NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070355

Metagenome / Metatranscriptome Family F070355

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070355
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 40 residues
Representative Sequence MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKF
Number of Associated Samples 106
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.93 %
% of genes near scaffold ends (potentially truncated) 78.05 %
% of genes from short scaffolds (< 2000 bps) 71.54 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.480 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.943 % of family members)
Environment Ontology (ENVO) Unclassified
(23.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.780 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.76%    β-sheet: 0.00%    Coil/Unstructured: 52.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00589Phage_integrase 8.94
PF02899Phage_int_SAM_1 2.44
PF13338AbiEi_4 1.63
PF03135CagE_TrbE_VirB 1.63
PF02371Transposase_20 1.63
PF01381HTH_3 0.81
PF08808RES 0.81
PF13655RVT_N 0.81
PF00498FHA 0.81
PF00082Peptidase_S8 0.81
PF13683rve_3 0.81
PF01914MarC 0.81
PF04465DUF499 0.81
PF12950TaqI_C 0.81
PF13531SBP_bac_11 0.81
PF04326AlbA_2 0.81
PF07730HisKA_3 0.81
PF13231PMT_2 0.81
PF00483NTP_transferase 0.81
PF03747ADP_ribosyl_GH 0.81
PF13538UvrD_C_2 0.81
PF01935DUF87 0.81
PF13411MerR_1 0.81
PF00899ThiF 0.81
PF01925TauE 0.81
PF08843AbiEii 0.81
PF01555N6_N4_Mtase 0.81
PF00149Metallophos 0.81
PF14464Prok-JAB 0.81
PF02384N6_Mtase 0.81
PF07859Abhydrolase_3 0.81
PF13020NOV_C 0.81
PF00903Glyoxalase 0.81
PF16542PNKP_ligase 0.81
PF13476AAA_23 0.81
PF13620CarboxypepD_reg 0.81
PF01609DDE_Tnp_1 0.81
PF04970LRAT 0.81
PF03819MazG 0.81
PF14279HNH_5 0.81
PF03235DUF262 0.81
PF01850PIN 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 2.44
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 2.44
COG3547TransposaseMobilome: prophages, transposons [X] 1.63
COG3451Type IV secretory pathway, VirB4 componentIntracellular trafficking, secretion, and vesicular transport [U] 1.63
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.81
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.81
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.81
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.81
COG5421TransposaseMobilome: prophages, transposons [X] 0.81
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.81
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.81
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.81
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.81
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.81
COG3293TransposaseMobilome: prophages, transposons [X] 0.81
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.81
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 0.81
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.81
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.81
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.81
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.81
COG1397ADP-ribosylglycohydrolasePosttranslational modification, protein turnover, chaperones [O] 0.81
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.81
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.81
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.29 %
UnclassifiedrootN/A31.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10242986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae585Open in IMG/M
3300001546|JGI12659J15293_10011079All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300005181|Ga0066678_10046861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2444Open in IMG/M
3300005436|Ga0070713_100600425All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005436|Ga0070713_102365393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui514Open in IMG/M
3300005538|Ga0070731_10452864All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium854Open in IMG/M
3300005610|Ga0070763_10057672All Organisms → cellular organisms → Bacteria1863Open in IMG/M
3300005614|Ga0068856_102273574Not Available551Open in IMG/M
3300005993|Ga0080027_10299172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300006162|Ga0075030_100001262All Organisms → cellular organisms → Bacteria22752Open in IMG/M
3300006176|Ga0070765_100316854All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300006354|Ga0075021_10014111All Organisms → cellular organisms → Bacteria4391Open in IMG/M
3300006893|Ga0073928_10019852All Organisms → cellular organisms → Bacteria6965Open in IMG/M
3300007982|Ga0102924_1003646All Organisms → cellular organisms → Bacteria16048Open in IMG/M
3300009038|Ga0099829_11184563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300009088|Ga0099830_11774557Not Available515Open in IMG/M
3300009137|Ga0066709_100233201All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300009523|Ga0116221_1558780Not Available503Open in IMG/M
3300009524|Ga0116225_1011043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae4900Open in IMG/M
3300009623|Ga0116133_1009774All Organisms → cellular organisms → Bacteria2377Open in IMG/M
3300009627|Ga0116109_1037152Not Available891Open in IMG/M
3300009645|Ga0116106_1008105All Organisms → cellular organisms → Bacteria3998Open in IMG/M
3300010043|Ga0126380_11881915Not Available544Open in IMG/M
3300010343|Ga0074044_10027581Not Available4032Open in IMG/M
3300010343|Ga0074044_10216926All Organisms → cellular organisms → Bacteria → Acidobacteria1268Open in IMG/M
3300010343|Ga0074044_10375557Not Available932Open in IMG/M
3300010358|Ga0126370_12136787Not Available550Open in IMG/M
3300010376|Ga0126381_103647939Not Available603Open in IMG/M
3300010379|Ga0136449_100044034All Organisms → cellular organisms → Bacteria10253Open in IMG/M
3300010398|Ga0126383_12447037Not Available607Open in IMG/M
3300011269|Ga0137392_10930062All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300011271|Ga0137393_10708918All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300012210|Ga0137378_10838562All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300012354|Ga0137366_10922143All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300012363|Ga0137390_10218241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1894Open in IMG/M
3300012517|Ga0157354_1084685Not Available520Open in IMG/M
3300012923|Ga0137359_11376595Not Available594Open in IMG/M
3300014150|Ga0134081_10337294Not Available550Open in IMG/M
3300014167|Ga0181528_10057813All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300014489|Ga0182018_10001891All Organisms → cellular organisms → Bacteria22456Open in IMG/M
3300014838|Ga0182030_10276138All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300014838|Ga0182030_11370503Not Available592Open in IMG/M
3300017925|Ga0187856_1048704All Organisms → cellular organisms → Bacteria → Acidobacteria1872Open in IMG/M
3300017925|Ga0187856_1168356All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300017935|Ga0187848_10412300Not Available556Open in IMG/M
3300017946|Ga0187879_10261486All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300017970|Ga0187783_10341587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300018008|Ga0187888_1350555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300018014|Ga0187860_1250512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4703Open in IMG/M
3300018015|Ga0187866_1316844Not Available544Open in IMG/M
3300018033|Ga0187867_10557012Not Available629Open in IMG/M
3300018034|Ga0187863_10858955Not Available515Open in IMG/M
3300018043|Ga0187887_10427902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300018057|Ga0187858_10275881Not Available1071Open in IMG/M
3300018086|Ga0187769_10110390All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300019787|Ga0182031_1086399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1567Open in IMG/M
3300019881|Ga0193707_1166353Not Available599Open in IMG/M
3300020061|Ga0193716_1057577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1789Open in IMG/M
3300020583|Ga0210401_11526511Not Available525Open in IMG/M
3300021088|Ga0210404_10150419All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.1219Open in IMG/M
3300021088|Ga0210404_10429945All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300021168|Ga0210406_10804872All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300021170|Ga0210400_11170149Not Available620Open in IMG/M
3300021407|Ga0210383_11205453Not Available636Open in IMG/M
3300021432|Ga0210384_10350931Not Available1328Open in IMG/M
3300021433|Ga0210391_10599282Not Available865Open in IMG/M
3300021478|Ga0210402_10251579All Organisms → cellular organisms → Bacteria → Acidobacteria1631Open in IMG/M
3300021478|Ga0210402_10474085Not Available1162Open in IMG/M
3300021861|Ga0213853_10461955Not Available567Open in IMG/M
3300022557|Ga0212123_10070925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium3005Open in IMG/M
3300023101|Ga0224557_1088593All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300023101|Ga0224557_1164181All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300025134|Ga0207416_1017187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3976Open in IMG/M
3300025414|Ga0208935_1044495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300025917|Ga0207660_10190219All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300026116|Ga0207674_12140620Not Available523Open in IMG/M
3300026294|Ga0209839_10057373All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300026548|Ga0209161_10377026All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300027625|Ga0208044_1177783Not Available578Open in IMG/M
3300027684|Ga0209626_1193610Not Available539Open in IMG/M
3300027698|Ga0209446_1008087All Organisms → cellular organisms → Bacteria2577Open in IMG/M
3300027701|Ga0209447_10073755All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300027729|Ga0209248_10173213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7641Open in IMG/M
3300027853|Ga0209274_10424464Not Available687Open in IMG/M
3300027879|Ga0209169_10001147All Organisms → cellular organisms → Bacteria16070Open in IMG/M
3300027905|Ga0209415_10101960Not Available3143Open in IMG/M
3300027908|Ga0209006_10003421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium14429Open in IMG/M
3300028047|Ga0209526_10771166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300028806|Ga0302221_10025031All Organisms → cellular organisms → Bacteria2885Open in IMG/M
3300028863|Ga0302218_10003700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea5040Open in IMG/M
3300029889|Ga0246001_1007428All Organisms → cellular organisms → Bacteria4198Open in IMG/M
3300029985|Ga0302280_1026617All Organisms → cellular organisms → Bacteria2693Open in IMG/M
3300029999|Ga0311339_11888824Not Available515Open in IMG/M
3300030041|Ga0302274_10005815All Organisms → cellular organisms → Bacteria10351Open in IMG/M
3300030053|Ga0302177_10015167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea5013Open in IMG/M
3300030057|Ga0302176_10022206All Organisms → cellular organisms → Bacteria2400Open in IMG/M
3300030494|Ga0310037_10185596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae929Open in IMG/M
3300030707|Ga0310038_10067631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1953Open in IMG/M
3300030743|Ga0265461_12312282Not Available627Open in IMG/M
3300030760|Ga0265762_1003802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea2700Open in IMG/M
3300030763|Ga0265763_1048897Not Available528Open in IMG/M
3300031234|Ga0302325_10433442All Organisms → cellular organisms → Archaea → TACK group2027Open in IMG/M
3300031234|Ga0302325_12036372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300031236|Ga0302324_101083177All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300031236|Ga0302324_101595427All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300031236|Ga0302324_102652630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300031524|Ga0302320_10831122All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300031708|Ga0310686_106167954All Organisms → cellular organisms → Bacteria3527Open in IMG/M
3300031708|Ga0310686_109404009All Organisms → cellular organisms → Bacteria → Acidobacteria1669Open in IMG/M
3300031708|Ga0310686_111929436All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300031708|Ga0310686_115166204Not Available695Open in IMG/M
3300031740|Ga0307468_101057226All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300031823|Ga0307478_10752893Not Available816Open in IMG/M
3300031962|Ga0307479_11297335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300032160|Ga0311301_10058237All Organisms → cellular organisms → Bacteria8542Open in IMG/M
3300032160|Ga0311301_10101292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5630Open in IMG/M
3300032160|Ga0311301_10419595All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300032180|Ga0307471_100068231All Organisms → cellular organisms → Bacteria → Proteobacteria3051Open in IMG/M
3300032782|Ga0335082_11721640Not Available501Open in IMG/M
3300032892|Ga0335081_10677121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1256Open in IMG/M
3300032955|Ga0335076_10019563All Organisms → cellular organisms → Bacteria6795Open in IMG/M
3300032955|Ga0335076_11798958Not Available502Open in IMG/M
3300033405|Ga0326727_11065625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.25%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.25%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.25%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.44%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.44%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.63%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.81%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.81%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1024298623300000567Peatlands SoilMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCS*
JGI12659J15293_1001107953300001546Forest SoilKLEEVNQRTKEAVDFLMAALESGHSAVLTQYLAATAKFRNYSFLCVQ*
Ga0066678_1004686123300005181SoilMKLEEVNKRTKEAVDFLVAELESGHSEVLTAYLGAMAKFHTY
Ga0070713_10060042533300005436Corn, Switchgrass And Miscanthus RhizosphereMKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAMAKFHT
Ga0070713_10236539313300005436Corn, Switchgrass And Miscanthus RhizosphereMKLDEIKNKTKEAVDYLVEALESGRSDVLTQYLGAMARFHT
Ga0070731_1045286413300005538Surface SoilMKLEEIKNKTKEATDYLVQSLEGGHSEVLTQYLGA
Ga0070763_1005767213300005610SoilMKLEEVNKRTKEAVDFLVAALESGHSEVLTAYLGAMAKF
Ga0068856_10227357423300005614Corn RhizosphereMKLEELKNKTKDAVDYLVQSLESGHSEVLTQYLGAM
Ga0080027_1029917223300005993Prmafrost SoilMKLEEINNKTNEAFSFLVAALESGESEVLTQYLNA
Ga0075030_10000126213300006162WatershedsMKLEDIKNKTKDAVDYLVQSLESGHSEVLTQYLGAMARFHT
Ga0070765_10031685433300006176SoilEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY*
Ga0075021_1001411153300006354WatershedsMKLEEVTLKAKEAVDYLVQSLESGQSAVLTQYLGAMAKFR
Ga0073928_1001985213300006893Iron-Sulfur Acid SpringMKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCY*
Ga0102924_1003646113300007982Iron-Sulfur Acid SpringMEGKNMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAM
Ga0099829_1118456313300009038Vadose Zone SoilMKLEEVNQKTKEAVDFLVAALESGHSEVLTAYLGAMAKFR
Ga0099830_1177455713300009088Vadose Zone SoilMKLEEIKNRTKDAVEHLIQALEAGRSEALTEYLAV
Ga0066709_10023320113300009137Grasslands SoilMKLEELKNKTKDAVNYLVQSLESGHSEVLTQYLGAMARFHTY
Ga0116221_155878013300009523Peatlands SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFH
Ga0116225_101104313300009524Peatlands SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLATYIGAMAKFHTYSFLCVQ*
Ga0116133_100977413300009623PeatlandVDFLVAALESGHSEVLTAYLGAMAKFHSYSFLCVQ*
Ga0116109_103715213300009627PeatlandMKLDDVNLKTKEALDYLVLSLDSGHSHVLTQYLGAMAKFRNYSF
Ga0116106_100810563300009645PeatlandMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYRCLCY*
Ga0126380_1188191513300010043Tropical Forest SoilMKLEDIKSKTKDAVDYLVHSLESGHSEVLTQYLGTM
Ga0074044_1002758113300010343Bog Forest SoilMKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAM
Ga0074044_1021692613300010343Bog Forest SoilTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY*
Ga0074044_1037555713300010343Bog Forest SoilMKLDEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAK
Ga0126370_1213678713300010358Tropical Forest SoilMKLEEVNQRTIEAVDFLVAALESGHSEVLTAYLGAMAKF
Ga0126381_10364793923300010376Tropical Forest SoilMKVVDIKSKTKDAVDYLVQSLESGHSEVLTQYLGA
Ga0136449_10004403483300010379Peatlands SoilMKVEEIKQLTTKALDELVSALESGHSETLTAYLEAMAKF*
Ga0126383_1244703713300010398Tropical Forest SoilMKLEEVNQRTKEAVDFLVAALESGHSEVLTTYLTAMAK
Ga0137392_1093006213300011269Vadose Zone SoilKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCC*
Ga0137393_1070891813300011271Vadose Zone SoilMKLEEVNLKTKEAVNYLVQPLGGGQSSVLTQYLGAMAK
Ga0137378_1083856213300012210Vadose Zone SoilEAFSFLVAALESGESEVLTQYLNAMARFHTYSFLC*
Ga0137366_1092214313300012354Vadose Zone SoilMKLEEIKNKTQEATDYLVQSLEAGHSEVLTEYLGAMAK
Ga0137390_1021824113300012363Vadose Zone SoilMKLEEIKDKTQEATNYLVHSLEAGHSKVLTQYLGPMAKFHTYSRHARRPREF*
Ga0157354_108468513300012517Unplanted SoilMKQEEINRRTKEAVDYLVESLESGRSEVLVQYLAAMGR
Ga0137359_1137659513300012923Vadose Zone SoilMKLEEVNQKTKEAVDFLVAALESGQSEVLTAYLGAMAKFRNY
Ga0134081_1033729413300014150Grasslands SoilMKLEDIKTKTKDAVDYLVQSLESGHSEVLTQYLGTMARFRTYSFG
Ga0181528_1005781323300014167BogMEGKTMKLEEVNKRTKDAVDFLVAALESGHSEVLTAYLGAMAKFH
Ga0182018_10001891173300014489PalsaMKLEEVNTRTKEAVDFLVAALESGHSEVLTTYLGAMA
Ga0182030_1027613823300014838BogMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAM
Ga0182030_1137050313300014838BogMKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLGAMAKFH
Ga0187856_104870423300017925PeatlandMRLQEVNLKTKEAVDYLVQSLESGHSEVLTQYLGAMAKFRNYSFLCC
Ga0187856_116835613300017925PeatlandMKLEEVNLKTKEAVNYLVQSLEAGQSAVLTQYLGAMAK
Ga0187848_1041230013300017935PeatlandMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAM
Ga0187879_1026148633300017946PeatlandLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMSKFHTYSFLCY
Ga0187783_1034158713300017970Tropical PeatlandMKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAM
Ga0187888_135055523300018008PeatlandMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAM
Ga0187860_125051213300018014PeatlandKGKNMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYPGAMAKFRNYSFLCVQ
Ga0187866_131684413300018015PeatlandMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMA
Ga0187867_1055701213300018033PeatlandMKLEEVNQRTKEAVDFLVAALESGHSEILTAYLGAMAKL
Ga0187863_1085895513300018034PeatlandRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY
Ga0187887_1042790223300018043PeatlandMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCY
Ga0187858_1027588113300018057PeatlandMRLEEVNLKTKEAVNYLVQSLEAGQSAVLTQYLGAMAKFRN
Ga0187769_1011039013300018086Tropical PeatlandMKLEDIQNRTKDAVDYLVQSLESGHSEVLAQYLGAMAR
Ga0182031_108639913300019787BogMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNY
Ga0193707_116635313300019881SoilMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCY
Ga0193716_105757723300020061SoilMKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ
Ga0210401_1152651123300020583SoilMKLEEVNQRTKEAVHFLVAALESGQSAVLTQYLSAIAK
Ga0210404_1015041923300021088SoilMKLEDIKNKTKDAVDYLVQSLESGQSDVLSKYLGAMARFH
Ga0210404_1042994523300021088SoilMKLEEVNQRTKEAVDFLVAALESGHSAVLTQYLAAMAKFRNYSFW
Ga0210406_1080487223300021168SoilLKTKEAVDYLVQSLESGQSAVLAQYLGAMAKFRNYSFLCY
Ga0210400_1117014913300021170SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAK
Ga0210383_1120545323300021407SoilMKLEEVNKRTKDAVDFLAAALESGHSEALTAYLGAMAKCRNYSFLCVQ
Ga0210384_1035093113300021432SoilMKLEEVNTRTKEAVDFLVAALESGNSEVLTAYLGAMAK
Ga0210391_1059928213300021433SoilMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGA
Ga0210402_1025157933300021478SoilMKLEEVNLKTKEAVNYLVQSLEAGQSTLLTQYLGAMAKFRNYSFLCS
Ga0210402_1047408523300021478SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGA
Ga0213853_1046195513300021861WatershedsMKLDEINRRTKEAVAYLVESLESGRSEVLVQYLAA
Ga0212123_1007092513300022557Iron-Sulfur Acid SpringMKLEEVNTRTKEAVDFLVAALESGHSEVLTTYLGAM
Ga0224557_108859313300023101SoilMKLEEIKNRTKDAVDYLVQALESGRSEVLTQYLGTMARFHTY
Ga0224557_116418113300023101SoilMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLAAMAKFR
Ga0207416_101718763300025134Iron-Sulfur Acid SpringMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTY
Ga0208935_104449513300025414PeatlandMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKF
Ga0207660_1019021963300025917Corn RhizosphereMKLEEVNKRTKEAIDFLIAALESGHSEVYTAYLRAMAKF
Ga0207674_1214062013300026116Corn RhizosphereMKLEEVNQKTKEAVDFLVAALESGHSEVLTQYLAV
Ga0209839_1005737323300026294SoilMKLEEVNTRTKVAVDFLVVALESGHSEVLTAYLGAMAKFHTYSFLCY
Ga0209161_1037702613300026548SoilMKLEDIKNKTKDAVDYLVQSLESGHSEVLTQYLGTMA
Ga0208044_117778313300027625Peatlands SoilMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCS
Ga0209626_119361023300027684Forest SoilMKSEEVNQRTKEAVDFLVAALESGQSAVLTEYLAAMAKFRNYSF
Ga0209446_100808743300027698Bog Forest SoilMKLEEINNRTKDAVSYLVEALESGQSAVLTQYLSAMGRFHNYTSRIG
Ga0209447_1007375533300027701Bog Forest SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKF
Ga0209248_1017321313300027729Bog Forest SoilMKLEEVNNKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSF
Ga0209274_1042446423300027853SoilMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKVHTYSVQCC
Ga0209169_10001147213300027879SoilEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY
Ga0209415_1010196023300027905Peatlands SoilMKVEEIKQLTTKALDELVSALESGHSETLTAYLEAMAKF
Ga0209006_1000342123300027908Forest SoilMKLEEINLKTKEAVDFLVQSLESGQSVVLTQYLGAMAKFRNYSFLCC
Ga0209526_1077116613300028047Forest SoilMKLEEIKNKTKEATDYLVQSLEAGHSEVLTQYLGAMAKFHT
Ga0302221_1002503143300028806PalsaMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLAAMAKFRNYSFLCVQ
Ga0302218_1000370013300028863PalsaMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ
Ga0246001_100742863300029889PeatMKLEEVNKRTKEAVDFLVAALESGHSEVLTAYLGAMAK
Ga0302280_102661723300029985FenMKLDEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFR
Ga0311339_1188882413300029999PalsaMKLEEVNTRTKEAVDFLVVALESGHSEVLTTYLGAMAK
Ga0302274_1000581513300030041BogMKLDEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKF
Ga0302177_1001516773300030053PalsaVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCVQ
Ga0302176_1002220613300030057PalsaRQKGKNMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ
Ga0310037_1018559623300030494Peatlands SoilMKLEEVNLKTKEAVDYLVQSLESGQSAVLAQYLGAMAKFRN
Ga0310038_1006763123300030707Peatlands SoilMKLEEVNTRTKEAVDFLVAELGSGHSEVLTAYLGAM
Ga0265461_1231228223300030743SoilMKLEEVNQRTKEAVGFLVAAVESGHSEVLTAYLGAMAKFHTYSFLCY
Ga0265762_100380213300030760SoilMKLEEVNQRTKEAVDFLMAALESGHSAVLTQYLAATAKFRNYSFLCVQ
Ga0265763_104889723300030763SoilMKIEEVNTRTKEAVDFLVAALESGRSEVLTAYLGAMAK
Ga0302325_1043344213300031234PalsaMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGA
Ga0302325_1203637213300031234PalsaMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFG
Ga0302324_10108317713300031236PalsaMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCVQ
Ga0302324_10159542723300031236PalsaMKLEEVNLKTKEAVDYLVQSLESGHSAVLTQYLGAM
Ga0302324_10265263013300031236PalsaMKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGA
Ga0302320_1083112223300031524BogMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMA
Ga0310686_10616795423300031708SoilMKLEELNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYMSTG
Ga0310686_10940400913300031708SoilEAVDFLVQSLESGQSAILTQYLGAMAKFRNYSFLCY
Ga0310686_11192943613300031708SoilEVNHKTKEAVDYLVQSLESGQSEVLTQYLGAMAKFSNYSFLCC
Ga0310686_11516620413300031708SoilMKLEEVNKRTKEAVDFLVAALESGHSEVLTEYLGAMAKFRNYSFLC
Ga0307468_10105722613300031740Hardwood Forest SoilMKLEDIKSKTKDAVDYLVQSLESGHSEVLTEYLGTMPDFMPIRSAMSC
Ga0307478_1075289313300031823Hardwood Forest SoilMKLEEIKNRTKDAVDHLVQSLESGHSEVLRQYLGIMAR
Ga0307479_1129733513300031962Hardwood Forest SoilMKLEEVNTRTKEAVDFLVAALESANSEVLTAYLGAMAKFHT
Ga0311301_1005823753300032160Peatlands SoilMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAK
Ga0311301_1010129263300032160Peatlands SoilMKLEEVNHKTKEAVDHLVQSLESGQSEVLTQYLGAM
Ga0311301_1041959533300032160Peatlands SoilMKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFR
Ga0307471_10006823173300032180Hardwood Forest SoilMKLDEVNRRTKEAVAYLVLALESGRSEVLVHYLAV
Ga0335082_1172164013300032782SoilMKLEDIKSRTKDAVDHLVQSLESGHSGVLTEYLGAMARFHT
Ga0335081_1067712113300032892SoilMKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAMAK
Ga0335076_1001956353300032955SoilMKLEEVNQRTKEAVDFLVAALESGRSEVLTAYLSA
Ga0335076_1179895813300032955SoilMKLEDIKSKTKDAVDYLVQSLESGHSEVLTEYLGAMARFHTY
Ga0326727_1106562513300033405Peat SoilMKLEEVNLKTKEAVNYLVQSLEAGQSMVLTQYLGAMAKFRNYSFLCC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.