NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070379

Metagenome / Metatranscriptome Family F070379

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070379
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 40 residues
Representative Sequence VTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG
Number of Associated Samples 112
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 99.19 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.06 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.846 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.512 % of family members)
Environment Ontology (ENVO) Unclassified
(24.390 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(62.602 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.45%    β-sheet: 0.00%    Coil/Unstructured: 89.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF01799Fer2_2 65.85
PF03450CO_deh_flav_C 22.76
PF00941FAD_binding_5 4.88
PF07883Cupin_2 0.81
PF00202Aminotran_3 0.81
PF10604Polyketide_cyc2 0.81
PF01315Ald_Xan_dh_C 0.81
PF09118GO-like_E_set 0.81
PF01565FAD_binding_4 0.81
PF01957NfeD 0.81
PF00561Abhydrolase_1 0.81



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.85 %
All OrganismsrootAll Organisms47.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_103284042Not Available679Open in IMG/M
3300000956|JGI10216J12902_106539592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3168Open in IMG/M
3300000956|JGI10216J12902_111876466All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300001686|C688J18823_10137183Not Available1685Open in IMG/M
3300004479|Ga0062595_100127393All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300004643|Ga0062591_101418693Not Available690Open in IMG/M
3300005093|Ga0062594_101430392All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005172|Ga0066683_10567424All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005364|Ga0070673_101113767All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005434|Ga0070709_10116524All Organisms → cellular organisms → Bacteria1804Open in IMG/M
3300005437|Ga0070710_11249142Not Available551Open in IMG/M
3300005437|Ga0070710_11460550Not Available513Open in IMG/M
3300005468|Ga0070707_101888209Not Available565Open in IMG/M
3300005554|Ga0066661_10783551Not Available558Open in IMG/M
3300005554|Ga0066661_10823313Not Available543Open in IMG/M
3300005555|Ga0066692_10613117All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005556|Ga0066707_10854251Not Available560Open in IMG/M
3300005569|Ga0066705_10767278Not Available577Open in IMG/M
3300005587|Ga0066654_10011541All Organisms → cellular organisms → Bacteria3325Open in IMG/M
3300005598|Ga0066706_10459856All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005615|Ga0070702_100157173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1465Open in IMG/M
3300005713|Ga0066905_100036555All Organisms → cellular organisms → Bacteria2860Open in IMG/M
3300005713|Ga0066905_101572138Not Available601Open in IMG/M
3300005764|Ga0066903_100851438All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300005764|Ga0066903_104703355All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005764|Ga0066903_107737714Not Available553Open in IMG/M
3300006031|Ga0066651_10650971Not Available563Open in IMG/M
3300006032|Ga0066696_10033267All Organisms → cellular organisms → Bacteria2777Open in IMG/M
3300006046|Ga0066652_100600531All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300006175|Ga0070712_101265266Not Available642Open in IMG/M
3300006237|Ga0097621_101052208All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300006575|Ga0074053_11644315All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium512Open in IMG/M
3300006578|Ga0074059_12149047All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300006755|Ga0079222_12211920Not Available547Open in IMG/M
3300006797|Ga0066659_10840857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes763Open in IMG/M
3300006871|Ga0075434_101317901All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300006871|Ga0075434_101528316Not Available676Open in IMG/M
3300007004|Ga0079218_13901150Not Available507Open in IMG/M
3300007076|Ga0075435_100858361All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300009012|Ga0066710_103590181Not Available585Open in IMG/M
3300009137|Ga0066709_104221393Not Available523Open in IMG/M
3300009553|Ga0105249_10709915All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300010038|Ga0126315_10038429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2536Open in IMG/M
3300010039|Ga0126309_10777674Not Available623Open in IMG/M
3300010041|Ga0126312_11420626Not Available514Open in IMG/M
3300010044|Ga0126310_11490360Not Available555Open in IMG/M
3300010045|Ga0126311_10176629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1542Open in IMG/M
3300010166|Ga0126306_11580488Not Available546Open in IMG/M
3300010333|Ga0134080_10323667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9697Open in IMG/M
3300010396|Ga0134126_11205233Not Available841Open in IMG/M
3300010403|Ga0134123_11672047Not Available686Open in IMG/M
3300010999|Ga0138505_100029168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300011332|Ga0126317_10559037Not Available729Open in IMG/M
3300011997|Ga0120162_1010760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3371Open in IMG/M
3300012019|Ga0120139_1003217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4216Open in IMG/M
3300012204|Ga0137374_10458624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium999Open in IMG/M
3300012206|Ga0137380_10512609All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300012207|Ga0137381_11209817Not Available649Open in IMG/M
3300012209|Ga0137379_10362903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1358Open in IMG/M
3300012212|Ga0150985_120679483All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300012350|Ga0137372_10190039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1651Open in IMG/M
3300012355|Ga0137369_10257874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1315Open in IMG/M
3300012359|Ga0137385_11021591Not Available682Open in IMG/M
3300012503|Ga0157313_1058076Not Available522Open in IMG/M
3300012679|Ga0136616_10100951All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300012907|Ga0157283_10314166Not Available549Open in IMG/M
3300012938|Ga0162651_100094310Not Available508Open in IMG/M
3300012960|Ga0164301_10502755All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300012961|Ga0164302_11290701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9589Open in IMG/M
3300012961|Ga0164302_11903896Not Available506Open in IMG/M
3300012976|Ga0134076_10412133Not Available604Open in IMG/M
3300012984|Ga0164309_10738700All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium785Open in IMG/M
3300012984|Ga0164309_10797144Not Available760Open in IMG/M
3300012986|Ga0164304_11460464Not Available564Open in IMG/M
3300013763|Ga0120179_1003171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4969Open in IMG/M
3300013772|Ga0120158_10336339Not Available716Open in IMG/M
3300014150|Ga0134081_10336464Not Available551Open in IMG/M
3300014823|Ga0120170_1048635All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300015356|Ga0134073_10420735Not Available508Open in IMG/M
3300015357|Ga0134072_10317156Not Available587Open in IMG/M
3300015373|Ga0132257_100007112All Organisms → cellular organisms → Bacteria10931Open in IMG/M
3300018056|Ga0184623_10521932Not Available504Open in IMG/M
3300018061|Ga0184619_10469514Not Available559Open in IMG/M
3300018076|Ga0184609_10077801All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300018468|Ga0066662_11194754All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300019356|Ga0173481_10654136Not Available561Open in IMG/M
3300019885|Ga0193747_1002812All Organisms → cellular organisms → Bacteria4357Open in IMG/M
3300022694|Ga0222623_10198634Not Available778Open in IMG/M
3300022694|Ga0222623_10376894Not Available541Open in IMG/M
3300022756|Ga0222622_11172620Not Available565Open in IMG/M
3300023071|Ga0247752_1045002All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025898|Ga0207692_10884743Not Available587Open in IMG/M
3300025906|Ga0207699_11053517Not Available602Open in IMG/M
3300025908|Ga0207643_10384291All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300025928|Ga0207700_10703274Not Available902Open in IMG/M
3300025934|Ga0207686_11154830Not Available633Open in IMG/M
3300025960|Ga0207651_11093147Not Available714Open in IMG/M
3300026075|Ga0207708_11354398Not Available624Open in IMG/M
3300026312|Ga0209153_1103684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1070Open in IMG/M
3300026335|Ga0209804_1268406Not Available607Open in IMG/M
3300026342|Ga0209057_1233687Not Available522Open in IMG/M
3300027401|Ga0208637_1044022Not Available525Open in IMG/M
3300027667|Ga0209009_1017336All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300028380|Ga0268265_11766814Not Available625Open in IMG/M
3300028713|Ga0307303_10003105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2585Open in IMG/M
3300028716|Ga0307311_10130441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300028717|Ga0307298_10180657Not Available618Open in IMG/M
3300028719|Ga0307301_10127704Not Available813Open in IMG/M
3300028720|Ga0307317_10195882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300028796|Ga0307287_10091694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300028807|Ga0307305_10413445Not Available609Open in IMG/M
3300028810|Ga0307294_10359515Not Available540Open in IMG/M
3300028811|Ga0307292_10050382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300028880|Ga0307300_10291680Not Available550Open in IMG/M
3300028881|Ga0307277_10320291Not Available689Open in IMG/M
3300028884|Ga0307308_10171357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300030902|Ga0308202_1097721Not Available603Open in IMG/M
3300031114|Ga0308187_10150962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300031123|Ga0308195_1033255Not Available689Open in IMG/M
3300031720|Ga0307469_10691489All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300031740|Ga0307468_101841950Not Available574Open in IMG/M
3300031901|Ga0307406_11564560Not Available582Open in IMG/M
3300032005|Ga0307411_10451394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.06%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.06%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.63%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011997Permafrost microbial communities from Nunavut, Canada - A15_80cm_18MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10328404223300000956SoilVTEVTVSPEQALVVDESGAPQRGFAGQNVPRKEDKRLVQGEG
JGI10216J12902_10653959253300000956SoilMTETTVTEPIVVEEQETRPGYAGQNVPRKEDKRLVQGEGV
JGI10216J12902_11187646613300000956SoilVSETTTVAEPLVVEQTETKPGFAGQNVPRKEDKRLVQGEGV
C688J18823_1013718343300001686SoilMTETTVTPERPLVVEEGETRPGFIGQNIPRKEDKRLVQGEGV
Ga0062595_10012739313300004479SoilVSESTTVSEPLVVEEQETKPGYAGQSVSRKEDKRLVQGEGLFF
Ga0062591_10141869313300004643SoilMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEG
Ga0062594_10143039223300005093SoilVTETTVTPERPLVVEEGESKPGFIGQNVPRKEDKRLVQGEGVF
Ga0066683_1056742413300005172SoilVTETTVTEPLVVEETETKPGYAGQSVPRKEDKRLLQGEGVF
Ga0070673_10111376713300005364Switchgrass RhizosphereVSDTTTVAEPLVVQETETKTGYAGTNVPRKEDKRLVQGEG
Ga0070709_1011652413300005434Corn, Switchgrass And Miscanthus RhizosphereMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFF
Ga0070710_1124914223300005437Corn, Switchgrass And Miscanthus RhizosphereVTETTTVTPAQPLVVEEAEAQRGFIGTNVPRKEDKRLVQG
Ga0070710_1146055013300005437Corn, Switchgrass And Miscanthus RhizosphereMTETTVAPEKPLVVEEGDTRPGFIGQNIPRKEDKRLVQGEG
Ga0070707_10188820913300005468Corn, Switchgrass And Miscanthus RhizosphereMCNAAEGGREVTETVTVTEALVVEPTETKPGFAGTSVPRKEDKRL
Ga0066661_1078355123300005554SoilMTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG
Ga0066661_1082331313300005554SoilMTETIVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQG
Ga0066692_1061311713300005555SoilVSETQTQTEALVVEETETKPGFIGTSTPRKEDKRLVQG
Ga0066707_1085425123300005556SoilVTETTIAPAGPLVVEETETKPGFIGQNVPRKEDKRLVQGEG
Ga0066705_1076727823300005569SoilVTETTAPTSAIVVEEQETRPGFIGTSIPRKEDRRLVQGE
Ga0066654_1001154113300005587SoilVTETTVTEPIVVEQTETKPGYAGQSVPRKEDRRLVQG
Ga0066706_1045985613300005598SoilVTETTVTPERPLVLEEGETKAGFVGQSVPRKEDKRL
Ga0070702_10015717333300005615Corn, Switchgrass And Miscanthus RhizosphereVTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGE
Ga0066905_10003655553300005713Tropical Forest SoilVTETTTVAEPIVVEQEETRRGYAGQNVPRKEDRRLVQGE
Ga0066905_10157213823300005713Tropical Forest SoilMTETTVTPERPLVVEEGETRPGFIGQNIPRKEDKRLVQ
Ga0066903_10085143813300005764Tropical Forest SoilMTETTLDQPLVVEKQETKRGWAGQNVPRKEDKRLVQ
Ga0066903_10470335513300005764Tropical Forest SoilVTEPTTVAEPIVVEEAETKRGYAGQNVPRKEDKRL
Ga0066903_10773771413300005764Tropical Forest SoilMTETTVTPAEPLVVEEAQTRPGFIGQNVPRKEDRRLVQGEGIF
Ga0066651_1065097113300006031SoilVTETTITPERPLVVEEGEARPGFIGQNVPRKEDRRLVQ
Ga0066696_1003326713300006032SoilVTETTVTEPIVVEQTETKPGYAGQSVPRKEDKRLVQGQGV
Ga0066652_10060053113300006046SoilMTETLSPAQPLVVEEGEEQRGFAGTNVPRKEDKRLVQGQGV
Ga0070712_10126526623300006175Corn, Switchgrass And Miscanthus RhizosphereVTETTTVTPAQPLVVEEGEAQRGFIGTNVPRKEDK
Ga0097621_10105220813300006237Miscanthus RhizosphereMSETTTVTPERPLVVEEGDVKPGFIGQNIPRKEDKRLVQGE
Ga0074053_1164431523300006575SoilMTETGTPTSALVVEEQETRPGFIGTSVPRKEDRRLVQG
Ga0074059_1214904713300006578SoilVSETTTVAEPLVVEQTETKPGYAGQSVPRKEDKRLVQGEGVF
Ga0079222_1221192023300006755Agricultural SoilMTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLV
Ga0066659_1084085733300006797SoilMTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEG
Ga0075434_10131790133300006871Populus RhizosphereMTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQ
Ga0075434_10152831623300006871Populus RhizosphereVTETTTVAEPVVVEEAEPKRGYAGQNVPRKEDRRLVQGE
Ga0079218_1390115013300007004Agricultural SoilVSETIAPTEALVVEETETRPGFAGQSIPRKEDKRLVQGE
Ga0075435_10085836113300007076Populus RhizosphereVTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLV
Ga0066710_10359018123300009012Grasslands SoilVTETTTVTEPMVVEESETRPGYAGQSVPRKEDKRLVQGQGLFV
Ga0066709_10422139313300009137Grasslands SoilMTETTVAPPKPAVVEEGKPQKGWAGQNVPRKEDKRLLQGEGVF
Ga0105249_1070991513300009553Switchgrass RhizosphereVTETTTVAEPVVVEDAEPKRGYAGQNVPRKEDRRLVQG
Ga0126315_1003842913300010038Serpentine SoilVSETTTLPEPVVIEEAEPKRGYAGQNVPRKEDKRLVQ
Ga0126309_1077767433300010039Serpentine SoilMTETTTMEPLVVEREETKPGFVGQSVPRKEDRRLT
Ga0126312_1142062623300010041Serpentine SoilVTETTVSPPEALVVEEQEVRPGFIGKNVPRKEDRRLVQGEGIFVDDV
Ga0126310_1149036013300010044Serpentine SoilLTDTQTQTQTAPLVVETEETKLGFVGQNVPRKEDKRLVQGEGV
Ga0126311_1017662913300010045Serpentine SoilMPRSSGDALLTETTTVTEPIVVEEGQTRPGFAGQNVPRKEDKR
Ga0126306_1158048813300010166Serpentine SoilVSETVTPDKPITVEEQEVAPGFIRQNVPRKEDRRLVQGEGVFV
Ga0134080_1032366713300010333Grasslands SoilMSETGVTPEHPLVVEGTEVKPGFIGQNVPRKEDKRLVQGEGVFFD
Ga0134126_1120523313300010396Terrestrial SoilVTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGV
Ga0134123_1167204723300010403Terrestrial SoilMSETTTVAEPLVVEQTETKPGYAGQSVPRKEDRRLVQGEGVFF
Ga0138505_10002916833300010999SoilMTETTVTPERPLVVEEGETRPGFIGQSIPRKEDKR
Ga0126317_1055903713300011332SoilMTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGV
Ga0120162_101076013300011997PermafrostMTETTVTPERPIVVEETESPQRGWAGTNVPRKEDKRLGQGEGGFFDDGKRDV
Ga0120139_100321783300012019PermafrostMTETTVTPERPIVVEETEAPQRGWAGTNVPPKGEKRVRHGEG
Ga0137374_1045862413300012204Vadose Zone SoilVLGQGGVEVTETTTEPIVVEETEVKPGFIGVSTPRKE
Ga0137380_1051260913300012206Vadose Zone SoilMTETLSPEQALVVEEGQEQRGWAGTNVPRKEDKRLVQGQG
Ga0137381_1120981713300012207Vadose Zone SoilMTETTVAPPKPVVLEEGKPQKGWAGQNIPRKEDKRLLQGEGVF
Ga0137379_1036290333300012209Vadose Zone SoilMTDTATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGE
Ga0150985_12067948313300012212Avena Fatua RhizosphereMTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGV
Ga0137372_1019003913300012350Vadose Zone SoilMTETTVTPERPLVVEEGDVRPGFIGQNVPRKEDKRLVQ
Ga0137369_1025787433300012355Vadose Zone SoilVLGQGGVEVTETTTEPIVVEETETKPGFIGTSTPRKEDKRLV
Ga0137385_1102159133300012359Vadose Zone SoilVNETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGVFFD
Ga0157313_105807623300012503Arabidopsis RhizosphereVSESTTVSEPLVVEEQETKPGYAGQNVPRKEDKRLVQGEGLF
Ga0136616_1010095133300012679Polar Desert SandMSETLAPAPEQAIVVEETGAPQRGWAGQNIPRKEDKRLVQGEGLF
Ga0157283_1031416613300012907SoilMTESATETAAQPLVVAPGETKPGFVGTNVPRKEDRRLVQGE
Ga0162651_10009431013300012938SoilVSETTVAEPVVVEETETKPGYAGQNVPRKEDKRLVQGEG
Ga0164301_1050275513300012960SoilMTETTVTPERPLVGEEGDVKPGFIGQNIPRKEDKRLVQGEGVFFD
Ga0164302_1129070113300012961SoilMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGV
Ga0164302_1190389623300012961SoilMTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFFD
Ga0134076_1041213313300012976Grasslands SoilMTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLVQGE
Ga0164309_1073870013300012984SoilMTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFF
Ga0164309_1079714413300012984SoilVTETTTVAEPLVVEQTETKPGYAGQSVPRKEDRRLVQGEGVFF
Ga0164304_1146046423300012986SoilMTETTTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGE
Ga0120179_100317183300013763PermafrostMTETTVTPERPIVVEETESPQRGWAGTNVPRKEDKRLVQGEGVFF
Ga0120158_1033633933300013772PermafrostMSETTTVTEPIVVEEGETKPGYAGQSVPRKEDKRLVQGE
Ga0134081_1033646413300014150Grasslands SoilMTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLV
Ga0120170_104863513300014823PermafrostMTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQ
Ga0134073_1042073513300015356Grasslands SoilVTETTVTPERPLVVEEGDVKPGFIGQNIPRKEDKRLVQGEGVF
Ga0134072_1031715623300015357Grasslands SoilVTETVTQTQPLVATPGETKPGFAGTNVPRKEDKRLVQGEGVFFD
Ga0132257_10000711213300015373Arabidopsis RhizosphereMTETTVTPERPLLVEEGETRPGFIGQNIPRKEDKRLVQGEGVYF
Ga0184623_1052193213300018056Groundwater SedimentMSEPTTTTEALVVEETETKAGFIGVSTPRKEDKRLLQGEGTFFDDVK
Ga0184619_1046951413300018061Groundwater SedimentMSETTVTPDQPITVEREETAPGFIGQNVPRKEDRRLV
Ga0184609_1007780113300018076Groundwater SedimentMTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGEGV
Ga0066662_1119475413300018468Grasslands SoilVTETTVTPERPLVVESGELRPGFIGQSVPRKEDKRLVQGAGL
Ga0173481_1065413613300019356SoilMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQG
Ga0193747_100281213300019885SoilVTETTVAPPRPAVVEEGKPQKGWAGQNVPRKEDKRLLQ
Ga0222623_1019863433300022694Groundwater SedimentMSETTVTPDQPITVEEHETAPGFIGQNVPRKEDRRLVEGAGV
Ga0222623_1037689413300022694Groundwater SedimentVTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGVFFD
Ga0222622_1117262013300022756Groundwater SedimentMSETTVTPDRPITVEETETAPGFIGVNVPRKEDRRLVQGEGV
Ga0247752_104500233300023071SoilMTDTTFERALVVEPTETKRGWAGQSVPRKEDKRLV
Ga0207692_1088474313300025898Corn, Switchgrass And Miscanthus RhizosphereMTETTVAPEKPLVVEEGDTRPGFIGQNIPRKEDKRLVQGE
Ga0207699_1105351713300025906Corn, Switchgrass And Miscanthus RhizosphereMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFFD
Ga0207643_1038429113300025908Miscanthus RhizosphereVTETASPTSAIVVEEQETKPGFIGTSIPRKEDRRL
Ga0207700_1070327413300025928Corn, Switchgrass And Miscanthus RhizosphereVTEPTTVAEPIVVEEAETKRGYAGQSVPRKEDKRLVQ
Ga0207686_1115483013300025934Miscanthus RhizosphereVTETTVTPERPLVIEEGESKAGFIGQNIPRKEDKRLVQG
Ga0207651_1109314713300025960Switchgrass RhizosphereVSDTTTVAEPLVVQETETKTGYAGTNVPRKEDKRLVQGEGVFFDD
Ga0207708_1135439813300026075Corn, Switchgrass And Miscanthus RhizosphereVSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRLVQGEGLFFD
Ga0209153_110368433300026312SoilMTETTVAPPKPVVVEEGKPQKGWAGQNVPRKEDKR
Ga0209804_126840613300026335SoilVTETTTVTEPIVVEERESRSGYAGQNVPRKEDKRLV
Ga0209057_123368723300026342SoilVTETAAPTSAIVVEEQETRPGFIGTNIPRKEDRRLVQGEGVFFDD
Ga0208637_104402213300027401SoilVTETTITPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGVFF
Ga0209009_101733613300027667Forest SoilMTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRL
Ga0268265_1176681413300028380Switchgrass RhizosphereMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQ
Ga0307303_1000310553300028713SoilMTETATVTEPIVVEETETRPGYAGQNVPRKEDKRL
Ga0307311_1013044133300028716SoilVTETTVTPERPLVVEEGDVKPGFIGQSIPRKEDKR
Ga0307298_1018065713300028717SoilVTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLVQGE
Ga0307301_1012770433300028719SoilVSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRL
Ga0307317_1019588233300028720SoilMSETTVTPDRPITVEETETAPGFIGVNVPRKEDRR
Ga0307287_1009169413300028796SoilVTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG
Ga0307305_1041344513300028807SoilMVSPVMETTVTPERPIVVEETEAPQRGWAGTNVPRKEDKRLVQGEGV
Ga0307294_1035951513300028810SoilVSETTTVTEPIVVEEGETRPGYAGQNVPRKEDKRLV
Ga0307292_1005038213300028811SoilVSETTTVSEPIVVEQTETKPGYAGQNVPRKEDKRL
Ga0307300_1029168023300028880SoilVSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRLVQGEG
Ga0307277_1032029113300028881SoilVTETTVTPERPLVVEETETRPGFVGQNVPRKEDRRLVQGQGVFF
Ga0307308_1017135733300028884SoilMTETATPTTALVVEEQETRPGFIGTSVPRKEDRRLVQGEG
Ga0308202_109772123300030902SoilMTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGE
Ga0308187_1015096213300031114SoilVTETTVTPERPLVVEEGESKVGFIGQNVPRKEDKRLVQ
Ga0308195_103325513300031123SoilVTETTVTPERPLVVEEGESKAGFIGQNVPRKEDKRLVQG
Ga0307469_1069148913300031720Hardwood Forest SoilMTETATPTSALVVEEQETRPGFIGTSVPRKEDRRL
Ga0307468_10184195023300031740Hardwood Forest SoilMTETTVTEPLVVEETETRRGYAGQSVPRKEDQRLLQGE
Ga0307406_1156456013300031901RhizosphereVSETTTLPEPVVVEEAEPKRGYAGQNVPRKEDKRLVQGEGV
Ga0307411_1045139413300032005RhizosphereVSETTTLPEPVVIEEAEPKRGYAGQNVPRKEDKRLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.