NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070370

Metagenome Family F070370

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070370
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 49 residues
Representative Sequence KTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ
Number of Associated Samples 106
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.38 %
% of genes near scaffold ends (potentially truncated) 88.62 %
% of genes from short scaffolds (< 2000 bps) 89.43 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.187 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.886 % of family members)
Environment Ontology (ENVO) Unclassified
(27.642 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.780 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.67%    β-sheet: 0.00%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF13418Kelch_4 13.82
PF08442ATP-grasp_2 6.50
PF09935DUF2167 3.25
PF14534DUF4440 2.44
PF13415Kelch_3 2.44
PF12697Abhydrolase_6 1.63
PF04773FecR 0.81
PF13884Peptidase_S74 0.81
PF01564Spermine_synth 0.81
PF00583Acetyltransf_1 0.81
PF03551PadR 0.81
PF02517Rce1-like 0.81
PF13854Kelch_5 0.81
PF15603Imm74 0.81
PF01914MarC 0.81
PF00879Defensin_propep 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 13.01
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 6.50
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 6.50
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 6.50
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 6.50
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.81
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.81
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.81
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.81
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.81
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102IZ456All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
2170459010|GIO7OMY01BX0LZAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium527Open in IMG/M
3300000443|F12B_14575107All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300000550|F24TB_12410298All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300000890|JGI11643J12802_12337240All Organisms → cellular organisms → Bacteria4433Open in IMG/M
3300000891|JGI10214J12806_10209869All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300000955|JGI1027J12803_104058381All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300002126|JGI24035J26624_1034522All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300004114|Ga0062593_101126142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia817Open in IMG/M
3300004114|Ga0062593_103263665All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004156|Ga0062589_102197620All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia565Open in IMG/M
3300004479|Ga0062595_100471185All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300004479|Ga0062595_100491742All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300004479|Ga0062595_100564190All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300004643|Ga0062591_101682287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium643Open in IMG/M
3300004643|Ga0062591_102935362All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005172|Ga0066683_10854184All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300005180|Ga0066685_10253771All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1213Open in IMG/M
3300005290|Ga0065712_10219559All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005293|Ga0065715_10114322All Organisms → cellular organisms → Bacteria2455Open in IMG/M
3300005327|Ga0070658_10249080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1507Open in IMG/M
3300005330|Ga0070690_100209717All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300005339|Ga0070660_100075465All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2640Open in IMG/M
3300005341|Ga0070691_10935123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia537Open in IMG/M
3300005353|Ga0070669_101053415All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005441|Ga0070700_100058804All Organisms → cellular organisms → Bacteria2417Open in IMG/M
3300005451|Ga0066681_10721858All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium605Open in IMG/M
3300005549|Ga0070704_100010015All Organisms → cellular organisms → Bacteria5758Open in IMG/M
3300005559|Ga0066700_10734890All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium672Open in IMG/M
3300005764|Ga0066903_108851864Not Available511Open in IMG/M
3300005841|Ga0068863_102120721All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005844|Ga0068862_102559539All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia522Open in IMG/M
3300006028|Ga0070717_10731107All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300006175|Ga0070712_101596597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Planktothrix → Planktothrix agardhii570Open in IMG/M
3300006852|Ga0075433_10764633All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006871|Ga0075434_101553209All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006871|Ga0075434_101903815All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium601Open in IMG/M
3300006904|Ga0075424_101618022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300006954|Ga0079219_11666028All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009093|Ga0105240_12123520All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300009156|Ga0111538_14067572All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300009162|Ga0075423_10706214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1065Open in IMG/M
3300009176|Ga0105242_10100897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Kocuria → Kocuria flava2445Open in IMG/M
3300009553|Ga0105249_12387840All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300010046|Ga0126384_10221382All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300010048|Ga0126373_11674467All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium700Open in IMG/M
3300010321|Ga0134067_10286990All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300010326|Ga0134065_10251282All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010359|Ga0126376_10076525All Organisms → cellular organisms → Bacteria2471Open in IMG/M
3300010360|Ga0126372_10509231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300010360|Ga0126372_11244752All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300010376|Ga0126381_100510687All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300010376|Ga0126381_103692953All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300010398|Ga0126383_10530215All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300012199|Ga0137383_10544061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia850Open in IMG/M
3300012200|Ga0137382_10151572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1572Open in IMG/M
3300012207|Ga0137381_10156593All Organisms → cellular organisms → Bacteria1963Open in IMG/M
3300012210|Ga0137378_10583895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1027Open in IMG/M
3300012210|Ga0137378_11253802All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012357|Ga0137384_10582806All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia914Open in IMG/M
3300012882|Ga0157304_1021973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia818Open in IMG/M
3300012895|Ga0157309_10121175All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia747Open in IMG/M
3300012927|Ga0137416_10208363All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1573Open in IMG/M
3300012929|Ga0137404_10047115All Organisms → cellular organisms → Bacteria3285Open in IMG/M
3300012951|Ga0164300_10546918All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia672Open in IMG/M
3300012951|Ga0164300_10618435All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia642Open in IMG/M
3300012957|Ga0164303_10087924All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1502Open in IMG/M
3300012957|Ga0164303_11331127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia533Open in IMG/M
3300012961|Ga0164302_10940825All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012961|Ga0164302_11348803All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia579Open in IMG/M
3300012971|Ga0126369_10331127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1537Open in IMG/M
3300012984|Ga0164309_11033972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia679Open in IMG/M
3300012986|Ga0164304_10443693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia934Open in IMG/M
3300012987|Ga0164307_10239241All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1260Open in IMG/M
3300012987|Ga0164307_10622799All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia835Open in IMG/M
3300012988|Ga0164306_10258704All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1251Open in IMG/M
3300012989|Ga0164305_11309895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium633Open in IMG/M
3300013306|Ga0163162_12025852All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300014154|Ga0134075_10565455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300014157|Ga0134078_10033503All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1701Open in IMG/M
3300014166|Ga0134079_10240241All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium779Open in IMG/M
3300015241|Ga0137418_10330221All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300015359|Ga0134085_10073929All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1390Open in IMG/M
3300015372|Ga0132256_101497539All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300015372|Ga0132256_103725676All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia513Open in IMG/M
3300015373|Ga0132257_101167640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae974Open in IMG/M
3300015373|Ga0132257_103604220All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300015374|Ga0132255_100195220All Organisms → cellular organisms → Bacteria → Proteobacteria2859Open in IMG/M
3300015374|Ga0132255_104088073All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300016371|Ga0182034_10276679All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300016371|Ga0182034_11244759All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300016422|Ga0182039_10581372All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300017792|Ga0163161_10184890All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300019868|Ga0193720_1016287All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300019877|Ga0193722_1002753All Organisms → cellular organisms → Bacteria4261Open in IMG/M
3300019882|Ga0193713_1003904All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4783Open in IMG/M
3300020001|Ga0193731_1093817All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium776Open in IMG/M
3300020006|Ga0193735_1031471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1620Open in IMG/M
3300021073|Ga0210378_10266149All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300021344|Ga0193719_10197560All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium859Open in IMG/M
3300021560|Ga0126371_11044291All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300025898|Ga0207692_10863324All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300025915|Ga0207693_11046173All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium622Open in IMG/M
3300025922|Ga0207646_10259467All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300025930|Ga0207701_10857484All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300025932|Ga0207690_11194859All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300025932|Ga0207690_11705068All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia526Open in IMG/M
3300025936|Ga0207670_10407957All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300025961|Ga0207712_10082730All Organisms → cellular organisms → Bacteria2341Open in IMG/M
3300026301|Ga0209238_1237481All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium540Open in IMG/M
3300026330|Ga0209473_1049908All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1829Open in IMG/M
3300026547|Ga0209156_10088813All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300027876|Ga0209974_10303145All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300028819|Ga0307296_10473034All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031231|Ga0170824_115171202All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300031474|Ga0170818_106461810All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia882Open in IMG/M
3300031744|Ga0306918_10452206All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300031942|Ga0310916_10803982All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300031945|Ga0310913_11125867All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031947|Ga0310909_10091544All Organisms → cellular organisms → Bacteria2430Open in IMG/M
3300032001|Ga0306922_10273000All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300033412|Ga0310810_11500057All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300034354|Ga0364943_0136746All Organisms → cellular organisms → Bacteria877Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_026340702170459002Grass SoilQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ
F62_043595102170459010Grass SoilNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ
F12B_1457510713300000443SoilDAQKIQEVKSLQSQSDPQLKAXXXXXXXXXXRVVRYQALRWVTQKRLGWQ*
F24TB_1241029813300000550SoilDAQKIQEVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ*
JGI11643J12802_1233724073300000890SoilSLSDAQKIQEVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ*
JGI10214J12806_1020986923300000891SoilQSDPQLKAILSSAQYDNLKVVRYQAVRWVTQKRLGWQ*
JGI1027J12803_10405838113300000955SoilEVTSLQKQSDPQLKAILSAAQYDKLKVVRYQALRWVTQKRLGWQ*
JGI24035J26624_103452223300002126Corn, Switchgrass And Miscanthus RhizosphereVTSLQKQSDPQXKAILSSAQYDKLXVVRYQAGRWVTQKRLGWQ*
Ga0062593_10112614213300004114SoilQEVTSLQKQSDPQLKTMLSSAQYDKLQAVRYQAVRRVTQKRLGWQ*
Ga0062593_10326366513300004114SoilKIQEVKSLQRQSDPRLKAILSSAQYDKLEVVRHQAVRWLTQKRLGWQ*
Ga0062589_10219762023300004156SoilLSNVQKTQEVKTLQNEADPQLKAILSSAQYDKLKPVRYQALRWVTQKRLGWQ*
Ga0062595_10047118513300004479SoilLQKQSDPQLKAILSSAQYDKLKVGRYQAVRWVTQKRLGWQ*
Ga0062595_10049174213300004479SoilQKIQEVKSIQKGSDPQLKAILSSAQYDKLKAVRYQAVRWITQKRLGWQ*
Ga0062595_10056419013300004479SoilQKQSDPQLKAILSSAQYDKLQVVRYQAGRWVTQKRLGWQ*
Ga0062591_10168228723300004643SoilNVQKTQEVTSLQKQSDPQLKAILSAAQYDKLKVVRYQALRWVTQKRLGWQ*
Ga0062591_10293536213300004643SoilKIQEVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAIRWLTQKRLGWQ*
Ga0066683_1085418413300005172SoilMAIRNNNSLSSVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVGR
Ga0066685_1025377143300005180SoilIAIRNNNLLSNVQKIQEVKTLQKQSDQQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ
Ga0065712_1021955913300005290Miscanthus RhizosphereQKIQEVKSLQKQSDPQLKAILSSAQYDKLKVVRHQVVRWVTQKRLGWQ*
Ga0065715_1011432233300005293Miscanthus RhizosphereMAIRTNNSLSDVQKIQEVKSLQKQSDPQLKAILSSAQYDKLKVVRHQVVRWVTQKRLGWQ
Ga0070658_1024908013300005327Corn RhizosphereNNSLSNVQKTQEVKTLQNESDPQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ*
Ga0070690_10020971713300005330Switchgrass RhizosphereSDAQKIQEVKSLQKQSDPQLKAILSSAQYDKLKLVRYQAVRWITQKRLGWQ*
Ga0070660_10007546533300005339Corn RhizosphereMAIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQAGRWVTQKRLGWQ
Ga0070691_1093512313300005341Corn, Switchgrass And Miscanthus RhizosphereNSLSNVQKTQEVKTLQNESDPQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ*
Ga0070669_10105341523300005353Switchgrass RhizosphereSDAQKIQEVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ*
Ga0070700_10005880473300005441Corn, Switchgrass And Miscanthus RhizosphereQKIQEVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ*
Ga0066681_1072185813300005451SoilLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ*
Ga0070704_10001001543300005549Corn, Switchgrass And Miscanthus RhizosphereMAIRNNNSLSDAQKIQEVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0066700_1073489013300005559SoilNNLLSKVQKIQEVKTLQKQSDQQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ*
Ga0066903_10885186423300005764Tropical Forest SoilQQQSDQQLKAILSSAQYDKLNAGRKQAVRWVTQPRLGWQ*
Ga0068863_10212072113300005841Switchgrass RhizosphereKQSDPQLKAILSSAQYDKLKLVRYQAVRWITQKRLGWQ*
Ga0068862_10255953913300005844Switchgrass RhizosphereVQKTQEVKTLQNESDPQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ*
Ga0070717_1073110713300006028Corn, Switchgrass And Miscanthus RhizosphereNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQAVRWITQKRLGWQ*
Ga0070712_10159659713300006175Corn, Switchgrass And Miscanthus RhizosphereQEVKTIQQQSDPQLKAILSSAQYNKLQVGRKQAVRWATQPRLGWQ*
Ga0075433_1076463333300006852Populus RhizosphereLQKQSDPQLKAILSFARYDKLKVVRYQALRWVTQKRLGWQ*
Ga0075434_10155320913300006871Populus RhizosphereLQKQSDPQLKAILSFARYDKLKGVRYQALRWVTQKRLGWQ*
Ga0075434_10190381523300006871Populus RhizosphereQRQSDPQLKAILSSAQYDKLEVVRYQAIRWLTQKRLGWQ*
Ga0075424_10161802213300006904Populus RhizosphereSLSDAQKIQDVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAVRWLTQKRLGWQ*
Ga0079219_1166602833300006954Agricultural SoilMAIRNDNSLSDTQKIQAVKDLQKQSDPQLKAILSSAQYDKLKTVRYQVVRWITQKRLGWQ
Ga0105240_1212352013300009093Corn RhizosphereQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQAGRWVTQKRLGWQ*
Ga0111538_1406757213300009156Populus RhizosphereQKIQDVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAVRWLTQKRLGWQ*
Ga0075423_1070621413300009162Populus RhizosphereMAIRNNNSLSDAQKIQEVKTLQKQSDPQLKAILSFARYDKLKGVRYQALRW
Ga0105242_1010089733300009176Miscanthus RhizosphereMSLQKQSDPQLKVILSSAHYDKLKVVRYQVVRWVTQKRLGWQ*
Ga0105249_1238784023300009553Switchgrass RhizosphereLSDAQKREEVKSLQKQSDPQLKGILSSAQYDKLKVVRYQAGRWITQKRLGWQ*
Ga0126384_1022138213300010046Tropical Forest SoilESDPQLKAILSSTQYDKLKLVRYQAVRWITQKRLGWQ*
Ga0126373_1167446713300010048Tropical Forest SoilMTIRNNNSLSDAQKIQEVESLQKQADPQLKAILSSAQYDKLKGVRYQAVRWITQKRLGWQ
Ga0134067_1028699023300010321Grasslands SoilTEEIKSLQKQSDPQLKEILSFAQYDKLKVVRYQAVRWVTQKRLGWQ*
Ga0134065_1025128213300010326Grasslands SoilSLSNVQKTEEVKTLQKQSDPQLKAILSSAQYDKLKVVRYQSIRWVTQKRLGWQ*
Ga0126376_1007652513300010359Tropical Forest SoilKRSDPQLKAILSSAQYDKLKVVRYQALRWVTQKRLGWQ*
Ga0126372_1050923133300010360Tropical Forest SoilVIAIRNNNSLSDAQKRQEVKSLQQQSDPPLKAILSSDQYDKLKVVRYQALRWVTQKRLGWQ*
Ga0126372_1124475213300010360Tropical Forest SoilKSLQKQSDPQLKASLSSAQYDKLKVVRYQAVRRITQKRLGWQ*
Ga0126381_10051068713300010376Tropical Forest SoilLSDAQKIQEVKSLQKQADPQLKAILSSAQYDKLKAVRYQAVRWITQKRLGWQ*
Ga0126381_10369295313300010376Tropical Forest SoilAIRNNNSLSDAQKIQEVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAVRWLTQKRLGWQ*
Ga0126383_1053021513300010398Tropical Forest SoilIVIRNNNSLSDAQKRQEVKSLQAQSEPQLKAILSSAQYDKLKVVRYQALRWVTQKRLGWQ
Ga0137383_1054406113300012199Vadose Zone SoilNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQRRLGWQ*
Ga0137382_1015157233300012200Vadose Zone SoilMAIRNNNSLSNVQKTQEVTSIQKQSDPQLKAILSSAQYDKLKVVRYQVVRWVTQKRLGWQ
Ga0137381_1015659313300012207Vadose Zone SoilQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ*
Ga0137378_1058389513300012210Vadose Zone SoilSLSSVQKTQELTSLQKQSDPQLKAILSSAQYDKLKVVRYQVVRWVTQKRLGWQ*
Ga0137378_1125380213300012210Vadose Zone SoilSLSSVQKTQELTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQRRLGWQ*
Ga0137384_1058280613300012357Vadose Zone SoilTEGVKTLQKQSDPQLKAILSSAQYDKLRVVRYQAVRWVTQRTLGWQ*
Ga0157304_102197323300012882SoilSNVQKTQEVKTLQNESDPQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ*
Ga0157309_1012117523300012895SoilEVKTLQNGSDAQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ*
Ga0137416_1020836313300012927Vadose Zone SoilQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ*
Ga0137404_1004711513300012929Vadose Zone SoilMAIRNNNSLSSVQKTQEVTSLQEQSDPQLKSILSSAQYDKLKVVRYQVVRWVTQKRLGWQ
Ga0164300_1054691813300012951SoilKTQEVKTLQNESDPQVKAILSSAQYDKLKTVRYQALRWITQKRLGWQ*
Ga0164300_1061843523300012951SoilKQSDPQLKAMLSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0164303_1008792413300012957SoilKQSDPQLKAILSSAQYDKLKVIRYQAGRWVTQKRLGWQ*
Ga0164303_1133112713300012957SoilVMAIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0164302_1094082513300012961SoilLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKAVRYQVVRWVTQKRLGWQ*
Ga0164302_1134880323300012961SoilSLQKQSDPQLKAILSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0126369_1033112713300012971Tropical Forest SoilLSDAQKIQEVKSLQRQSDPQLKAILSAAQYDKLEVVRYQAIRWLTQKRLGWQ*
Ga0164309_1103397223300012984SoilQKTQEVTSLQKQSDPQLKAILSSAQHDKLQVVRYQALRWVTQKRLGWQ*
Ga0164304_1044369313300012986SoilDPQLKAILSPAQYDKLKVVRYQAGRWVTQKRLGWQ*
Ga0164307_1023924113300012987SoilPQLKAILSPAQYDKLKVVRYQAGRWVTQKRLGWQ*
Ga0164307_1062279923300012987SoilAIRKNNSLSNVQKTQEVKTLQNESDPQLKAILSSAQYDKLKTVRYQALRWITQKRLGWQ*
Ga0164306_1025870413300012988SoilNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ*
Ga0164305_1130989513300012989SoilIAIRNNNLLSNVQKIQEVKTIQQQSDPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ
Ga0163162_1202585223300013306Switchgrass RhizosphereAIRNNNSLSDAQKIQEVKTLQNQSDPQLKAILSSGQYDKLKVVRYQALRWVTQKRLGWQ*
Ga0134075_1056545513300014154Grasslands SoilQQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ*
Ga0134078_1003350353300014157Grasslands SoilLSNVQKIQEVKTLQKQSDQQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ*
Ga0134079_1024024113300014166Grasslands SoilIRNNNSLSNIQKTQDAETLQKQSDLQLKGILSSAQYDKLKVVRYQAVRWITQKRLGWQ*
Ga0137418_1033022113300015241Vadose Zone SoilDVQKIQEVKSLQKQADPQLKAILSSAQYDKLKVVRYQSIRWVTQKRLGWQ*
Ga0134085_1007392933300015359Grasslands SoilQEVKTLQKQSDQQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ*
Ga0132256_10149753913300015372Arabidopsis RhizosphereIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0132256_10372567613300015372Arabidopsis RhizosphereIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDRLQVVRYQALRWVTQKRLGWQ*
Ga0132257_10116764013300015373Arabidopsis RhizosphereKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ*
Ga0132257_10360422013300015373Arabidopsis RhizosphereLQKQSDPQLKAILSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0132255_10019522013300015374Arabidopsis RhizosphereKQSDAQLKAILSSAQYDKLKVVRYQALRWVTQKRLGWQ*
Ga0132255_10408807323300015374Arabidopsis RhizosphereSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLQVVRYQALRWVTQKRLGWQ*
Ga0182034_1027667913300016371SoilLSDSQKIQDVKALQTQSDPQLKAILSSAQYDKLKAVRYHALRWVTQKRLGWQ
Ga0182034_1124475923300016371SoilNNSLSDAQKIQEVKSLQKQADPQLKVILSSAQYDKLKAVRYQAVRWITQKRLGWQ
Ga0182039_1058137213300016422SoilIAIRNNNSLSDSQKIQDVKALQTQSDPQLKAILSSAQYDKLKAVRYHALRWVTQKRLGWQ
Ga0163161_1018489013300017792Switchgrass RhizosphereTSLSDAQKIQVVKSLQKQSDPQLKALLSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0193720_101628713300019868SoilLIATRNNNSLSDVQKIQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGW
Ga0193722_100275313300019877SoilMAIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ
Ga0193713_100390423300019882SoilMKIRNNNSLSSGQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQRRLGWQ
Ga0193731_109381713300020001SoilEEVKTLQKESDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ
Ga0193735_103147123300020006SoilMAIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQVVRWVTQKRLGWQ
Ga0210378_1026614933300021073Groundwater SedimentNSLSNVQKIQGVKAIQQQSDPQLKAILPSAQYEKLRVVRQAAIRWVTQARLGWQ
Ga0193719_1019756023300021344SoilIQEITSLQKQSDPQLKAILSSAQYDKLKAVRYQAVRWVTQKRLGWQ
Ga0126371_1104429113300021560Tropical Forest SoilAQKIQEVKSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0207692_1086332423300025898Corn, Switchgrass And Miscanthus RhizosphereKQSDPQLKAILSSAQYDKLQVVRYQAVRWITQKRLGWQ
Ga0207693_1104617323300025915Corn, Switchgrass And Miscanthus RhizosphereAIRNNNSLSNVQKTQEVTSLQKQSDPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ
Ga0207646_1025946743300025922Corn, Switchgrass And Miscanthus RhizosphereGVKTIQQQSDPQLKAILSSAQYDKLNAGRKQAIRWVTQPRLGWQ
Ga0207701_1085748413300025930Corn, Switchgrass And Miscanthus RhizosphereLQKQSDPQLKAILSSAQYDKLKVVRYQALRWVTQKRLGWQ
Ga0207690_1119485923300025932Corn RhizosphereRNNNSLSDAQKIQGVKDLQKQSDPQLKAILSSAQYDNLKVVRYQAVRWVTQKRLGWQ
Ga0207690_1170506813300025932Corn RhizosphereRKNNSLSNVQKTQELKTLQNESDPQLKAILSSAQYDKLKAVRYQALRWITQKRLGWQ
Ga0207670_1040795733300025936Switchgrass RhizosphereKTQEVTSLQKQSDPQFKAILSSAQYDKLQVVRYQAGRWVTQKRLGWQ
Ga0207712_1008273023300025961Switchgrass RhizosphereMSLQKQSDPQLKVILSSAHYDKLKVVRYQVVRWVTQKRLGWQ
Ga0209238_123748113300026301Grasslands SoilQDAETLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0209473_104990813300026330SoilSDPQLKAILSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0209156_1008881313300026547SoilTEEVKSLQKQSDPQLKEILSFAQYDKLKVVRYQAVRWVTQKRLGWQ
Ga0209974_1030314513300027876Arabidopsis Thaliana RhizosphereQGVKDLQKQSDPQLKAILSSAQYDNLKVVRYQAVRWVTQKRLGWQ
Ga0307296_1047303423300028819SoilSLQKQSDPQLKAILSSAQYDKLKAVRYQAVRWVTQKRLGWQ
Ga0170824_11517120213300031231Forest SoilNSLSNVQKTQEVMSLQKQSDPQLKAILSSAQYDKLKVVRYQVVRWVTQKRLGWQ
Ga0170818_10646181023300031474Forest SoilSLQKQADPQLKAILSSAQYDKLKVVRYQAGRWVTQKRLGWQ
Ga0306918_1045220613300031744SoilRNNNSLSDAQKIQEVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAIRWLTQKRLGWQ
Ga0310916_1080398223300031942SoilAIRNNNSLSDAQKIQEVKSLQRQSDPQLKAILSSAQYDKLEVVRYQAIRWLTQKRLGWQ
Ga0310913_1112586713300031945SoilLSDAQKIQEVKSLQKQADPQLKVILSSAQYDKLKAVRYQAVRWITQKRLGWQ
Ga0310909_1009154433300031947SoilDVKALQTQSDPQLKAILSSAQYDKLKAVRYHALRWVTQKRLGWQ
Ga0306922_1027300053300032001SoilQADPQLKTILSSAQYDKLEVVRYQAVRWLTQKRLGWQ
Ga0310810_1150005713300033412SoilSLSDAQKIQEVKSLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWITQKRLGWQ
Ga0364943_0136746_2_1693300034354SedimentNNSLSDVQKTEEVKTLQKQSDPQLKAILSSAQYDKLKVVRYQAVRWVTQKRLGWQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.