NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070358

Metagenome / Metatranscriptome Family F070358

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070358
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 41 residues
Representative Sequence FYLDHRARIEDIEINPLMVRPNGAVAVDVRVIWRTGVD
Number of Associated Samples 109
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 92.68 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.984 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.073 % of family members)
Environment Ontology (ENVO) Unclassified
(26.016 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.463 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.06%    β-sheet: 34.85%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF02771Acyl-CoA_dh_N 72.36
PF05378Hydant_A_N 11.38
PF00903Glyoxalase 3.25
PF02538Hydantoinase_B 1.63
PF07731Cu-oxidase_2 0.81
PF13505OMP_b-brl 0.81
PF12697Abhydrolase_6 0.81
PF01977UbiD 0.81
PF13561adh_short_C2 0.81
PF00873ACR_tran 0.81
PF13384HTH_23 0.81
PF04480DUF559 0.81
PF12681Glyoxalase_2 0.81
PF00331Glyco_hydro_10 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 72.36
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 22.76
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 3.25
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.81
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.81
COG3693Endo-1,4-beta-xylanase, GH35 familyCarbohydrate transport and metabolism [G] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.98 %
UnclassifiedrootN/A26.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1004785All Organisms → cellular organisms → Bacteria → Proteobacteria2192Open in IMG/M
3300000858|JGI10213J12805_10154239All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis747Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1049307All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis658Open in IMG/M
3300001593|JGI12635J15846_10637929Not Available617Open in IMG/M
3300001661|JGI12053J15887_10361292All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300003995|Ga0055438_10288643All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300004081|Ga0063454_100643204All Organisms → cellular organisms → Bacteria → Proteobacteria785Open in IMG/M
3300004156|Ga0062589_100876670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales823Open in IMG/M
3300004633|Ga0066395_10532656All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae681Open in IMG/M
3300005332|Ga0066388_101761459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus1099Open in IMG/M
3300005332|Ga0066388_104736726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300005764|Ga0066903_100608357All Organisms → cellular organisms → Bacteria → Proteobacteria1896Open in IMG/M
3300005764|Ga0066903_104776021All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300005764|Ga0066903_104852421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales715Open in IMG/M
3300005764|Ga0066903_106691700All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300005843|Ga0068860_100023101All Organisms → cellular organisms → Bacteria → Proteobacteria6013Open in IMG/M
3300005921|Ga0070766_10536182All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006038|Ga0075365_10838257Not Available649Open in IMG/M
3300006050|Ga0075028_100928030All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300006059|Ga0075017_100909528All Organisms → cellular organisms → Bacteria → Proteobacteria683Open in IMG/M
3300006176|Ga0070765_100229448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1696Open in IMG/M
3300006178|Ga0075367_10471161All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300006178|Ga0075367_10520771All Organisms → cellular organisms → Bacteria → Proteobacteria755Open in IMG/M
3300006800|Ga0066660_10589565All Organisms → cellular organisms → Bacteria → Proteobacteria930Open in IMG/M
3300006847|Ga0075431_100368156All Organisms → cellular organisms → Bacteria → Proteobacteria1443Open in IMG/M
3300006847|Ga0075431_100440781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1299Open in IMG/M
3300006854|Ga0075425_102912270All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300006904|Ga0075424_102832675All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300006914|Ga0075436_100133462All Organisms → cellular organisms → Bacteria → Proteobacteria1742Open in IMG/M
3300007788|Ga0099795_10065605All Organisms → cellular organisms → Bacteria → Proteobacteria1358Open in IMG/M
3300009012|Ga0066710_102207156All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300009089|Ga0099828_10377005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1279Open in IMG/M
3300009094|Ga0111539_11805825Not Available709Open in IMG/M
3300009143|Ga0099792_10545856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium732Open in IMG/M
3300009808|Ga0105071_1109984All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010042|Ga0126314_10386998All Organisms → cellular organisms → Bacteria → Proteobacteria1007Open in IMG/M
3300010045|Ga0126311_11094019Not Available655Open in IMG/M
3300010046|Ga0126384_11712410Not Available595Open in IMG/M
3300010359|Ga0126376_10917902All Organisms → cellular organisms → Bacteria → Proteobacteria868Open in IMG/M
3300010359|Ga0126376_13011504All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010362|Ga0126377_11202082Not Available829Open in IMG/M
3300010366|Ga0126379_11215344Not Available860Open in IMG/M
3300010398|Ga0126383_11061238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium899Open in IMG/M
3300010398|Ga0126383_12895639All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012209|Ga0137379_11047984Not Available721Open in IMG/M
3300012360|Ga0137375_10993241Not Available661Open in IMG/M
3300012469|Ga0150984_112164125Not Available563Open in IMG/M
3300012685|Ga0137397_10543467All Organisms → cellular organisms → Bacteria → Proteobacteria865Open in IMG/M
3300012908|Ga0157286_10056960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1024Open in IMG/M
3300012918|Ga0137396_10661955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria771Open in IMG/M
3300012927|Ga0137416_10912337Not Available782Open in IMG/M
3300012929|Ga0137404_11679891All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300012971|Ga0126369_11191705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium851Open in IMG/M
3300012987|Ga0164307_11551559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria560Open in IMG/M
3300014254|Ga0075312_1085105Not Available642Open in IMG/M
3300014326|Ga0157380_11927400Not Available652Open in IMG/M
3300015372|Ga0132256_100136167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2444Open in IMG/M
3300016270|Ga0182036_11867087Not Available509Open in IMG/M
3300017658|Ga0182738_1296030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria641Open in IMG/M
3300018086|Ga0187769_11466922Not Available516Open in IMG/M
3300018088|Ga0187771_11649822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium544Open in IMG/M
3300018422|Ga0190265_12441822Not Available622Open in IMG/M
3300018422|Ga0190265_12622743Not Available601Open in IMG/M
3300018469|Ga0190270_12292937Not Available601Open in IMG/M
3300020018|Ga0193721_1079717All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300021340|Ga0194041_10275225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium511Open in IMG/M
3300021363|Ga0193699_10047620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes1650Open in IMG/M
3300021474|Ga0210390_11548248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300021478|Ga0210402_10113448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2444Open in IMG/M
3300021560|Ga0126371_13158226All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300022557|Ga0212123_10286057All Organisms → cellular organisms → Bacteria → Proteobacteria1161Open in IMG/M
3300025939|Ga0207665_11352758All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300027326|Ga0209731_1034146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300027334|Ga0209529_1041043All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300027641|Ga0208827_1004029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5898Open in IMG/M
3300027648|Ga0209420_1053556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1207Open in IMG/M
3300027875|Ga0209283_10082351All Organisms → cellular organisms → Bacteria → Proteobacteria2086Open in IMG/M
3300027875|Ga0209283_10258180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1154Open in IMG/M
3300027880|Ga0209481_10710796Not Available522Open in IMG/M
3300027884|Ga0209275_10047394All Organisms → cellular organisms → Bacteria → Proteobacteria2051Open in IMG/M
3300028047|Ga0209526_10366902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria961Open in IMG/M
3300028708|Ga0307295_10233646Not Available526Open in IMG/M
3300028771|Ga0307320_10238532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300028819|Ga0307296_10780502All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300028906|Ga0308309_10826081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria805Open in IMG/M
3300028906|Ga0308309_11013697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300031421|Ga0308194_10354630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300031421|Ga0308194_10361517Not Available519Open in IMG/M
3300031546|Ga0318538_10340020All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031561|Ga0318528_10004440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5959Open in IMG/M
3300031564|Ga0318573_10128021All Organisms → cellular organisms → Bacteria → Proteobacteria1321Open in IMG/M
3300031679|Ga0318561_10212700All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300031679|Ga0318561_10737162Not Available541Open in IMG/M
3300031715|Ga0307476_11290981Not Available533Open in IMG/M
3300031718|Ga0307474_10734082All Organisms → cellular organisms → Bacteria → Proteobacteria780Open in IMG/M
3300031718|Ga0307474_11639471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031726|Ga0302321_101422257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium798Open in IMG/M
3300031747|Ga0318502_10514908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium717Open in IMG/M
3300031771|Ga0318546_10398020All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031780|Ga0318508_1203749Not Available567Open in IMG/M
3300031792|Ga0318529_10143065All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300031794|Ga0318503_10201534All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031795|Ga0318557_10438717Not Available600Open in IMG/M
3300031820|Ga0307473_10680328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300031854|Ga0310904_10896478Not Available626Open in IMG/M
3300031880|Ga0318544_10155223All Organisms → cellular organisms → Bacteria → Proteobacteria878Open in IMG/M
3300031890|Ga0306925_10634648All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300031941|Ga0310912_11105768Not Available605Open in IMG/M
3300031947|Ga0310909_10681642All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031954|Ga0306926_12046805Not Available642Open in IMG/M
3300031959|Ga0318530_10397800Not Available571Open in IMG/M
3300031981|Ga0318531_10103157All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300032001|Ga0306922_10651167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1112Open in IMG/M
3300032054|Ga0318570_10433714Not Available600Open in IMG/M
3300032091|Ga0318577_10399947All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300032174|Ga0307470_10460512Not Available917Open in IMG/M
3300032180|Ga0307471_103805940Not Available534Open in IMG/M
3300032783|Ga0335079_11870348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium582Open in IMG/M
3300032896|Ga0335075_10215049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes2272Open in IMG/M
3300032898|Ga0335072_10985862All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300032955|Ga0335076_10592982All Organisms → cellular organisms → Bacteria → Proteobacteria990Open in IMG/M
3300033134|Ga0335073_10684741All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300033289|Ga0310914_10721710All Organisms → cellular organisms → Bacteria893Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.63%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.81%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.81%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017658Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2)EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021340Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9mEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_100478533300000580Forest SoilALEAAALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA*
JGI10213J12805_1015423923300000858SoilEAAALAVGQFFLDHRTKIKDIEINPLMVRATGAVAVDVRVIWREDVQGA*
AP72_2010_repI_A001DRAFT_104930723300000893Forest SoilALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA*
JGI12635J15846_1063792913300001593Forest SoilGRFYLDHRARIEEIEINPLIIRPHGAIAVDVRVAWRSAKESV*
JGI12053J15887_1036129213300001661Forest SoilRARIAEIEINPLIIKPAGAIAVDVRVLWRDESKQH*
Ga0055438_1028864313300003995Natural And Restored WetlandsALGRFFLDHRARIADIEINPLMVRANGAVAVDVRVLWRDGVEGA*
Ga0063454_10064320423300004081SoilQFYLDHRARIEDIEINPLMIRASGAVAVDVRVIWRTGYA*
Ga0062589_10087667023300004156SoilEAAALALARFFLDHRARIADIEINPLIVRGSGAVAVDVRVLWREGEPP*
Ga0066395_1053265613300004633Tropical Forest SoilALSRFYLDHRARIADIEINPLMIGEKGAVAVDVRVLWREGG*
Ga0066388_10176145923300005332Tropical Forest SoilALALGRFFLDHRARIKDIEINPLMVRPRRSAEQAGAVAVDVRVVWREDAQGV*
Ga0066388_10473672623300005332Tropical Forest SoilALGRFFLDHRARIKDIEINPVMERPTDAVAVDVRVIWREGA*
Ga0066903_10060835713300005764Tropical Forest SoilRARISDVEINPLMVRPKGGAVAVDVRVVWREDAEGV*
Ga0066903_10477602113300005764Tropical Forest SoilFYLDHRARIEDIEINPLMVRPNGAVAVDVRVIWRTGVD*
Ga0066903_10485242123300005764Tropical Forest SoilFYLDHRAAIEDIEINPLIVRDSGAVAVDVRVIWRNRSTGDR*
Ga0066903_10669170023300005764Tropical Forest SoilTVLALGRFYLDHRAKISDIEINPLVVRSSGCVAVDVRVLWR*
Ga0068860_10002310113300005843Switchgrass RhizosphereHRARIKDIEINPLMVRPAGQGTVAVDVRVLWREDSQGA*
Ga0070766_1053618213300005921SoilRFYLDHRSRIADIEINPLMVGPAGAIAVDVRVLWRAAS*
Ga0075365_1083825713300006038Populus EndosphereRIKDIEINPLMVRPRHGAKRAGAVAVDVRVVWREDAQGV*
Ga0075028_10092803013300006050WatershedsFYLDHRARIEEIEINPLIVRRHGAVAVDVRVAWRGAKESV*
Ga0075017_10090952823300006059WatershedsYLDHRARIAEIEINPLIVRASGAVAVDVRVAWHDSKENA*
Ga0070765_10022944813300006176SoilFLDHRARIAEIEINPLMVRGSGAVAVDVRVAWRERPGSVAASG*
Ga0075367_1047116133300006178Populus EndosphereIQALAQFYLDHRACIEDIEINPLMVRPSGAVAVDVRVIWKS*
Ga0075367_1052077123300006178Populus EndosphereLDHRARIKDIEINPLLVRPQGKGAVAVDVRVIWHDK*
Ga0066660_1058956513300006800SoilDHRARIADIEVNPLIVRSNGAVAVDIRVLWRNDSAGET*
Ga0075431_10036815613300006847Populus RhizosphereRIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA*
Ga0075431_10044078113300006847Populus RhizosphereARIKDIEINPLMVRPRRSGPDSAQASHAERAGAVAVDVRVVWREGAQGV*
Ga0075425_10291227023300006854Populus RhizosphereVLALAKFYLDHRSKIDDIEINPLMVRQSGAVAVDVRVIWRE*
Ga0075424_10283267523300006904Populus RhizosphereLDHRARIEDIEINPLMVRPHGKGAVAVDVRVIWRDTK*
Ga0075436_10013346233300006914Populus RhizosphereALGLARFYRDHRTRIAEIEINPLTISAQGAVAVDVRVAWREENT*
Ga0099795_1006560513300007788Vadose Zone SoilHRARIEDIEINPLMVHPSGAIAVDMRVIWRTGEA*
Ga0066710_10220715623300009012Grasslands SoilLDHRARVAEIEINPLMVCTRGAVAVDVRVLWRRDGGDA
Ga0099828_1037700513300009089Vadose Zone SoilALALGQFFLDHRARISDIEINPLMVRQTGCVAVDVRVLWREDV*
Ga0111539_1180582513300009094Populus RhizosphereSIKDIEINPLRVRPRRGGPDSAQARQGERAGAVAVDVRVVWREDAQGA*
Ga0099792_1054585613300009143Vadose Zone SoilTASGLAQFFLDHRARIRDVEINPLMVRPSGAVAVDVRVLWREDV*
Ga0105071_110998423300009808Groundwater SandLAQFYLDHRARIDDIEINPLMVRGNGAVAVDVRVIWRA*
Ga0126314_1038699813300010042Serpentine SoilAQFYLDHRARIEDVEINPLTVRPNGRGAVAVDVRVIWRNDNEGNA*
Ga0126311_1109401913300010045Serpentine SoilFFLDHRERIADIEINPLMVRPFGRGAVAVDVRVLWRDESGSMA*
Ga0126384_1171241023300010046Tropical Forest SoilALAQFYLDHRARIRDVEINPLIVRAAGRGAVAVDVRVLWREGS*
Ga0126376_1091790223300010359Tropical Forest SoilALARFYLDHRSKIDDIEINPLMVRSSGAVAVDVRVIWRR*
Ga0126376_1301150413300010359Tropical Forest SoilKIVLALAKFYLDHRARIDDIEINPLMVRPNGAVAVDVRVIWRTGVD*
Ga0126377_1120208213300010362Tropical Forest SoilYLDHRARIEDIEINPLMVRPNGAVAVDVRVIWKS*
Ga0126379_1121534413300010366Tropical Forest SoilHRAHIEDIEINPLMVRPSGAIAVDVRVIWRERNP*
Ga0126383_1106123823300010398Tropical Forest SoilALSRFYLDHRARIADIEINPLMIGEKGAVAVDVRVLWREGS*
Ga0126383_1289563913300010398Tropical Forest SoilLDHRARIEDIEINPLMVRSSGAVAVDVRVIWREGKA*
Ga0137379_1104798423300012209Vadose Zone SoilDHRSKIEDVEINPLMVRQQGAVAVDVRVIWRTGDA*
Ga0137375_1099324113300012360Vadose Zone SoilVRALAQFYLDHRARIEDIEINPLMVRPSSAVAVDVRVIWRTGEA*
Ga0150984_11216412513300012469Avena Fatua RhizosphereEDVEINPLMVRPDGRGAVAVDVRVIWRNDNGGNA*
Ga0137397_1054346723300012685Vadose Zone SoilLALAQFYLDHRARIEDIEINPLMVRQKGAVAVDVRVIWRSHSGGDA*
Ga0157286_1005696013300012908SoilHRARIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA*
Ga0137396_1066195523300012918Vadose Zone SoilFFLDHRARIADIEINPLIVRQSGAVAVDVRVLWREGEPA*
Ga0137416_1091233723300012927Vadose Zone SoilERADPGALALAQFHLDHRARIEEIEINPLMVRALGRGAVAVDVRVLWRDDTKLHKS*
Ga0137404_1167989123300012929Vadose Zone SoilAAVRALAQFYLDHRARIEDIEINPLMVRSSGAVAVDVRVIWRTGDA*
Ga0126369_1119170513300012971Tropical Forest SoilALEAAALALGRFFLDHRARIKEIEINPVMVRTGSADIGAIAVDVRVLWQDGAEDA*
Ga0164307_1155155913300012987SoilLAHFYADHRARVEDVEINPLMVRTNGAVAVDVRVIWKT*
Ga0075312_108510523300014254Natural And Restored WetlandsQFFLDHRANIDDIEINPLMVRPNGAVAVDVRVIWRNNDREGA*
Ga0157380_1192740023300014326Switchgrass RhizosphereARIDDIEINPLMVRPNGAVAVDVRVIWKDAKGDH*
Ga0132256_10013616763300015372Arabidopsis RhizosphereIKDIEINPLIVRPSGDGAVAVDVRVLWREEGVQPT*
Ga0182036_1186708723300016270SoilALAIGRLFLDHRARIRDIEINPLIVRPDACGAVAVDVRVLWRDDD
Ga0182738_129603023300017658CompostYLDHRARIADIEINPLVLRPDGEGACAVDVRVIWR
Ga0187769_1146692213300018086Tropical PeatlandAALALARFYLNHRARIAEIELNPLMVRQQGAVAVDVRVVWREEN
Ga0187771_1164982223300018088Tropical PeatlandQFYLDHRARVAEIEINPLMVGASGATAVDLRVVWRE
Ga0190265_1244182213300018422SoilAQFYLDHRARIEDIEINPLMVRPQGNGAVAVDVRVIWRDAK
Ga0190265_1262274323300018422SoilLDHRTRIEDIEINPLMVRPQGKGAVAVDVRVIWRDAK
Ga0190270_1229293723300018469SoilLGRFFLDHRARMDDIEINPLMVRENGAVAVDVRVLWRDSAQGA
Ga0193721_107971713300020018SoilLAQFYLDHRARVAEIEINPLMVCTRGAIAVDVRVLWCRDGGDP
Ga0194041_1027522513300021340Anoxic Zone FreshwaterFYLDHRAAVADIEINPLIVRPAGQGVCAVDVRVIWK
Ga0193699_1004762013300021363SoilRIRDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA
Ga0210390_1154824823300021474SoilLETATLGLARFYLDHRARIAEIEFNPLMVRNNGAVAVDVRVVWREEKK
Ga0210402_1011344813300021478SoilHRGAIKDIEINPLIVRRSGSGAVAVDVRVVWHTEQGG
Ga0126371_1315822623300021560Tropical Forest SoilLDHRARISDIEINPLMVRSTGAVAVDVRVIWREGAAEP
Ga0212123_1028605713300022557Iron-Sulfur Acid SpringFYLDHRARVAEIEVNPLIVRGNGAVAVDVRVVWHRENPREENSREEKM
Ga0207665_1135275823300025939Corn, Switchgrass And Miscanthus RhizosphereDHRARIAEIEINPLMVSAQGAIAVDVRVAWREENA
Ga0209731_103414633300027326Forest SoilLLARAALALGRFYLDHRANIEEIEINPLIVRPQGAVAVDVRVAWRRG
Ga0209529_104104313300027334Forest SoilNHRAKIDEIEINPLIVRPQGAIAVDVRVAWRKENV
Ga0208827_100402913300027641Peatlands SoilALALGRFYLDHRARIEEIEINPLIVRPQGAVAVDVRVAWRKENR
Ga0209420_105355613300027648Forest SoilRLRIAEIEINPLIVRSNGAVAVDVRVVWREGEAPPCT
Ga0209283_1008235113300027875Vadose Zone SoilALGRFFLDHRARIQDIEINPLMVRCSGTVAIDVRVLWRADIQGAD
Ga0209283_1025818013300027875Vadose Zone SoilALALGQFFLDHRARISDIEINPLMVRQTGCVAVDVRVLWREGV
Ga0209481_1071079613300027880Populus RhizosphereHRARIEDIEINPLMVRPQGKGAVAVDVRVIWRDAK
Ga0209275_1004739443300027884SoilYLDHRAKIDEIEINPLIVRPRGAVAVDVRVAWRES
Ga0209526_1036690213300028047Forest SoilLDHRARIKDIEINPLMVRPNGCGTVAVDVRVLWREDGEGA
Ga0307295_1023364613300028708SoilLDHRARIKDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA
Ga0307320_1023853213300028771SoilLTQFLLDHRARIKDIEINPLMVRPAGQGTVAVDVRVLWREDSQGA
Ga0307296_1078050213300028819SoilFLDHRTRIKDIEINPLMVRARGCGAIAVDVRVVWRDDGEGDQTA
Ga0308309_1082608123300028906SoilALSRFFLDHRARIAEIEINPLMVRGSGAVAVDVRVAWRERPGSVAASG
Ga0308309_1101369723300028906SoilALARFYLDHRARIADIEINPLMIRANGAVAVDVRVVWRE
Ga0308194_1035463023300031421SoilVRALAQFYLDHRARIEDIEINPLMVRPSGAVAVDVRVIWKS
Ga0308194_1036151723300031421SoilRARIKDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA
Ga0318538_1034002013300031546SoilALVATVLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR
Ga0318528_1000444013300031561SoilALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA
Ga0318573_1012802113300031564SoilFYLDHRARIAEIEINPLMIRDCGRGAVAVDVRVLWRDQQ
Ga0318561_1021270023300031679SoilDHGARIKDIEINPLVVRAAGRGAVAVDVRVLWRSDGQG
Ga0318561_1073716213300031679SoilPPRRARIAEIEINPLMIRDCGRGAVAVDVRVLWRDQQ
Ga0307476_1129098123300031715Hardwood Forest SoilYLDHRSRIADIEINPLMVGPASAIAVDVRVLWRAAS
Ga0307474_1073408213300031718Hardwood Forest SoilLALGRFYLDHRGKIEEIEINPLIVRPQGAVAVDVRVAWRKEK
Ga0307474_1163947113300031718Hardwood Forest SoilEAAAMALGRFYLDHRARIEEIEINPLIVRASGAVAVDVRVAWSKENK
Ga0302321_10142225713300031726FenDHRAKIADIEINPLMVREKGAVAVDVRVLWRNDTGA
Ga0318502_1051490823300031747SoilGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA
Ga0318546_1039802023300031771SoilGRFFLDHRENIKDIEINPLMVRARGRGAMAVDVRVLWRKDGEG
Ga0318508_120374913300031780SoilLDHRARIADIEINPLIVRARAHGAVAVDVRVSWRDA
Ga0318529_1014306513300031792SoilHRENIKDIEINPLMVRARGRGAMAVDVRVLWRKDGEG
Ga0318503_1020153423300031794SoilDHRESIKDIEINPLMVRAKGRGAVAVDMRVLWRKDGEG
Ga0318557_1043871713300031795SoilAAALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA
Ga0307473_1068032823300031820Hardwood Forest SoilALAQFYLDHRARIAEIEINPLVIRANGAVAVDVRALWREPQ
Ga0310904_1089647813300031854SoilHRARIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA
Ga0318544_1015522313300031880SoilFYLDHRARIADIEINPLIVRARAHGAVAVDVRVSWRDA
Ga0306925_1063464813300031890SoilALEAAALALAKFYLDHRAAVAEIEINPLTVQHNGAVPVDVRVIWRETN
Ga0310912_1110576813300031941SoilALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA
Ga0310909_1068164213300031947SoilGRFYLDHRTRIGDIEINPLVVRASGCVAVDVRVLWR
Ga0306926_1204680523300031954SoilGHFYLDHRARIADIEINPLIVRPHPHGAVAVDVRVAWRDP
Ga0318530_1039780013300031959SoilLALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA
Ga0318531_1010315713300031981SoilFFLDHGARIKDIEINPLVVRAAGRGAVAVDVRVLWRSDGQG
Ga0306922_1065116723300032001SoilRTAFEAAALALARFFLDHRARIKDIEINPLMVRANNQSPVAVDVRVLWREHGEGT
Ga0318570_1043371413300032054SoilALARFFLDHRARIKDIEINPLMVRANNQSPVAVDVRVLWREHGEGT
Ga0318577_1039994723300032091SoilTVLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR
Ga0307470_1046051213300032174Hardwood Forest SoilGALAQFYLDHRARIEDIEINPLMVRPSGAVAVDVRVIWKS
Ga0307471_10380594023300032180Hardwood Forest SoilALGRFFLDHRARIADIEINPLMVRQHGAVAVDVRVLWRNQGA
Ga0335079_1187034823300032783SoilEAAALALGRFYLDHRVRNADIEINPLIVRPGPHGAVAVDVRVAWRDA
Ga0335075_1021504933300032896SoilLALGRFYLDHRANIAEIEINPLMVRSDGAMAVDLRVVWREEKM
Ga0335072_1098586213300032898SoilYLDHRARIGEIEINPLMVRATDAVAVDVRVAWRGESK
Ga0335076_1059298223300032955SoilATALALARFYLDHRARISEIEFNPLIVRNSGAVAVDVRVNWRGENV
Ga0335073_1068474123300033134SoilALSRFFLDHRARIAEIEINPLIVRDAGAVAIDVRVVWRQEQV
Ga0310914_1072171023300033289SoilVLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.