| Basic Information | |
|---|---|
| Family ID | F070379 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.19 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.06 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.846 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.512 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.390 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 0.00% Coil/Unstructured: 89.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01799 | Fer2_2 | 65.85 |
| PF03450 | CO_deh_flav_C | 22.76 |
| PF00941 | FAD_binding_5 | 4.88 |
| PF07883 | Cupin_2 | 0.81 |
| PF00202 | Aminotran_3 | 0.81 |
| PF10604 | Polyketide_cyc2 | 0.81 |
| PF01315 | Ald_Xan_dh_C | 0.81 |
| PF09118 | GO-like_E_set | 0.81 |
| PF01565 | FAD_binding_4 | 0.81 |
| PF01957 | NfeD | 0.81 |
| PF00561 | Abhydrolase_1 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.85 % |
| All Organisms | root | All Organisms | 47.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_103284042 | Not Available | 679 | Open in IMG/M |
| 3300000956|JGI10216J12902_106539592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3168 | Open in IMG/M |
| 3300000956|JGI10216J12902_111876466 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300001686|C688J18823_10137183 | Not Available | 1685 | Open in IMG/M |
| 3300004479|Ga0062595_100127393 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300004643|Ga0062591_101418693 | Not Available | 690 | Open in IMG/M |
| 3300005093|Ga0062594_101430392 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005172|Ga0066683_10567424 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005364|Ga0070673_101113767 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005434|Ga0070709_10116524 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300005437|Ga0070710_11249142 | Not Available | 551 | Open in IMG/M |
| 3300005437|Ga0070710_11460550 | Not Available | 513 | Open in IMG/M |
| 3300005468|Ga0070707_101888209 | Not Available | 565 | Open in IMG/M |
| 3300005554|Ga0066661_10783551 | Not Available | 558 | Open in IMG/M |
| 3300005554|Ga0066661_10823313 | Not Available | 543 | Open in IMG/M |
| 3300005555|Ga0066692_10613117 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005556|Ga0066707_10854251 | Not Available | 560 | Open in IMG/M |
| 3300005569|Ga0066705_10767278 | Not Available | 577 | Open in IMG/M |
| 3300005587|Ga0066654_10011541 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300005598|Ga0066706_10459856 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005615|Ga0070702_100157173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1465 | Open in IMG/M |
| 3300005713|Ga0066905_100036555 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300005713|Ga0066905_101572138 | Not Available | 601 | Open in IMG/M |
| 3300005764|Ga0066903_100851438 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300005764|Ga0066903_104703355 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005764|Ga0066903_107737714 | Not Available | 553 | Open in IMG/M |
| 3300006031|Ga0066651_10650971 | Not Available | 563 | Open in IMG/M |
| 3300006032|Ga0066696_10033267 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300006046|Ga0066652_100600531 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300006175|Ga0070712_101265266 | Not Available | 642 | Open in IMG/M |
| 3300006237|Ga0097621_101052208 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006575|Ga0074053_11644315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 512 | Open in IMG/M |
| 3300006578|Ga0074059_12149047 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006755|Ga0079222_12211920 | Not Available | 547 | Open in IMG/M |
| 3300006797|Ga0066659_10840857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 763 | Open in IMG/M |
| 3300006871|Ga0075434_101317901 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006871|Ga0075434_101528316 | Not Available | 676 | Open in IMG/M |
| 3300007004|Ga0079218_13901150 | Not Available | 507 | Open in IMG/M |
| 3300007076|Ga0075435_100858361 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300009012|Ga0066710_103590181 | Not Available | 585 | Open in IMG/M |
| 3300009137|Ga0066709_104221393 | Not Available | 523 | Open in IMG/M |
| 3300009553|Ga0105249_10709915 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010038|Ga0126315_10038429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2536 | Open in IMG/M |
| 3300010039|Ga0126309_10777674 | Not Available | 623 | Open in IMG/M |
| 3300010041|Ga0126312_11420626 | Not Available | 514 | Open in IMG/M |
| 3300010044|Ga0126310_11490360 | Not Available | 555 | Open in IMG/M |
| 3300010045|Ga0126311_10176629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
| 3300010166|Ga0126306_11580488 | Not Available | 546 | Open in IMG/M |
| 3300010333|Ga0134080_10323667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 697 | Open in IMG/M |
| 3300010396|Ga0134126_11205233 | Not Available | 841 | Open in IMG/M |
| 3300010403|Ga0134123_11672047 | Not Available | 686 | Open in IMG/M |
| 3300010999|Ga0138505_100029168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300011332|Ga0126317_10559037 | Not Available | 729 | Open in IMG/M |
| 3300011997|Ga0120162_1010760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3371 | Open in IMG/M |
| 3300012019|Ga0120139_1003217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4216 | Open in IMG/M |
| 3300012204|Ga0137374_10458624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
| 3300012206|Ga0137380_10512609 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300012207|Ga0137381_11209817 | Not Available | 649 | Open in IMG/M |
| 3300012209|Ga0137379_10362903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
| 3300012212|Ga0150985_120679483 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300012350|Ga0137372_10190039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1651 | Open in IMG/M |
| 3300012355|Ga0137369_10257874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1315 | Open in IMG/M |
| 3300012359|Ga0137385_11021591 | Not Available | 682 | Open in IMG/M |
| 3300012503|Ga0157313_1058076 | Not Available | 522 | Open in IMG/M |
| 3300012679|Ga0136616_10100951 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300012907|Ga0157283_10314166 | Not Available | 549 | Open in IMG/M |
| 3300012938|Ga0162651_100094310 | Not Available | 508 | Open in IMG/M |
| 3300012960|Ga0164301_10502755 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012961|Ga0164302_11290701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 589 | Open in IMG/M |
| 3300012961|Ga0164302_11903896 | Not Available | 506 | Open in IMG/M |
| 3300012976|Ga0134076_10412133 | Not Available | 604 | Open in IMG/M |
| 3300012984|Ga0164309_10738700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 785 | Open in IMG/M |
| 3300012984|Ga0164309_10797144 | Not Available | 760 | Open in IMG/M |
| 3300012986|Ga0164304_11460464 | Not Available | 564 | Open in IMG/M |
| 3300013763|Ga0120179_1003171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4969 | Open in IMG/M |
| 3300013772|Ga0120158_10336339 | Not Available | 716 | Open in IMG/M |
| 3300014150|Ga0134081_10336464 | Not Available | 551 | Open in IMG/M |
| 3300014823|Ga0120170_1048635 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300015356|Ga0134073_10420735 | Not Available | 508 | Open in IMG/M |
| 3300015357|Ga0134072_10317156 | Not Available | 587 | Open in IMG/M |
| 3300015373|Ga0132257_100007112 | All Organisms → cellular organisms → Bacteria | 10931 | Open in IMG/M |
| 3300018056|Ga0184623_10521932 | Not Available | 504 | Open in IMG/M |
| 3300018061|Ga0184619_10469514 | Not Available | 559 | Open in IMG/M |
| 3300018076|Ga0184609_10077801 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300018468|Ga0066662_11194754 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300019356|Ga0173481_10654136 | Not Available | 561 | Open in IMG/M |
| 3300019885|Ga0193747_1002812 | All Organisms → cellular organisms → Bacteria | 4357 | Open in IMG/M |
| 3300022694|Ga0222623_10198634 | Not Available | 778 | Open in IMG/M |
| 3300022694|Ga0222623_10376894 | Not Available | 541 | Open in IMG/M |
| 3300022756|Ga0222622_11172620 | Not Available | 565 | Open in IMG/M |
| 3300023071|Ga0247752_1045002 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025898|Ga0207692_10884743 | Not Available | 587 | Open in IMG/M |
| 3300025906|Ga0207699_11053517 | Not Available | 602 | Open in IMG/M |
| 3300025908|Ga0207643_10384291 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300025928|Ga0207700_10703274 | Not Available | 902 | Open in IMG/M |
| 3300025934|Ga0207686_11154830 | Not Available | 633 | Open in IMG/M |
| 3300025960|Ga0207651_11093147 | Not Available | 714 | Open in IMG/M |
| 3300026075|Ga0207708_11354398 | Not Available | 624 | Open in IMG/M |
| 3300026312|Ga0209153_1103684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1070 | Open in IMG/M |
| 3300026335|Ga0209804_1268406 | Not Available | 607 | Open in IMG/M |
| 3300026342|Ga0209057_1233687 | Not Available | 522 | Open in IMG/M |
| 3300027401|Ga0208637_1044022 | Not Available | 525 | Open in IMG/M |
| 3300027667|Ga0209009_1017336 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300028380|Ga0268265_11766814 | Not Available | 625 | Open in IMG/M |
| 3300028713|Ga0307303_10003105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2585 | Open in IMG/M |
| 3300028716|Ga0307311_10130441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300028717|Ga0307298_10180657 | Not Available | 618 | Open in IMG/M |
| 3300028719|Ga0307301_10127704 | Not Available | 813 | Open in IMG/M |
| 3300028720|Ga0307317_10195882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300028796|Ga0307287_10091694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300028807|Ga0307305_10413445 | Not Available | 609 | Open in IMG/M |
| 3300028810|Ga0307294_10359515 | Not Available | 540 | Open in IMG/M |
| 3300028811|Ga0307292_10050382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
| 3300028880|Ga0307300_10291680 | Not Available | 550 | Open in IMG/M |
| 3300028881|Ga0307277_10320291 | Not Available | 689 | Open in IMG/M |
| 3300028884|Ga0307308_10171357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300030902|Ga0308202_1097721 | Not Available | 603 | Open in IMG/M |
| 3300031114|Ga0308187_10150962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300031123|Ga0308195_1033255 | Not Available | 689 | Open in IMG/M |
| 3300031720|Ga0307469_10691489 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300031740|Ga0307468_101841950 | Not Available | 574 | Open in IMG/M |
| 3300031901|Ga0307406_11564560 | Not Available | 582 | Open in IMG/M |
| 3300032005|Ga0307411_10451394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.06% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.06% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1032840422 | 3300000956 | Soil | VTEVTVSPEQALVVDESGAPQRGFAGQNVPRKEDKRLVQGEG |
| JGI10216J12902_1065395925 | 3300000956 | Soil | MTETTVTEPIVVEEQETRPGYAGQNVPRKEDKRLVQGEGV |
| JGI10216J12902_1118764661 | 3300000956 | Soil | VSETTTVAEPLVVEQTETKPGFAGQNVPRKEDKRLVQGEGV |
| C688J18823_101371834 | 3300001686 | Soil | MTETTVTPERPLVVEEGETRPGFIGQNIPRKEDKRLVQGEGV |
| Ga0062595_1001273931 | 3300004479 | Soil | VSESTTVSEPLVVEEQETKPGYAGQSVSRKEDKRLVQGEGLFF |
| Ga0062591_1014186931 | 3300004643 | Soil | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEG |
| Ga0062594_1014303922 | 3300005093 | Soil | VTETTVTPERPLVVEEGESKPGFIGQNVPRKEDKRLVQGEGVF |
| Ga0066683_105674241 | 3300005172 | Soil | VTETTVTEPLVVEETETKPGYAGQSVPRKEDKRLLQGEGVF |
| Ga0070673_1011137671 | 3300005364 | Switchgrass Rhizosphere | VSDTTTVAEPLVVQETETKTGYAGTNVPRKEDKRLVQGEG |
| Ga0070709_101165241 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFF |
| Ga0070710_112491422 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VTETTTVTPAQPLVVEEAEAQRGFIGTNVPRKEDKRLVQG |
| Ga0070710_114605501 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETTVAPEKPLVVEEGDTRPGFIGQNIPRKEDKRLVQGEG |
| Ga0070707_1018882091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MCNAAEGGREVTETVTVTEALVVEPTETKPGFAGTSVPRKEDKRL |
| Ga0066661_107835512 | 3300005554 | Soil | MTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG |
| Ga0066661_108233131 | 3300005554 | Soil | MTETIVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQG |
| Ga0066692_106131171 | 3300005555 | Soil | VSETQTQTEALVVEETETKPGFIGTSTPRKEDKRLVQG |
| Ga0066707_108542512 | 3300005556 | Soil | VTETTIAPAGPLVVEETETKPGFIGQNVPRKEDKRLVQGEG |
| Ga0066705_107672782 | 3300005569 | Soil | VTETTAPTSAIVVEEQETRPGFIGTSIPRKEDRRLVQGE |
| Ga0066654_100115411 | 3300005587 | Soil | VTETTVTEPIVVEQTETKPGYAGQSVPRKEDRRLVQG |
| Ga0066706_104598561 | 3300005598 | Soil | VTETTVTPERPLVLEEGETKAGFVGQSVPRKEDKRL |
| Ga0070702_1001571733 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGE |
| Ga0066905_1000365555 | 3300005713 | Tropical Forest Soil | VTETTTVAEPIVVEQEETRRGYAGQNVPRKEDRRLVQGE |
| Ga0066905_1015721382 | 3300005713 | Tropical Forest Soil | MTETTVTPERPLVVEEGETRPGFIGQNIPRKEDKRLVQ |
| Ga0066903_1008514381 | 3300005764 | Tropical Forest Soil | MTETTLDQPLVVEKQETKRGWAGQNVPRKEDKRLVQ |
| Ga0066903_1047033551 | 3300005764 | Tropical Forest Soil | VTEPTTVAEPIVVEEAETKRGYAGQNVPRKEDKRL |
| Ga0066903_1077377141 | 3300005764 | Tropical Forest Soil | MTETTVTPAEPLVVEEAQTRPGFIGQNVPRKEDRRLVQGEGIF |
| Ga0066651_106509711 | 3300006031 | Soil | VTETTITPERPLVVEEGEARPGFIGQNVPRKEDRRLVQ |
| Ga0066696_100332671 | 3300006032 | Soil | VTETTVTEPIVVEQTETKPGYAGQSVPRKEDKRLVQGQGV |
| Ga0066652_1006005311 | 3300006046 | Soil | MTETLSPAQPLVVEEGEEQRGFAGTNVPRKEDKRLVQGQGV |
| Ga0070712_1012652662 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTETTTVTPAQPLVVEEGEAQRGFIGTNVPRKEDK |
| Ga0097621_1010522081 | 3300006237 | Miscanthus Rhizosphere | MSETTTVTPERPLVVEEGDVKPGFIGQNIPRKEDKRLVQGE |
| Ga0074053_116443152 | 3300006575 | Soil | MTETGTPTSALVVEEQETRPGFIGTSVPRKEDRRLVQG |
| Ga0074059_121490471 | 3300006578 | Soil | VSETTTVAEPLVVEQTETKPGYAGQSVPRKEDKRLVQGEGVF |
| Ga0079222_122119202 | 3300006755 | Agricultural Soil | MTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLV |
| Ga0066659_108408573 | 3300006797 | Soil | MTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEG |
| Ga0075434_1013179013 | 3300006871 | Populus Rhizosphere | MTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQ |
| Ga0075434_1015283162 | 3300006871 | Populus Rhizosphere | VTETTTVAEPVVVEEAEPKRGYAGQNVPRKEDRRLVQGE |
| Ga0079218_139011501 | 3300007004 | Agricultural Soil | VSETIAPTEALVVEETETRPGFAGQSIPRKEDKRLVQGE |
| Ga0075435_1008583611 | 3300007076 | Populus Rhizosphere | VTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLV |
| Ga0066710_1035901812 | 3300009012 | Grasslands Soil | VTETTTVTEPMVVEESETRPGYAGQSVPRKEDKRLVQGQGLFV |
| Ga0066709_1042213931 | 3300009137 | Grasslands Soil | MTETTVAPPKPAVVEEGKPQKGWAGQNVPRKEDKRLLQGEGVF |
| Ga0105249_107099151 | 3300009553 | Switchgrass Rhizosphere | VTETTTVAEPVVVEDAEPKRGYAGQNVPRKEDRRLVQG |
| Ga0126315_100384291 | 3300010038 | Serpentine Soil | VSETTTLPEPVVIEEAEPKRGYAGQNVPRKEDKRLVQ |
| Ga0126309_107776743 | 3300010039 | Serpentine Soil | MTETTTMEPLVVEREETKPGFVGQSVPRKEDRRLT |
| Ga0126312_114206262 | 3300010041 | Serpentine Soil | VTETTVSPPEALVVEEQEVRPGFIGKNVPRKEDRRLVQGEGIFVDDV |
| Ga0126310_114903601 | 3300010044 | Serpentine Soil | LTDTQTQTQTAPLVVETEETKLGFVGQNVPRKEDKRLVQGEGV |
| Ga0126311_101766291 | 3300010045 | Serpentine Soil | MPRSSGDALLTETTTVTEPIVVEEGQTRPGFAGQNVPRKEDKR |
| Ga0126306_115804881 | 3300010166 | Serpentine Soil | VSETVTPDKPITVEEQEVAPGFIRQNVPRKEDRRLVQGEGVFV |
| Ga0134080_103236671 | 3300010333 | Grasslands Soil | MSETGVTPEHPLVVEGTEVKPGFIGQNVPRKEDKRLVQGEGVFFD |
| Ga0134126_112052331 | 3300010396 | Terrestrial Soil | VTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGV |
| Ga0134123_116720472 | 3300010403 | Terrestrial Soil | MSETTTVAEPLVVEQTETKPGYAGQSVPRKEDRRLVQGEGVFF |
| Ga0138505_1000291683 | 3300010999 | Soil | MTETTVTPERPLVVEEGETRPGFIGQSIPRKEDKR |
| Ga0126317_105590371 | 3300011332 | Soil | MTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGV |
| Ga0120162_10107601 | 3300011997 | Permafrost | MTETTVTPERPIVVEETESPQRGWAGTNVPRKEDKRLGQGEGGFFDDGKRDV |
| Ga0120139_10032178 | 3300012019 | Permafrost | MTETTVTPERPIVVEETEAPQRGWAGTNVPPKGEKRVRHGEG |
| Ga0137374_104586241 | 3300012204 | Vadose Zone Soil | VLGQGGVEVTETTTEPIVVEETEVKPGFIGVSTPRKE |
| Ga0137380_105126091 | 3300012206 | Vadose Zone Soil | MTETLSPEQALVVEEGQEQRGWAGTNVPRKEDKRLVQGQG |
| Ga0137381_112098171 | 3300012207 | Vadose Zone Soil | MTETTVAPPKPVVLEEGKPQKGWAGQNIPRKEDKRLLQGEGVF |
| Ga0137379_103629033 | 3300012209 | Vadose Zone Soil | MTDTATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGE |
| Ga0150985_1206794831 | 3300012212 | Avena Fatua Rhizosphere | MTETTVTPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGV |
| Ga0137372_101900391 | 3300012350 | Vadose Zone Soil | MTETTVTPERPLVVEEGDVRPGFIGQNVPRKEDKRLVQ |
| Ga0137369_102578743 | 3300012355 | Vadose Zone Soil | VLGQGGVEVTETTTEPIVVEETETKPGFIGTSTPRKEDKRLV |
| Ga0137385_110215913 | 3300012359 | Vadose Zone Soil | VNETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGVFFD |
| Ga0157313_10580762 | 3300012503 | Arabidopsis Rhizosphere | VSESTTVSEPLVVEEQETKPGYAGQNVPRKEDKRLVQGEGLF |
| Ga0136616_101009513 | 3300012679 | Polar Desert Sand | MSETLAPAPEQAIVVEETGAPQRGWAGQNIPRKEDKRLVQGEGLF |
| Ga0157283_103141661 | 3300012907 | Soil | MTESATETAAQPLVVAPGETKPGFVGTNVPRKEDRRLVQGE |
| Ga0162651_1000943101 | 3300012938 | Soil | VSETTVAEPVVVEETETKPGYAGQNVPRKEDKRLVQGEG |
| Ga0164301_105027551 | 3300012960 | Soil | MTETTVTPERPLVGEEGDVKPGFIGQNIPRKEDKRLVQGEGVFFD |
| Ga0164302_112907011 | 3300012961 | Soil | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGV |
| Ga0164302_119038962 | 3300012961 | Soil | MTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFFD |
| Ga0134076_104121331 | 3300012976 | Grasslands Soil | MTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLVQGE |
| Ga0164309_107387001 | 3300012984 | Soil | MTETGAPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFF |
| Ga0164309_107971441 | 3300012984 | Soil | VTETTTVAEPLVVEQTETKPGYAGQSVPRKEDRRLVQGEGVFF |
| Ga0164304_114604642 | 3300012986 | Soil | MTETTTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGE |
| Ga0120179_10031718 | 3300013763 | Permafrost | MTETTVTPERPIVVEETESPQRGWAGTNVPRKEDKRLVQGEGVFF |
| Ga0120158_103363393 | 3300013772 | Permafrost | MSETTTVTEPIVVEEGETKPGYAGQSVPRKEDKRLVQGE |
| Ga0134081_103364641 | 3300014150 | Grasslands Soil | MTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLV |
| Ga0120170_10486351 | 3300014823 | Permafrost | MTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQ |
| Ga0134073_104207351 | 3300015356 | Grasslands Soil | VTETTVTPERPLVVEEGDVKPGFIGQNIPRKEDKRLVQGEGVF |
| Ga0134072_103171562 | 3300015357 | Grasslands Soil | VTETVTQTQPLVATPGETKPGFAGTNVPRKEDKRLVQGEGVFFD |
| Ga0132257_1000071121 | 3300015373 | Arabidopsis Rhizosphere | MTETTVTPERPLLVEEGETRPGFIGQNIPRKEDKRLVQGEGVYF |
| Ga0184623_105219321 | 3300018056 | Groundwater Sediment | MSEPTTTTEALVVEETETKAGFIGVSTPRKEDKRLLQGEGTFFDDVK |
| Ga0184619_104695141 | 3300018061 | Groundwater Sediment | MSETTVTPDQPITVEREETAPGFIGQNVPRKEDRRLV |
| Ga0184609_100778011 | 3300018076 | Groundwater Sediment | MTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGEGV |
| Ga0066662_111947541 | 3300018468 | Grasslands Soil | VTETTVTPERPLVVESGELRPGFIGQSVPRKEDKRLVQGAGL |
| Ga0173481_106541361 | 3300019356 | Soil | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQG |
| Ga0193747_10028121 | 3300019885 | Soil | VTETTVAPPRPAVVEEGKPQKGWAGQNVPRKEDKRLLQ |
| Ga0222623_101986343 | 3300022694 | Groundwater Sediment | MSETTVTPDQPITVEEHETAPGFIGQNVPRKEDRRLVEGAGV |
| Ga0222623_103768941 | 3300022694 | Groundwater Sediment | VTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQGEGVFFD |
| Ga0222622_111726201 | 3300022756 | Groundwater Sediment | MSETTVTPDRPITVEETETAPGFIGVNVPRKEDRRLVQGEGV |
| Ga0247752_10450023 | 3300023071 | Soil | MTDTTFERALVVEPTETKRGWAGQSVPRKEDKRLV |
| Ga0207692_108847431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETTVAPEKPLVVEEGDTRPGFIGQNIPRKEDKRLVQGE |
| Ga0207699_110535171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQGEGVFFD |
| Ga0207643_103842911 | 3300025908 | Miscanthus Rhizosphere | VTETASPTSAIVVEEQETKPGFIGTSIPRKEDRRL |
| Ga0207700_107032741 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEPTTVAEPIVVEEAETKRGYAGQSVPRKEDKRLVQ |
| Ga0207686_111548301 | 3300025934 | Miscanthus Rhizosphere | VTETTVTPERPLVIEEGESKAGFIGQNIPRKEDKRLVQG |
| Ga0207651_110931471 | 3300025960 | Switchgrass Rhizosphere | VSDTTTVAEPLVVQETETKTGYAGTNVPRKEDKRLVQGEGVFFDD |
| Ga0207708_113543981 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRLVQGEGLFFD |
| Ga0209153_11036843 | 3300026312 | Soil | MTETTVAPPKPVVVEEGKPQKGWAGQNVPRKEDKR |
| Ga0209804_12684061 | 3300026335 | Soil | VTETTTVTEPIVVEERESRSGYAGQNVPRKEDKRLV |
| Ga0209057_12336872 | 3300026342 | Soil | VTETAAPTSAIVVEEQETRPGFIGTNIPRKEDRRLVQGEGVFFDD |
| Ga0208637_10440221 | 3300027401 | Soil | VTETTITPERPLVVEEGESKAGFIGQNIPRKEDKRLVQGEGVFF |
| Ga0209009_10173361 | 3300027667 | Forest Soil | MTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRL |
| Ga0268265_117668141 | 3300028380 | Switchgrass Rhizosphere | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRLVQ |
| Ga0307303_100031055 | 3300028713 | Soil | MTETATVTEPIVVEETETRPGYAGQNVPRKEDKRL |
| Ga0307311_101304413 | 3300028716 | Soil | VTETTVTPERPLVVEEGDVKPGFIGQSIPRKEDKR |
| Ga0307298_101806571 | 3300028717 | Soil | VTETTVTPERPLVVEEGDVKPGFIGQNVPRKEDKRLVQGE |
| Ga0307301_101277043 | 3300028719 | Soil | VSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRL |
| Ga0307317_101958823 | 3300028720 | Soil | MSETTVTPDRPITVEETETAPGFIGVNVPRKEDRR |
| Ga0307287_100916941 | 3300028796 | Soil | VTETTVTPERPLVVEEGETRPGFIGQNVPRKEDKRLVQG |
| Ga0307305_104134451 | 3300028807 | Soil | MVSPVMETTVTPERPIVVEETEAPQRGWAGTNVPRKEDKRLVQGEGV |
| Ga0307294_103595151 | 3300028810 | Soil | VSETTTVTEPIVVEEGETRPGYAGQNVPRKEDKRLV |
| Ga0307292_100503821 | 3300028811 | Soil | VSETTTVSEPIVVEQTETKPGYAGQNVPRKEDKRL |
| Ga0307300_102916802 | 3300028880 | Soil | VSESTTVSEPIVVEEQETKPGFAGQNVPRKEDKRLVQGEG |
| Ga0307277_103202911 | 3300028881 | Soil | VTETTVTPERPLVVEETETRPGFVGQNVPRKEDRRLVQGQGVFF |
| Ga0307308_101713573 | 3300028884 | Soil | MTETATPTTALVVEEQETRPGFIGTSVPRKEDRRLVQGEG |
| Ga0308202_10977212 | 3300030902 | Soil | MTETTVTPERPLVVEEGDVKPGFIGQSVPRKEDKRLVQGE |
| Ga0308187_101509621 | 3300031114 | Soil | VTETTVTPERPLVVEEGESKVGFIGQNVPRKEDKRLVQ |
| Ga0308195_10332551 | 3300031123 | Soil | VTETTVTPERPLVVEEGESKAGFIGQNVPRKEDKRLVQG |
| Ga0307469_106914891 | 3300031720 | Hardwood Forest Soil | MTETATPTSALVVEEQETRPGFIGTSVPRKEDRRL |
| Ga0307468_1018419502 | 3300031740 | Hardwood Forest Soil | MTETTVTEPLVVEETETRRGYAGQSVPRKEDQRLLQGE |
| Ga0307406_115645601 | 3300031901 | Rhizosphere | VSETTTLPEPVVVEEAEPKRGYAGQNVPRKEDKRLVQGEGV |
| Ga0307411_104513941 | 3300032005 | Rhizosphere | VSETTTLPEPVVIEEAEPKRGYAGQNVPRKEDKRLV |
| ⦗Top⦘ |