic Information | |
---|---|
Family ID | F070415 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 40 residues |
Representative Sequence | PIPVGLGAALAISLAATIYLGVLPGRVLDYASRSVVELLR |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.37 % |
% of genes from short scaffolds (< 2000 bps) | 89.43 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.130 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.512 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.407 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF00137 | ATP-synt_C | 14.63 |
PF00005 | ABC_tran | 4.88 |
PF00924 | MS_channel | 4.88 |
PF00119 | ATP-synt_A | 3.25 |
PF00578 | AhpC-TSA | 2.44 |
PF09861 | Lar_N | 1.63 |
PF12698 | ABC2_membrane_3 | 0.81 |
PF12867 | DinB_2 | 0.81 |
PF01553 | Acyltransferase | 0.81 |
PF00528 | BPD_transp_1 | 0.81 |
PF01740 | STAS | 0.81 |
PF02371 | Transposase_20 | 0.81 |
PF03737 | RraA-like | 0.81 |
PF02566 | OsmC | 0.81 |
PF12730 | ABC2_membrane_4 | 0.81 |
PF07609 | DUF1572 | 0.81 |
PF09527 | ATPase_gene1 | 0.81 |
PF00571 | CBS | 0.81 |
PF00300 | His_Phos_1 | 0.81 |
PF00072 | Response_reg | 0.81 |
PF14815 | NUDIX_4 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 14.63 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 4.88 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 4.88 |
COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 3.25 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.81 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.67 % |
Unclassified | root | N/A | 33.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10178436 | Not Available | 754 | Open in IMG/M |
3300003218|JGI26339J46600_10131377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 593 | Open in IMG/M |
3300004092|Ga0062389_101523616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 852 | Open in IMG/M |
3300004152|Ga0062386_101632659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 538 | Open in IMG/M |
3300004799|Ga0058863_11350039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 589 | Open in IMG/M |
3300005177|Ga0066690_10442298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300005332|Ga0066388_100646666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1673 | Open in IMG/M |
3300005366|Ga0070659_101331498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 637 | Open in IMG/M |
3300005434|Ga0070709_10616740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 837 | Open in IMG/M |
3300005439|Ga0070711_101826872 | Not Available | 533 | Open in IMG/M |
3300005457|Ga0070662_101893075 | Not Available | 515 | Open in IMG/M |
3300005467|Ga0070706_100044120 | All Organisms → cellular organisms → Bacteria | 4119 | Open in IMG/M |
3300005529|Ga0070741_11475564 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005534|Ga0070735_10438118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 781 | Open in IMG/M |
3300005542|Ga0070732_10981802 | Not Available | 516 | Open in IMG/M |
3300005553|Ga0066695_10312648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
3300005614|Ga0068856_100547536 | Not Available | 1178 | Open in IMG/M |
3300005897|Ga0075281_1047708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
3300005897|Ga0075281_1090523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 520 | Open in IMG/M |
3300005903|Ga0075279_10075404 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005921|Ga0070766_10144160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
3300005993|Ga0080027_10137597 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300006028|Ga0070717_10034111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4111 | Open in IMG/M |
3300006050|Ga0075028_100214987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
3300006059|Ga0075017_101322715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 566 | Open in IMG/M |
3300006175|Ga0070712_100012689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 5363 | Open in IMG/M |
3300006755|Ga0079222_10020425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2643 | Open in IMG/M |
3300006755|Ga0079222_11819923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300006881|Ga0068865_100854930 | Not Available | 788 | Open in IMG/M |
3300006904|Ga0075424_100298714 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300007265|Ga0099794_10753321 | Not Available | 520 | Open in IMG/M |
3300009137|Ga0066709_103173853 | Not Available | 600 | Open in IMG/M |
3300009137|Ga0066709_104319751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300009143|Ga0099792_11203889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300009156|Ga0111538_11984734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300009522|Ga0116218_1481319 | Not Available | 553 | Open in IMG/M |
3300009792|Ga0126374_10695722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 764 | Open in IMG/M |
3300009839|Ga0116223_10235381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1109 | Open in IMG/M |
3300009839|Ga0116223_10408936 | Not Available | 797 | Open in IMG/M |
3300010046|Ga0126384_11964026 | Not Available | 559 | Open in IMG/M |
3300010329|Ga0134111_10037319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
3300010339|Ga0074046_10170089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
3300010339|Ga0074046_10662337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300010339|Ga0074046_10714737 | Not Available | 588 | Open in IMG/M |
3300010339|Ga0074046_10766527 | Not Available | 565 | Open in IMG/M |
3300010371|Ga0134125_11997837 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010379|Ga0136449_100830924 | Not Available | 1520 | Open in IMG/M |
3300010398|Ga0126383_10488785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1287 | Open in IMG/M |
3300010400|Ga0134122_10095330 | Not Available | 2348 | Open in IMG/M |
3300011120|Ga0150983_14556019 | Not Available | 653 | Open in IMG/M |
3300011269|Ga0137392_10223034 | Not Available | 1547 | Open in IMG/M |
3300012209|Ga0137379_10939292 | Not Available | 769 | Open in IMG/M |
3300012469|Ga0150984_110109560 | Not Available | 576 | Open in IMG/M |
3300012929|Ga0137404_11328031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300012931|Ga0153915_10549805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1324 | Open in IMG/M |
3300012961|Ga0164302_11786648 | Not Available | 519 | Open in IMG/M |
3300012971|Ga0126369_10680790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300012986|Ga0164304_10612318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300013296|Ga0157374_12677643 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300014311|Ga0075322_1095801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300015259|Ga0180085_1081264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300015264|Ga0137403_11152124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300017823|Ga0187818_10181077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
3300017930|Ga0187825_10235260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300017934|Ga0187803_10070926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1371 | Open in IMG/M |
3300017939|Ga0187775_10076832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1077 | Open in IMG/M |
3300017973|Ga0187780_11361823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300017974|Ga0187777_10369096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 989 | Open in IMG/M |
3300017975|Ga0187782_10252722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
3300018001|Ga0187815_10177438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300018014|Ga0187860_1030368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2952 | Open in IMG/M |
3300018043|Ga0187887_10257300 | Not Available | 1033 | Open in IMG/M |
3300018058|Ga0187766_10928586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300018060|Ga0187765_11106271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300018088|Ga0187771_11591431 | Not Available | 555 | Open in IMG/M |
3300018090|Ga0187770_10177042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1635 | Open in IMG/M |
3300020001|Ga0193731_1065139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300020581|Ga0210399_10684075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300021080|Ga0210382_10445525 | Not Available | 574 | Open in IMG/M |
3300021170|Ga0210400_11052990 | Not Available | 660 | Open in IMG/M |
3300021388|Ga0213875_10218533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 898 | Open in IMG/M |
3300021406|Ga0210386_10390335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1199 | Open in IMG/M |
3300021420|Ga0210394_10437652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1151 | Open in IMG/M |
3300021432|Ga0210384_10099905 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300021433|Ga0210391_10845144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300021433|Ga0210391_11249438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300021478|Ga0210402_11978328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300025320|Ga0209171_10554313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300025664|Ga0208849_1159126 | Not Available | 581 | Open in IMG/M |
3300027662|Ga0208565_1101998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300027667|Ga0209009_1112004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300027812|Ga0209656_10129075 | Not Available | 1292 | Open in IMG/M |
3300027829|Ga0209773_10222456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 789 | Open in IMG/M |
3300027862|Ga0209701_10725449 | Not Available | 509 | Open in IMG/M |
3300027869|Ga0209579_10505238 | Not Available | 656 | Open in IMG/M |
3300027879|Ga0209169_10239998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
3300027894|Ga0209068_10573135 | Not Available | 655 | Open in IMG/M |
3300027905|Ga0209415_10989689 | Not Available | 561 | Open in IMG/M |
3300028037|Ga0265349_1030640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300031231|Ga0170824_105952097 | Not Available | 965 | Open in IMG/M |
3300031231|Ga0170824_111736201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300031234|Ga0302325_11534106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300031244|Ga0302297_1093711 | Not Available | 551 | Open in IMG/M |
3300031708|Ga0310686_104709760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300031715|Ga0307476_10063062 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
3300031715|Ga0307476_10288309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1203 | Open in IMG/M |
3300031788|Ga0302319_10527843 | Not Available | 1257 | Open in IMG/M |
3300031879|Ga0306919_10286129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1248 | Open in IMG/M |
3300031946|Ga0310910_10658754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 829 | Open in IMG/M |
3300031954|Ga0306926_10336698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1867 | Open in IMG/M |
3300032059|Ga0318533_10970469 | Not Available | 623 | Open in IMG/M |
3300032180|Ga0307471_100088053 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
3300032205|Ga0307472_100321633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
3300032770|Ga0335085_10118181 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
3300032805|Ga0335078_12517916 | Not Available | 530 | Open in IMG/M |
3300032892|Ga0335081_10436564 | Not Available | 1670 | Open in IMG/M |
3300032893|Ga0335069_10097648 | All Organisms → cellular organisms → Bacteria | 3717 | Open in IMG/M |
3300032896|Ga0335075_11486097 | Not Available | 565 | Open in IMG/M |
3300032955|Ga0335076_11346009 | Not Available | 599 | Open in IMG/M |
3300033004|Ga0335084_11517057 | Not Available | 662 | Open in IMG/M |
3300033158|Ga0335077_12232014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 502 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.13% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.50% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.25% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.44% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.63% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.63% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.63% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.63% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031244 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_101784362 | 3300000567 | Peatlands Soil | PLGVALALTVAATIYLGVLPGRVLDYASRGAALLTR* |
JGI26339J46600_101313772 | 3300003218 | Bog Forest Soil | RIPMGLGIGLAISLVATIYLGVLPGRVLGYAMESAQDLLK* |
Ga0062389_1015236161 | 3300004092 | Bog Forest Soil | PIPLGLGAALAISLATTIYLGVLPGRVLDYAARTASEWAR* |
Ga0062386_1016326592 | 3300004152 | Bog Forest Soil | SIPAGLGVALAISLIATIYLGVLPGRVLSYAIESAQDLLK* |
Ga0058863_113500392 | 3300004799 | Host-Associated | VMPMPASVGFSLAVSVLATIYLGVLPGRVLEYALQSARDLIR* |
Ga0066690_104422981 | 3300005177 | Soil | EPAPLAPIPFGVSAALAISALATIYLGILPGRVLEYASQSAADLLR* |
Ga0066388_1006466662 | 3300005332 | Tropical Forest Soil | EPRDEVPVTPMSSGLRVALAISLAATIYLGVLPGRVLEYAHRSVNLLR* |
Ga0070659_1013314981 | 3300005366 | Corn Rhizosphere | TPIPAGLGFALTLSLALTIYLGVLPNRVLEYASRSVGLLR* |
Ga0070709_106167402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PIPMGLGLALALSLAATIYLGVLPNRVLEYASRSVNLLR* |
Ga0070711_1018268722 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EVPVTPIPAGLGLALALSLAVTIYLGVLPNRVLEYAGRSVNLLR* |
Ga0070662_1018930751 | 3300005457 | Corn Rhizosphere | AVPPVSFSLGSALAISVVATLYLGILPGRVLDYARSAAEYIR* |
Ga0070706_1000441201 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPIPFGVSAALAISALATIYLGILPGRVLECASQSAADLLR* |
Ga0070741_114755641 | 3300005529 | Surface Soil | REPREDTAVAPVTPGLGLALGLSLAVTIYLGILPGRVLEYAGRSVDLLR* |
Ga0070735_104381181 | 3300005534 | Surface Soil | LGLGTALAISLAATIYLGVLPGRVLDYAARTVADWAH* |
Ga0070732_109818021 | 3300005542 | Surface Soil | GLGVALAISLIATIYLGVLPGRVLDYASKSAAQLIR* |
Ga0066695_103126481 | 3300005553 | Soil | IPLGVSAALTISALATIYLGVLPGRVLEYTSRSAADLLR* |
Ga0068856_1005475362 | 3300005614 | Corn Rhizosphere | AGLGVGLAISAIATIYLGVLPGRVLEYALRGAQELIR* |
Ga0075281_10477081 | 3300005897 | Rice Paddy Soil | MTAAVGLSLAISAIVTIYLGVLPDRALQYALDGARALVR* |
Ga0075281_10905232 | 3300005897 | Rice Paddy Soil | GLAVAISVIATLYLGVLPGRVLDYALQSAKQLIQ* |
Ga0075279_100754041 | 3300005903 | Rice Paddy Soil | PVSPVPWSLGTALAVSLLATIYLGVLPGRVLEYATRSAAELMR* |
Ga0070766_101441601 | 3300005921 | Soil | GAALTISLAATIYLGVLPGRVIEYASRTATAWSR* |
Ga0080027_101375973 | 3300005993 | Prmafrost Soil | REEAPLPRIPAGLGTALAISVAATIYLGVLPGRVLEYASQSVSQLLR* |
Ga0070717_100341114 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PVTPIPVGLGLALGLSLAVTIYLGVLPNRVLEYAGRSVDLLR* |
Ga0075028_1002149873 | 3300006050 | Watersheds | LGAALAISAFLTLYLGLLPGRVLEYARSAAELLR* |
Ga0075017_1013227151 | 3300006059 | Watersheds | PIPVGLGAALAISLAATIYLGVLPGRVLDYASRSVVELLR* |
Ga0070712_1000126891 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGVALALSLAATIYLGVLPNRVLEYASRSVNLLR* |
Ga0079222_100204255 | 3300006755 | Agricultural Soil | AMPASVGFSVAAAAIATIYLGVLPGRVLDYALQGARALIK* |
Ga0079222_118199231 | 3300006755 | Agricultural Soil | LGVALAISLVATIYLGVLPGRVLDYATKSAEQLMR* |
Ga0068865_1008549302 | 3300006881 | Miscanthus Rhizosphere | PIPVALGVALAISLIATLYLGLLPGRVLDYASRSVAELTR* |
Ga0075424_1002987145 | 3300006904 | Populus Rhizosphere | SAALGTALAISAAATLYLGILPGRVLEYASRSAADLMR* |
Ga0099794_107533212 | 3300007265 | Vadose Zone Soil | MREAREPAPLAPIPFGVSAALAISALATIYLGILPGRVLEYASQSAADLLR* |
Ga0066709_1031738531 | 3300009137 | Grasslands Soil | KEETLVAPIPPGLGIALALSLAATIYLGVLPGRVLEYAGRSVGELLH* |
Ga0066709_1043197511 | 3300009137 | Grasslands Soil | VSAALAISALATIYLGILPGRVLEYASRSAADLLR* |
Ga0099792_112038893 | 3300009143 | Vadose Zone Soil | GLAIALALSLAATIYLGVLPGRVLDYAGQSVGLLH* |
Ga0111538_119847341 | 3300009156 | Populus Rhizosphere | EVAPISFSLGSAIAISVIATLYLGILPGRVLEFASRSAADLVR* |
Ga0116218_14813192 | 3300009522 | Peatlands Soil | LGVALALTVAATIYLGVLPGRVLDYASRGAALLTR* |
Ga0126374_106957223 | 3300009792 | Tropical Forest Soil | PVPGMPASLGTAVAISLLATLYLGVLPDRVLEDAIHAAQDLVK* |
Ga0116223_102353813 | 3300009839 | Peatlands Soil | VPVSPVPFGLGAALAISLGATIYLGVLPGRILDYAARTAAEWAR* |
Ga0116223_104089362 | 3300009839 | Peatlands Soil | VSAPLGVALALTVAATIYLGVLPGRVLDYASRGAALLTR* |
Ga0126384_119640261 | 3300010046 | Tropical Forest Soil | SMPASLGVAVAICVIVTIYLGVLPNRVLGDAIRAAQDLVK* |
Ga0134111_100373193 | 3300010329 | Grasslands Soil | LRAALTLTVFATIYLGILPGRVLEYASRSATELLRQ* |
Ga0074046_101700893 | 3300010339 | Bog Forest Soil | PMGLGIGLAISLVATIYLGVLPGRVLGYAIESAQDLLK* |
Ga0074046_106623371 | 3300010339 | Bog Forest Soil | PVPFGLGTALAISLAATIYLGVLPGRVIDYAARTAAEWAR* |
Ga0074046_107147371 | 3300010339 | Bog Forest Soil | QVDAPIDPIPAGLGWALAISLVATIYLGVLPGRILDYASRSVAELLR* |
Ga0074046_107665272 | 3300010339 | Bog Forest Soil | GVALALTVAATIYLGVLPGRVLDYASRGAALLTR* |
Ga0134125_119978372 | 3300010371 | Terrestrial Soil | LGVSLAACLLATIYLGVLPGRVLDYAIESARVLTR* |
Ga0136449_1008309241 | 3300010379 | Peatlands Soil | QSVSAPLGVALALTVAATIYLGVLPGRVLDYASRGAALLMR* |
Ga0126383_104887851 | 3300010398 | Tropical Forest Soil | LGSAVAISLIATIYLGVLPNRVLENAVRAAQDLVR* |
Ga0134122_100953302 | 3300010400 | Terrestrial Soil | EAVPVTPIPAGLGFALTLSLALTIYLGVLPNRVLEYASRSVGLLR* |
Ga0150983_145560192 | 3300011120 | Forest Soil | ASLGAALAVSVAATLYLGILPGQVLEYASRSATELLR* |
Ga0137392_102230343 | 3300011269 | Vadose Zone Soil | GAAIGISIAATLYLGLLPGRVLEYASRSAAELLH* |
Ga0137379_109392921 | 3300012209 | Vadose Zone Soil | EPREEALVSAVPAGLAIALALSLAATIYLGVLPNRVLEYAGQSVGLLH* |
Ga0150984_1101095601 | 3300012469 | Avena Fatua Rhizosphere | NIPAGLGIALALSLAATVYLGVLPGRILEYAGRSVDLLH* |
Ga0137404_113280311 | 3300012929 | Vadose Zone Soil | PLGVSAALAISALATIYLGILPGRVLEYASQSAADLLR* |
Ga0153915_105498051 | 3300012931 | Freshwater Wetlands | DTPMIPMPPALGLSLAASLFATIYLGVLPGRVLDYAIQSARDLVK* |
Ga0164302_117866483 | 3300012961 | Soil | SLPVASIPAGLGIALALSLAATVYLGVLPGRILEYAGRSVDLLH* |
Ga0126369_106807902 | 3300012971 | Tropical Forest Soil | PMSSGLRVALAISLAATIYLGVLPGRVLEYAHRSVNLLR* |
Ga0164304_106123181 | 3300012986 | Soil | EARESVPLDPIPVGVSAALVISTLATIYLGIFPGRVLEYASRSAADLLR* |
Ga0157374_126776431 | 3300013296 | Miscanthus Rhizosphere | IPLGLGVGLAISAIATIYLGVLPGRVLEYAIRGAQDLMK* |
Ga0075322_10958012 | 3300014311 | Natural And Restored Wetlands | EEIAVAPVPAALGTALAVTLLATIYLGVLPGRVLEYASRSAADLMH* |
Ga0180085_10812641 | 3300015259 | Soil | MPAALGVSLAAAALATIYLGVLPGRVLDYALQGARDLMR* |
Ga0137403_111521242 | 3300015264 | Vadose Zone Soil | AREPVPLAPIPFGVSAALAISALATIYLGILPGRVLEYASRSAADLLR* |
Ga0132258_119351023 | 3300015371 | Arabidopsis Rhizosphere | ALGAALAISVAATLYLGLLPGRVLEFASRSAAELLH* |
Ga0187818_101810773 | 3300017823 | Freshwater Sediment | GMPLGIALTLAVAATIYLGVLPGRVLDYASRGAALLVR |
Ga0187825_102352602 | 3300017930 | Freshwater Sediment | VVPVMRIPPALATALAISLIATIYLGVLPGRVLEYASKSASALLR |
Ga0187803_100709261 | 3300017934 | Freshwater Sediment | VQSVSAPLGVALALTVAATIYLGVLPGRVLDYASRGAALLTR |
Ga0187775_100768323 | 3300017939 | Tropical Peatland | PLGVALTFALAATIYLGVLPGRVLDYASRGAALLVR |
Ga0187780_113618231 | 3300017973 | Tropical Peatland | SPVPAGLGAALAISLMTTIYLGILPGRVLKYAAQTATAWMR |
Ga0187777_103690961 | 3300017974 | Tropical Peatland | TPVASVPLGLGAALITSLALTIYLGVLPGRVLAYASRSAAGLLR |
Ga0187782_102527223 | 3300017975 | Tropical Peatland | ASVSVPLGVALTLTVAATIYLGVLPGRVLDYASRGAALLVR |
Ga0187815_101774382 | 3300018001 | Freshwater Sediment | RIPLGLGTALAVSLAATIYLGVLPGRVLDYAARTAAEWAR |
Ga0187860_10303681 | 3300018014 | Peatland | LGIGLAISLIMTIYLGVLPGRVIEYAIQGAQDLLK |
Ga0187887_102573003 | 3300018043 | Peatland | IPAGLGIGLAISLIATIYLGVLPGRVLDYAMQSAQDLMK |
Ga0187766_109285862 | 3300018058 | Tropical Peatland | GLGTALAISLVATVYLGVLPGRVLDFAARSVSELAH |
Ga0187765_111062711 | 3300018060 | Tropical Peatland | GLGTALAISLATTIYLGVLPGRVLSYAAQTASAWMR |
Ga0187771_115914312 | 3300018088 | Tropical Peatland | LGIALTLTVAATIYLGVLPGRVLDYASRGAALLVR |
Ga0187770_101770423 | 3300018090 | Tropical Peatland | AHIPAALGIGLAISLIATIYLGVLPGRVLGYAMESAQELLK |
Ga0193731_10651391 | 3300020001 | Soil | AREPAPLAPIPFGVSAALAISALATIYLGILPGRVLEYASRSAADLLR |
Ga0193730_11445521 | 3300020002 | Soil | PVPAALGIALAVSSIATLYLGLLPGRVLDYASRSVAELTR |
Ga0210399_106840753 | 3300020581 | Soil | VAAIPASLGAALAVSLAATLYLGILPGQVLEYASRSATELLR |
Ga0210382_104455252 | 3300021080 | Groundwater Sediment | EAAVRPIPATLGIALAVSLIATLYLGLLPGRVLDYASRSVGELTR |
Ga0210400_110529903 | 3300021170 | Soil | PAGLGIGLAISLIATIYLGVMPGRVLEHAVQSAQDLIK |
Ga0213875_102185332 | 3300021388 | Plant Roots | PSRLGIALGLSLAATIYLGILPGRILEYAARSVALLR |
Ga0210386_103903353 | 3300021406 | Soil | LGAALAISLAATIYLGVLPGRLLDYAARTAAEWAR |
Ga0210394_104376521 | 3300021420 | Soil | IPLGLGAALAISLAATIYLGVLPGRLLDYAARTAAEWAR |
Ga0210384_100999051 | 3300021432 | Soil | EVPLAPIPLGLGTALAISLAATIYLGVLPGRVLDYAARTAAEWAR |
Ga0210391_108451442 | 3300021433 | Soil | ALPRIPFALGTALAISVATTIYLGVLPGRVLDYAARTAAEWAR |
Ga0210391_112494381 | 3300021433 | Soil | PLGLGAALAISLAATIYLGVLPGRLLDYAARTAAEWAR |
Ga0210402_119783282 | 3300021478 | Soil | GLGAALAISLVATIYLGVLPGQVLEYAARTATEWAR |
Ga0209171_105543131 | 3300025320 | Iron-Sulfur Acid Spring | ALPRIPFALGTALAISVVATIYLGVLPGRVLDYAARTAAEWAR |
Ga0208849_11591261 | 3300025664 | Arctic Peat Soil | TAPLPSIPAGLGAALALSVAATIYLGVLPGRVLEYASQSVAQLLH |
Ga0208565_11019982 | 3300027662 | Peatlands Soil | EPKGEISVSPIPAGLGTALAISLVATIYMGVLPGRLLDYAARSVNELLH |
Ga0209009_11120042 | 3300027667 | Forest Soil | RESVPLAPIPFGVSVALAISALATIYLGILPGRVLDYASRAAVDLLR |
Ga0209656_101290751 | 3300027812 | Bog Forest Soil | IPAGLGIGLAISVIATIYLGVLPGRVLEYAIHGAQDLMK |
Ga0209773_102224563 | 3300027829 | Bog Forest Soil | LGFALAFSLAATIYLGVLPGRVLEYASRTATAWAR |
Ga0209701_107254493 | 3300027862 | Vadose Zone Soil | ATVSPIPAGLGVALALSLAATIYLGVLPGRVLEYAGRSVGLLR |
Ga0209579_105052383 | 3300027869 | Surface Soil | AGVGTALAISLGATIYLGVLPGRVLDYASRSVGELLR |
Ga0209169_102399981 | 3300027879 | Soil | ISVPRIPIGLGFALAISLVATIYLGVLPGRVLDYASRTAAAWAR |
Ga0209068_105731353 | 3300027894 | Watersheds | PALGAALAISVAATLYLGLLPGRVLEYASRSAAELLH |
Ga0209415_109896891 | 3300027905 | Peatlands Soil | PLGVALALTVAATIYLGVLPGRVLDYASRGAALLTR |
Ga0265349_10306402 | 3300028037 | Soil | PIPLGLGTALAISLAATIYLGVLPGRLLDYAARTAAAWAH |
Ga0170824_1059520971 | 3300031231 | Forest Soil | APLSISLSTALAISVIATIYLGILPGRVLEFAARSATELMR |
Ga0170824_1117362011 | 3300031231 | Forest Soil | LGTALAICLATTLYLGLLPGRVLDYASRSVADLVH |
Ga0302325_115341062 | 3300031234 | Palsa | GLGSALAICLAATIYLGVLPGRVLEYASRSAAELLH |
Ga0302297_10937111 | 3300031244 | Fen | RMPFALGAAVAISAVATIYLGVLPNRVLDGAIHAAQDLIR |
Ga0310686_1047097601 | 3300031708 | Soil | GLGAALAISLAATIYLGVLPGRLLDYAARTATEWAR |
Ga0307476_100630621 | 3300031715 | Hardwood Forest Soil | REPRGEVPVTPISPSLGTALVLSVLATIYLGVLPSRVLDYAARSVAAWTH |
Ga0307476_102883093 | 3300031715 | Hardwood Forest Soil | EDIALPRIPFALGTALAISVVATIYLGVLPGRVLDFVARTAAEWAR |
Ga0302319_105278431 | 3300031788 | Bog | GLGIGLTISLIATIYLGVLPGRILYYAMQSAQDLLK |
Ga0306919_102861293 | 3300031879 | Soil | PAGLGVAVAISLIATIYLGVLPNRVLDDAVRAAQDLVK |
Ga0310910_106587543 | 3300031946 | Soil | MPAGLGVAVAISLIATLYLGVLPNRVLGDAVKAAQDLVK |
Ga0306926_103366984 | 3300031954 | Soil | PPMPASLGSAVAISLIATIYLGVLPNRVLDDAIRAAQDLVK |
Ga0318533_109704692 | 3300032059 | Soil | TPVAPISVSLGVGIAISLIATIYLGVLPNRVLADAVRAAQDLLK |
Ga0307471_1000880531 | 3300032180 | Hardwood Forest Soil | AVSPVSLGLGAALAVSLTITLYLGVLPAQVLKYASQSATSLVR |
Ga0307472_1003216331 | 3300032205 | Hardwood Forest Soil | PIPVGLGLALGLSLAVTIYLGVLPNRVLEYAGRSVDLLR |
Ga0335085_101181811 | 3300032770 | Soil | VAPVPLGLGTALVVSLAATIYLGVLPGRVLEYASRSAAQLLR |
Ga0335078_125179161 | 3300032805 | Soil | DVPVAPIPLGLGTALAISLIATIYLGVLPGRVLDYAGQSVSQLMH |
Ga0335081_104365642 | 3300032892 | Soil | ASLPPVPAAMGVALAVSVVATLYLGILPGRVLDYASRSAADLMK |
Ga0335069_100976486 | 3300032893 | Soil | PVGLGTALAISVLATLYLGILPGRVLQYAARSAAQLMQ |
Ga0335075_114860971 | 3300032896 | Soil | PAGLGIGLAISLIATIYLGVLPGRVLEYAIQSAQDLMK |
Ga0335076_113460091 | 3300032955 | Soil | TLGVGLAISLAATIYLGVLPGRVLDYAVQSAQDLMK |
Ga0335084_115170571 | 3300033004 | Soil | LGVSLAVSALATIYLGVLPGRVLEYALQGARDLMK |
Ga0335077_122320141 | 3300033158 | Soil | RIPAGLGAAMAISLIATIYLGVLPNRVLDNAVRAAQDLLR |
⦗Top⦘ |