NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070403

Metagenome / Metatranscriptome Family F070403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070403
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 37 residues
Representative Sequence PIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE
Number of Associated Samples 91
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 96.75 %
% of genes from short scaffolds (< 2000 bps) 93.50 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.138 % of family members)
Environment Ontology (ENVO) Unclassified
(38.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.789 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.95%    β-sheet: 16.22%    Coil/Unstructured: 37.84%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF04392ABC_sub_bind 69.92
PF00072Response_reg 4.07
PF03401TctC 2.44
PF02627CMD 1.63
PF02371Transposase_20 1.63
PF07690MFS_1 0.81
PF07045DUF1330 0.81
PF03988DUF347 0.81
PF02913FAD-oxidase_C 0.81
PF12680SnoaL_2 0.81
PF02743dCache_1 0.81
PF00589Phage_integrase 0.81
PF13185GAF_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 69.92
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.44
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.63
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.63
COG3547TransposaseMobilome: prophages, transposons [X] 1.63
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.81
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.81
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 0.81
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17172157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2653Open in IMG/M
3300000955|JGI1027J12803_101207701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium511Open in IMG/M
3300005332|Ga0066388_104787523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium688Open in IMG/M
3300005332|Ga0066388_108031814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3527Open in IMG/M
3300005598|Ga0066706_10379077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1124Open in IMG/M
3300005713|Ga0066905_100310797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1242Open in IMG/M
3300005713|Ga0066905_100312854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.31238Open in IMG/M
3300005713|Ga0066905_101579428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium600Open in IMG/M
3300005713|Ga0066905_102117654All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300005764|Ga0066903_101049395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1496Open in IMG/M
3300005764|Ga0066903_101649352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1218Open in IMG/M
3300005764|Ga0066903_101975799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1119Open in IMG/M
3300005764|Ga0066903_104768090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium721Open in IMG/M
3300005764|Ga0066903_106037107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales634Open in IMG/M
3300005764|Ga0066903_106302801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium619Open in IMG/M
3300005764|Ga0066903_107274930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium572Open in IMG/M
3300006032|Ga0066696_10428265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium865Open in IMG/M
3300006175|Ga0070712_100359596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1193Open in IMG/M
3300006575|Ga0074053_11932189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales587Open in IMG/M
3300006794|Ga0066658_10187497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.31085Open in IMG/M
3300006797|Ga0066659_11194242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales635Open in IMG/M
3300006847|Ga0075431_100699876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium991Open in IMG/M
3300006871|Ga0075434_101188423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium775Open in IMG/M
3300007258|Ga0099793_10726766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300007265|Ga0099794_10388679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7728Open in IMG/M
3300009100|Ga0075418_11972855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300009522|Ga0116218_1099452All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300009792|Ga0126374_10180562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1314Open in IMG/M
3300010046|Ga0126384_10926715All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300010046|Ga0126384_12223908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300010048|Ga0126373_11454514All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300010358|Ga0126370_10133545All Organisms → cellular organisms → Bacteria → Proteobacteria1781Open in IMG/M
3300010358|Ga0126370_10342369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1205Open in IMG/M
3300010360|Ga0126372_10881504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium895Open in IMG/M
3300010362|Ga0126377_10212517All Organisms → cellular organisms → Bacteria1861Open in IMG/M
3300010366|Ga0126379_10031939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4126Open in IMG/M
3300010366|Ga0126379_11106977All Organisms → cellular organisms → Bacteria → Proteobacteria898Open in IMG/M
3300010376|Ga0126381_101369543All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300010398|Ga0126383_11295766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium818Open in IMG/M
3300010398|Ga0126383_11660643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300012199|Ga0137383_10603741All Organisms → cellular organisms → Bacteria → Proteobacteria803Open in IMG/M
3300012202|Ga0137363_10570215All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans954Open in IMG/M
3300012202|Ga0137363_11040834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300012205|Ga0137362_10342559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1294Open in IMG/M
3300012205|Ga0137362_10487858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1066Open in IMG/M
3300012210|Ga0137378_11149945All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300012211|Ga0137377_11852570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes522Open in IMG/M
3300012355|Ga0137369_10231047All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300012357|Ga0137384_10349077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1226Open in IMG/M
3300012361|Ga0137360_10216287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1559Open in IMG/M
3300012362|Ga0137361_11965250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300012948|Ga0126375_10685109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300012948|Ga0126375_10850982All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300012957|Ga0164303_10424861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales828Open in IMG/M
3300012971|Ga0126369_12940723All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300012988|Ga0164306_11501120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales577Open in IMG/M
3300015356|Ga0134073_10344782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300015372|Ga0132256_100683210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1142Open in IMG/M
3300015373|Ga0132257_104349366All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300016270|Ga0182036_11332104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300016270|Ga0182036_11677986All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300016294|Ga0182041_10313461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1305Open in IMG/M
3300016319|Ga0182033_10774239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium844Open in IMG/M
3300016341|Ga0182035_10167728All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300016357|Ga0182032_10837599All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300016357|Ga0182032_11079873All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300016371|Ga0182034_11167384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300016371|Ga0182034_11869061All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300016387|Ga0182040_11178004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria644Open in IMG/M
3300016387|Ga0182040_11677056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300016404|Ga0182037_10434383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1089Open in IMG/M
3300018482|Ga0066669_10232903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1441Open in IMG/M
3300021168|Ga0210406_10949785All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300021444|Ga0213878_10116789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1092Open in IMG/M
3300021479|Ga0210410_11659718All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300025905|Ga0207685_10686099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300025915|Ga0207693_10185750All Organisms → cellular organisms → Bacteria → Proteobacteria1636Open in IMG/M
3300025928|Ga0207700_11135531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7698Open in IMG/M
3300026304|Ga0209240_1146140All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300026514|Ga0257168_1144486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium530Open in IMG/M
3300026550|Ga0209474_10630074All Organisms → cellular organisms → Bacteria → Proteobacteria550Open in IMG/M
3300026551|Ga0209648_10064718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3092Open in IMG/M
3300027616|Ga0209106_1120846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria587Open in IMG/M
3300027874|Ga0209465_10547704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300027905|Ga0209415_10071688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4106Open in IMG/M
3300028716|Ga0307311_10057988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1037Open in IMG/M
3300028778|Ga0307288_10459738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300031421|Ga0308194_10285750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300031543|Ga0318516_10871825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300031545|Ga0318541_10256720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium971Open in IMG/M
3300031546|Ga0318538_10650158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300031546|Ga0318538_10664736All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031549|Ga0318571_10208506All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031719|Ga0306917_10184164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1572Open in IMG/M
3300031719|Ga0306917_10184624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1570Open in IMG/M
3300031777|Ga0318543_10328590All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300031797|Ga0318550_10598545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300031798|Ga0318523_10176904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300031833|Ga0310917_10039717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2835Open in IMG/M
3300031833|Ga0310917_10120270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1709Open in IMG/M
3300031833|Ga0310917_10445813All Organisms → cellular organisms → Bacteria → Proteobacteria880Open in IMG/M
3300031860|Ga0318495_10099058All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300031890|Ga0306925_10106228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2991Open in IMG/M
3300031890|Ga0306925_10167254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2368Open in IMG/M
3300031890|Ga0306925_11104082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium801Open in IMG/M
3300031894|Ga0318522_10199937All Organisms → cellular organisms → Bacteria → Proteobacteria756Open in IMG/M
3300031896|Ga0318551_10299842All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300031912|Ga0306921_10022210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6977Open in IMG/M
3300031912|Ga0306921_10395922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1612Open in IMG/M
3300031941|Ga0310912_11031196All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300031942|Ga0310916_10329926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1294Open in IMG/M
3300031946|Ga0310910_10212991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1501Open in IMG/M
3300031946|Ga0310910_10540810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria924Open in IMG/M
3300031947|Ga0310909_10451398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1079Open in IMG/M
3300032039|Ga0318559_10599979All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300032063|Ga0318504_10355818All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300032064|Ga0318510_10371420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300032067|Ga0318524_10795206All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300032076|Ga0306924_10366684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1650Open in IMG/M
3300032076|Ga0306924_10421682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1526Open in IMG/M
3300032076|Ga0306924_10555104All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300032076|Ga0306924_10862818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1004Open in IMG/M
3300032261|Ga0306920_100771082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1413Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.44%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_039344002088090014SoilIEQSPRFYMAVNLKTAASLGVFLSDAFIARANGVRE
JGI1027J12803_10120770113300000955SoilEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVIE*
Ga0066388_10478752323300005332Tropical Forest SoilMLNSYLEPTPIEQSPRFYMAVNLKTAASLGVSLSDVFIARAN
Ga0066388_10803181413300005332Tropical Forest SoilDMPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0066706_1037907713300005598SoilIEQSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE*
Ga0066905_10031079723300005713Tropical Forest SoilIEQSPRFYMAVNLKAAAALGVSLSDVFVARANEVIE*
Ga0066905_10031285423300005713Tropical Forest SoilSDMPIEQSPRFYMAVNLKTAASLGISLSDVFIARANEVRE*
Ga0066905_10157942813300005713Tropical Forest SoilSDMPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE*
Ga0066905_10211765423300005713Tropical Forest SoilMPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0066903_10104939513300005764Tropical Forest SoilQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE*
Ga0066903_10164935243300005764Tropical Forest SoilIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0066903_10197579923300005764Tropical Forest SoilDIPIEQSAVNLKTAALLGVSLSDVFIARANEVRE*
Ga0066903_10476809013300005764Tropical Forest SoilMPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE*
Ga0066903_10603710723300005764Tropical Forest SoilPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE*
Ga0066903_10630280123300005764Tropical Forest SoilPIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE*
Ga0066903_10727493023300005764Tropical Forest SoilDMPIEQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE*
Ga0066696_1042826513300006032SoilEQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE*
Ga0070712_10035959633300006175Corn, Switchgrass And Miscanthus RhizosphereIEQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE*
Ga0074053_1193218923300006575SoilQSLRFHMAVNLKTAASLGISLSDSFVARANEVRE*
Ga0066658_1018749713300006794SoilPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE*
Ga0066659_1119424213300006797SoilDMPIEQSPRFYMAVNLKTAALLGVSLSDVFVARANEVRE*
Ga0075431_10069987623300006847Populus RhizosphereSDMPIEQSPRFYMAVNLKTAASLGVALSDVFVARANEVRE*
Ga0075434_10118842313300006871Populus RhizosphereEQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE*
Ga0099793_1072676613300007258Vadose Zone SoilQSPRFYMAVNLKAAASLGVSLSDVFIARANEVRE*
Ga0099794_1038867913300007265Vadose Zone SoilQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE*
Ga0075418_1197285513300009100Populus RhizosphereMPIEQSPRFYMAVNLKTAASLGVALPDVFVARANEVRE*
Ga0116218_109945233300009522Peatlands SoilMRPPHFDMAINLKTAASLGIVLPPSFTARTDEVIE*
Ga0126374_1018056213300009792Tropical Forest SoilQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE*
Ga0126384_1092671513300010046Tropical Forest SoilPIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE*
Ga0126384_1222390813300010046Tropical Forest SoilIEQSPRFYMAVNLKTAALLGVSLSDAFIARANEVRE*
Ga0126373_1145451413300010048Tropical Forest SoilEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE*
Ga0126370_1013354533300010358Tropical Forest SoilSDMPIEQSPRFYMAVNLKTAAALGISLSDVFVARANEVRE*
Ga0126370_1034236933300010358Tropical Forest SoilIEQSPRFYMAVNLKTAALLGVSLSDVFIARADEVIE*
Ga0126372_1088150433300010360Tropical Forest SoilSDMPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0126377_1021251713300010362Tropical Forest SoilQSPRFYMAVNLKAAAALGVSLSDVFVARANEVIE*
Ga0126379_1003193913300010366Tropical Forest SoilMPIEQSPRFYMAVNLKTAASLGVSLSDAFIARANEVIE*
Ga0126379_1110697723300010366Tropical Forest SoilQSPRFYMAVNLKTAAALGVSLSDVFIARANEVRE*
Ga0126381_10136954313300010376Tropical Forest SoilSDMPIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE*
Ga0126383_1129576613300010398Tropical Forest SoilIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE*
Ga0126383_1166064313300010398Tropical Forest SoilKQSVRVHLAVNLKTAASLGVSLSDAFVARADEVIE*
Ga0137383_1060374113300012199Vadose Zone SoilDMPIEQSPRFYMAVNLKTAASLGISLSDVLVARANEVRE*
Ga0137363_1057021513300012202Vadose Zone SoilIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE*
Ga0137363_1104083423300012202Vadose Zone SoilPPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE*
Ga0137362_1034255923300012205Vadose Zone SoilPIEQSPRFYMAVNLKTAASLGVSLSGVFIARANEVRE*
Ga0137362_1048785823300012205Vadose Zone SoilEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0137378_1114994513300012210Vadose Zone SoilQSPRFYMAVNLKAAASLGVSLSDVFVARANEVRE*
Ga0137377_1185257013300012211Vadose Zone SoilDMPIEQSPRFYMAVNLKTAALLGIPLSDVFIARANEVRE*
Ga0137369_1023104713300012355Vadose Zone SoilIEQSPRFYMAVNLKTAGLLGVSLSDVFVARANEVRE*
Ga0137384_1034907713300012357Vadose Zone SoilSDMPIEQSPRCYMAVNLKTASLLGVSLSAVFIARANEVCE*
Ga0137360_1021628713300012361Vadose Zone SoilMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE*
Ga0137361_1196525013300012362Vadose Zone SoilMPIEQSPRFYMAVNLKTAASIGASLSDVFIARANEVIE*
Ga0126375_1068510913300012948Tropical Forest SoilKPSDTPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE*
Ga0126375_1085098213300012948Tropical Forest SoilEQSPRFYMAVNLKTAASIGVALPDVFVARANEVRE*
Ga0164303_1042486113300012957SoilEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE*
Ga0126369_1294072313300012971Tropical Forest SoilQSVRVHLAVNLKTAASLGVSLSDAFVARADEVIE*
Ga0164306_1150112013300012988SoilMPIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE*
Ga0134073_1034478213300015356Grasslands SoilQSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE*
Ga0132256_10068321023300015372Arabidopsis RhizosphereMPIEQSPRFYMAVNLKTAASLGISLSDAFIARANEVIE*
Ga0132257_10434936613300015373Arabidopsis RhizosphereQSSRFHMAVNLKTAASLGISLSDAFVARADEVRE*
Ga0182036_1133210413300016270SoilMPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVIE
Ga0182036_1167798613300016270SoilEQSPRFYMAVNLKTAASIGVALPDVFVARANEVRE
Ga0182041_1031346133300016294SoilSEMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0182033_1077423923300016319SoilEQSPRFYMAVNLKTAAALGVSLSDVFVARANEVRE
Ga0182035_1016772833300016341SoilAKPSDMPIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE
Ga0182032_1083759923300016357SoilSDMPIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE
Ga0182032_1107987313300016357SoilKPSDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0182034_1116738413300016371SoilMPIEQSPRFYMAINLKAAASLGVSLSDVFIARANEVRE
Ga0182034_1186906123300016371SoilDLRIAQSSRFHMAVNLKTAAALGITLSDRFVARADEVRE
Ga0182040_1117800423300016387SoilPIEQSPRFYMAVNLKAAASLGISLSDVFVAPANEVRE
Ga0182040_1167705613300016387SoilDMPIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE
Ga0182037_1043438343300016404SoilDMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANGVRE
Ga0066669_1023290313300018482Grasslands SoilDMPIEQSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE
Ga0210406_1094978523300021168SoilDMPIEQSPRFYMAVNLKTAASLGISLSDAFTARANEVRE
Ga0213878_1011678923300021444Bulk SoilEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0210410_1165971823300021479SoilMPIEQSPRFYMAVNLKTAASLGISLSDAFIARANEVRE
Ga0207685_1068609923300025905Corn, Switchgrass And Miscanthus RhizosphereSDMPIEQSPRFYMAVNLKGAASLGISLSDVFVARANEVRE
Ga0207693_1018575033300025915Corn, Switchgrass And Miscanthus RhizosphereSDMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE
Ga0207700_1113553123300025928Corn, Switchgrass And Miscanthus RhizosphereEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0209240_114614023300026304Grasslands SoilEQSPRFYMAVNLKTATSLGVSLSDVFIARANEVIE
Ga0257168_114448613300026514SoilEMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0209474_1063007413300026550SoilPIEQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE
Ga0209648_1006471813300026551Grasslands SoilIEQSPRFYMGVNLKMAASLGVSLSDVFIARANEVRE
Ga0209106_112084623300027616Forest SoilKPSEMPIEQSLRFHMAVNLNTAASLGVSLSDSFVARANEVRE
Ga0209465_1054770423300027874Tropical Forest SoilIEQSPRFYMAVNLKTAASIGVSLSDVFVARANEVRE
Ga0209415_1007168823300027905Peatlands SoilMRPPHFDMAINLKTAASLGIVLPPSFTARTDEVIE
Ga0307311_1005798823300028716SoilEMPIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE
Ga0307288_1045973813300028778SoilPIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE
Ga0308194_1028575023300031421SoilIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE
Ga0318516_1087182513300031543SoilDMPIEQSPRFYMGVNLKTAASLGVSLTDVFIARANEVIE
Ga0318541_1025672013300031545SoilIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0318538_1065015813300031546SoilSHMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE
Ga0318538_1066473623300031546SoilMPIEQSPRFYMAVNLKTAASLGISLSDVFIARANEVRE
Ga0318571_1020850623300031549SoilEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE
Ga0306917_1018416433300031719SoilEQSPRFYMAVNLKTAALLGVSLSDVFVARANEVRE
Ga0306917_1018462413300031719SoilPSEMPIEQSPRFHMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0318543_1032859013300031777SoilMPIEQSPRFYMAVNLKTAALLGISLSDVFVARANEVRE
Ga0318550_1059854523300031797SoilPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE
Ga0318523_1017690413300031798SoilMPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE
Ga0310917_1003971773300031833SoilDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0310917_1012027033300031833SoilEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE
Ga0310917_1044581323300031833SoilPIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE
Ga0318495_1009905813300031860SoilSDMPIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE
Ga0306925_1010622813300031890SoilIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE
Ga0306925_1016725413300031890SoilIEQSPRFYMSVNLKTAASLGVSLSDVFVARANEVIE
Ga0306925_1110408213300031890SoilEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE
Ga0318522_1019993713300031894SoilDMPIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE
Ga0318551_1029984223300031896SoilSDMPIEQSPRFYMAINLKTAASLGVSLSDVFIARANEVRE
Ga0306921_1002221013300031912SoilPSDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0306921_1039592213300031912SoilMPIEQSPRFHMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0310912_1103119613300031941SoilDMPIEQSPRFYMAVNLKTAAALGVSLSDVFVARANEVRE
Ga0310916_1032992633300031942SoilEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE
Ga0310910_1021299113300031946SoilMPIEQSPRFYMAVNLKTAASLGVALPDVFVARANEVRE
Ga0310910_1054081043300031946SoilIEQSPRFYMAINLKTAAFLGVSLSDVFIARANEVRE
Ga0310909_1045139813300031947SoilKPSDMPIEQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE
Ga0318559_1059997913300032039SoilIEQSPRFYMAVNLKTAASLGISLSDVLVARANEVRE
Ga0318504_1035581823300032063SoilEQSPRFYMAVNLKTTASLGVSLSDVFIARANEVIE
Ga0318510_1037142013300032064SoilSDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE
Ga0318524_1079520623300032067SoilEMPIEQSPRFFMAVNLKAAALLGVSLSDVLVARANEVIE
Ga0306924_1036668433300032076SoilEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE
Ga0306924_1042168223300032076SoilPSEMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE
Ga0306924_1055510413300032076SoilEQSLRFHMAVNLKTAALLGVSLSDAFVARADEVIE
Ga0306924_1086281823300032076SoilSDMPIQQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE
Ga0306920_10077108243300032261SoilPPDTPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.