Metagenome / Metatranscriptome Family F070286

Overview

Basic Information

• Family ID: F070286
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 123
• Average Sequence Length: 39 residues
• Representative Sequence: MKTIVSALIALSVLAGVAGPANALDAKKFWDEHPTGGER
• Number of Associated Samples: 81
• Number of Associated Scaffolds: 123

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 85.95 %
• % of genes near scaffold ends (potentially truncated): 16.26 %
• % of genes from short scaffolds (< 2000 bps): 78.05 %
• Associated GOLD sequencing projects: 75
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (65.041 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (36.585 % of family members)
• Environment Ontology (ENVO): Unclassified (32.520 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (49.593 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 44.78%
  β-sheet: 0.00%
  Coil/Unstructured: 55.22%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF12893	Lumazine_bd_2	11.38
PF03328	HpcH_HpaI	7.32
PF01656	CbiA	2.44
PF05016	ParE_toxin	1.63
PF00296	Bac_luciferase	1.63
PF01474	DAHP_synth_2	1.63
PF02515	CoA_transf_3	1.63
PF03372	Exo_endo_phos	0.81
PF03734	YkuD	0.81
PF05988	DUF899	0.81
PF13560	HTH_31	0.81
PF07087	DUF1353	0.81
PF05958	tRNA_U5-meth_tr	0.81
PF00753	Lactamase_B	0.81
PF14537	Cytochrom_c3_2	0.81
PF02617	ClpS	0.81
PF13419	HAD_2	0.81
PF14235	DUF4337	0.81
PF06078	DUF937	0.81
PF07992	Pyr_redox_2	0.81
PF13748	ABC_membrane_3	0.81
PF00892	EamA	0.81
PF05683	Fumerase_C	0.81
PF13561	adh_short_C2	0.81
PF00120	Gln-synt_C	0.81
PF13727	CoA_binding_3	0.81
PF00072	Response_reg	0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 123 Family Scaffolds
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	7.32
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	7.32
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	7.32
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	1.63
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.63
COG3200	3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II	Amino acid transport and metabolism [E]	1.63
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.81
COG1838	Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain	Energy production and conversion [C]	0.81
COG2127	ATP-dependent Clp protease adapter protein ClpS	Posttranslational modification, protein turnover, chaperones [O]	0.81
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.81
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.81
COG3753	Uncharacterized conserved protein YidB, DUF937 family	Function unknown [S]	0.81
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.81

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
All Organisms	root	All Organisms	34.96 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
cellular organisms	root	All Organisms → cellular organisms	34.96 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	34.96 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	32.52 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.81 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.81 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	25.20 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.44 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.81 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.81 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14.63 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.44 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.81 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.81 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	2.44 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	2.44 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.81 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.44 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	2.44 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.81 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.81 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.81 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	2.44 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.44 %
Mesorhizobium onobrychidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis	0.81 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	0.81 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Citreicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus	2.44 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.44 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.81 %
Mesorhizobium onobrychidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis	0.81 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.04 %
Citreicoccus inhibens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens	2.44 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.44 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.81 %
Mesorhizobium onobrychidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis	0.81 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.81 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459005|F1BAP7Q02FUWJT	Not Available	532
3300000033|ICChiseqgaiiDRAFT_c0333003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	753
3300000574|JGI1357J11328_10155803	Not Available	643
3300000956|JGI10216J12902_102727915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3066
3300000956|JGI10216J12902_107155601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1908
3300004114|Ga0062593_101227987	Not Available	789
3300004114|Ga0062593_101574969	Not Available	712
3300004463|Ga0063356_104661558	Not Available	589
3300004643|Ga0062591_100418865	Not Available	1115
3300004798|Ga0058859_11713494	Not Available	578
3300005330|Ga0070690_100202474	Not Available	1382
3300005340|Ga0070689_100962405	Not Available	758
3300005441|Ga0070700_100749678	Not Available	781
3300005544|Ga0070686_100922924	Not Available	712
3300005713|Ga0066905_100351482	Not Available	1178
3300005713|Ga0066905_100535224	Not Available	980
3300005713|Ga0066905_101530641	Not Available	608
3300006196|Ga0075422_10108985	All Organisms → cellular organisms → Bacteria → Proteobacteria	1071
3300006580|Ga0074049_12494461	All Organisms → cellular organisms → Bacteria → Proteobacteria	579
3300006844|Ga0075428_100074854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3698
3300006844|Ga0075428_100156158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2478
3300006844|Ga0075428_100184539	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	2257
3300006844|Ga0075428_100427678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1419
3300006844|Ga0075428_100447673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis	1383
3300006844|Ga0075428_100806868	Not Available	997
3300006844|Ga0075428_101054068	Not Available	860
3300006844|Ga0075428_101347656	Not Available	750
3300006845|Ga0075421_100115328	All Organisms → cellular organisms → Bacteria	3375
3300006845|Ga0075421_101229874	Not Available	833
3300006845|Ga0075421_101326716	Not Available	795
3300006846|Ga0075430_100005868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	10366
3300006852|Ga0075433_10961982	All Organisms → cellular organisms → Bacteria → Proteobacteria	744
3300006852|Ga0075433_11447820	Not Available	594
3300006852|Ga0075433_11614146	Not Available	559
3300006852|Ga0075433_11714960	Not Available	541
3300006865|Ga0073934_10000713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	90956
3300006904|Ga0075424_100724001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1062
3300006953|Ga0074063_13465084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	948
3300009094|Ga0111539_10002384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	24949
3300009094|Ga0111539_10101719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3374
3300009094|Ga0111539_11644910	Not Available	745
3300009094|Ga0111539_12250441	Not Available	632
3300009098|Ga0105245_10734376	Not Available	1022
3300009100|Ga0075418_10098766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3101
3300009100|Ga0075418_10230289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	1972
3300009100|Ga0075418_10769897	Not Available	1039
3300009100|Ga0075418_11611051	Not Available	705
3300009100|Ga0075418_12036937	Not Available	625
3300009137|Ga0066709_100145303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3020
3300009146|Ga0105091_10441505	Not Available	653
3300009147|Ga0114129_11876198	All Organisms → cellular organisms → Bacteria → Proteobacteria	727
3300009147|Ga0114129_12831004	Not Available	576
3300009156|Ga0111538_12019962	Not Available	725
3300009156|Ga0111538_12441182	Not Available	656
3300009162|Ga0075423_10453886	Not Available	1347
3300009162|Ga0075423_12671828	Not Available	546
3300009553|Ga0105249_12424728	Not Available	597
3300009678|Ga0105252_10442959	Not Available	597
3300009814|Ga0105082_1023351	Not Available	950
3300010047|Ga0126382_12290653	Not Available	522
3300010166|Ga0126306_11523251	Not Available	555
3300010397|Ga0134124_13217971	Not Available	500
3300010398|Ga0126383_12526455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598
3300010857|Ga0126354_1139763	Not Available	521
3300010862|Ga0126348_1189558	Not Available	546
3300011415|Ga0137325_1062820	Not Available	805
3300011422|Ga0137425_1166762	Not Available	549
3300012668|Ga0157216_10484721	Not Available	534
3300012897|Ga0157285_10191801	Not Available	636
3300012912|Ga0157306_10167345	Not Available	710
3300012958|Ga0164299_11170011	Not Available	580
3300013096|Ga0157307_1131444	Not Available	564
3300015077|Ga0173483_10164816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	991
3300015077|Ga0173483_10517537	Not Available	640
3300015371|Ga0132258_10101702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6773
3300017792|Ga0163161_11074082	Not Available	691
3300017936|Ga0187821_10090749	All Organisms → cellular organisms → Bacteria → Proteobacteria	1120
3300017997|Ga0184610_1188609	Not Available	686
3300018053|Ga0184626_10083163	Not Available	1353
3300018054|Ga0184621_10161134	Not Available	808
3300018054|Ga0184621_10243560	Not Available	642
3300018072|Ga0184635_10372241	Not Available	545
3300018081|Ga0184625_10134437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1289
3300018083|Ga0184628_10041482	Not Available	2311
3300018469|Ga0190270_10703753	All Organisms → cellular organisms → Bacteria → Proteobacteria	1003
3300018469|Ga0190270_10866336	Not Available	917
3300018469|Ga0190270_11509182	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens	721
3300019233|Ga0184645_1347777	Not Available	516
3300019269|Ga0184644_1303580	Not Available	512
3300019279|Ga0184642_1151548	Not Available	682
3300019377|Ga0190264_10984583	Not Available	671
3300020020|Ga0193738_1021685	Not Available	2020
3300020020|Ga0193738_1060425	Not Available	1131
3300020020|Ga0193738_1154675	Not Available	610
3300021082|Ga0210380_10017551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3020
3300021082|Ga0210380_10103480	Not Available	1260
3300022530|Ga0242658_1209505	Not Available	534
3300025310|Ga0209172_10000133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	222640
3300025917|Ga0207660_11055698	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens	662
3300025918|Ga0207662_10206257	Not Available	1274
3300027056|Ga0209879_1036257	Not Available	814
3300027815|Ga0209726_10034028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3880
3300027873|Ga0209814_10218793	Not Available	824
3300027880|Ga0209481_10002898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7126
3300027880|Ga0209481_10116569	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1300
3300027907|Ga0207428_10021134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5513
3300027907|Ga0207428_10040797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3760
3300027907|Ga0207428_10128017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1944
3300027907|Ga0207428_10177431	Not Available	1611
3300027909|Ga0209382_10021359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7858
3300027909|Ga0209382_10077562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3920
3300027909|Ga0209382_10205659	Not Available	2254
3300027909|Ga0209382_10589439	Not Available	1212
3300027957|Ga0209857_1050765	Not Available	731
3300030570|Ga0247647_1205336	Not Available	564
3300030592|Ga0247612_1096542	Not Available	672
3300030990|Ga0308178_1172472	Not Available	510
3300031576|Ga0247727_10002852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	38987
3300031576|Ga0247727_10004790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28244
3300031949|Ga0214473_11802867	Not Available	605
3300034643|Ga0370545_159861	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens	523

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	58.54%
Host-Associated	Host-Associated	41.46%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	41.46%
Plants	Host-Associated → Plants	40.65%
Aquatic	Environmental → Aquatic	17.07%
Human	Host-Associated → Human	0.81%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	39.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere	38.21%
Sediment	Environmental → Aquatic → Sediment	8.13%
Freshwater	Environmental → Aquatic → Freshwater	7.32%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.44%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.63%
Cave	Environmental → Terrestrial → Cave	1.63%
Digestive System	Host-Associated → Human → Digestive System	0.81%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	38.21%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	8.13%
Loam	Environmental → Terrestrial → Soil → Loam	7.32%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.88%
Sand	Environmental → Terrestrial → Soil → Sand	2.44%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.63%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.63%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.63%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.63%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.81%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.81%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	38.21%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.51%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	8.13%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.88%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.06%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.25%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.44%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.44%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.44%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	1.63%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.63%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.63%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.81%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.81%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.81%

Habitat

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	36.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.20%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.69%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	4.06%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.25%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.44%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.44%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.44%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	1.63%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.63%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.63%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	1.63%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	1.63%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.81%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.81%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.81%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.81%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.81%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.81%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.81%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.81%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated
3300006580	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental
3300009814	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010857	Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300010862	Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300013096	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2	Environmental
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300019233	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)	Environmental
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental
3300019279	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300027056	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)	Environmental
3300027815	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)	Environmental
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027957	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)	Environmental
3300030570	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)	Environmental
3300030592	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)	Environmental
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_00938410	2170459005	Grass Soil	MKTILSALLALSVLAGIVAPASAFDAQKFWDEHPTGSQR
ICChiseqgaiiDRAFT_03330031	3300000033	Soil	MKILLSALLALSVLAGVAGSANALDPKTFWEENDRQTQ*
JGI1357J11328_101558032	3300000574	Groundwater	MKTIVSALVALSVLAGIAAAPASAFDAKRFWDEHPTGSQR*
JGI10216J12902_1027279153	3300000956	Soil	MKTLVSALVALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP*
JGI10216J12902_1071556012	3300000956	Soil	MKAIVSALLALSVLAGVAGSANALDAKKFWDEHQTSGER*
Ga0062593_1012279871	3300004114	Soil	MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER*
Ga0062593_1015749691	3300004114	Soil	MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH*
Ga0063356_1046615581	3300004463	Arabidopsis Thaliana Rhizosphere	MKTLVSALLALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP*
Ga0062591_1004188651	3300004643	Soil	MKTIVSVLVVLSVLAGVAGSANALDAKKFWDEHPTGGER*
Ga0058859_117134942	3300004798	Host-Associated	TAMKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER*
Ga0070690_1002024743	3300005330	Switchgrass Rhizosphere	MKTIVGVLVALSVLAGVAGSSNALDAKKFWDEHPTGGER*
Ga0070689_1009624051	3300005340	Switchgrass Rhizosphere	MKTIVGVLVALSVLASVAGSASALDVKKFWDEHPTGGER*
Ga0070700_1007496782	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MKTIVSALIALSVLVGVADPANALDAKRFWDEHPTSGER*
Ga0070686_1009229241	3300005544	Switchgrass Rhizosphere	MKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER*
Ga0066905_1003514821	3300005713	Tropical Forest Soil	MKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER*
Ga0066905_1005352242	3300005713	Tropical Forest Soil	MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSAQR*
Ga0066905_1015306412	3300005713	Tropical Forest Soil	MKTLVSALIALTVLAGVVASANALDAKRFWDEHPTSGER*
Ga0075422_101089852	3300006196	Populus Rhizosphere	MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGSER*
Ga0074049_124944611	3300006580	Soil	MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGGER*
Ga0075428_1000748547	3300006844	Populus Rhizosphere	MKTIVSALIALSVLAGVAGWANALDVKKFWDEHPTSGER*
Ga0075428_1001561581	3300006844	Populus Rhizosphere	MKTIVSALIALSVLAGAAGSANALDVKKFWDEHPTSGER*
Ga0075428_1001845395	3300006844	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER*
Ga0075428_1004276782	3300006844	Populus Rhizosphere	MKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH*
Ga0075428_1004476732	3300006844	Populus Rhizosphere	MKTIVSALIALSVLVGVVGPANALDAKKFWDEHPTSGER*
Ga0075428_1008068682	3300006844	Populus Rhizosphere	MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR*
Ga0075428_1010540684	3300006844	Populus Rhizosphere	AMKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER*
Ga0075428_1013476561	3300006844	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGEH*
Ga0075421_1001153285	3300006845	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDVKKFWDEHPTSGER*
Ga0075421_1012298742	3300006845	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGER*
Ga0075421_1013267161	3300006845	Populus Rhizosphere	MKTIVFALIALSVLAGVAGSANALDVRKFWDEHPTSGER*
Ga0075430_1000058687	3300006846	Populus Rhizosphere	MKTIISALIALSVLAGVAGSANALDVRKFWDEHPTSGER*
Ga0075433_109619821	3300006852	Populus Rhizosphere	LSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR*
Ga0075433_114478202	3300006852	Populus Rhizosphere	MKALVSALIALAVVAGVAGPADALDAKMFWDEHPTSGQR*
Ga0075433_116141462	3300006852	Populus Rhizosphere	MKTIVSLLLALAVLTGVAGSANALDAKKFWDEHPTSGER*
Ga0075433_117149601	3300006852	Populus Rhizosphere	MKIIVSALIALSVLVGIAAPAGAVSDPKTFWDQQERSQY*
Ga0073934_1000071395	3300006865	Hot Spring Sediment	MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTSGQR*
Ga0075424_1007240011	3300006904	Populus Rhizosphere	MKIIVSALIALSVLVGIAAPAGAVSDPKTFWDQQERS
Ga0074063_134650842	3300006953	Soil	MKTLISALVALSVLAGIAAPASALDAKKFWDEHPTSSER*
Ga0111539_100023843	3300009094	Populus Rhizosphere	MKTIVSLLVALTVLAGIAGPVNALDAKRFWDEHPTSGER*
Ga0111539_101017195	3300009094	Populus Rhizosphere	MKALLSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR*
Ga0111539_116449102	3300009094	Populus Rhizosphere	MKTLVSILVALSVLAGVAGAANALDGKRFWDEHATSGER*
Ga0111539_122504412	3300009094	Populus Rhizosphere	MIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH*
Ga0105245_107343761	3300009098	Miscanthus Rhizosphere	MIMKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH*
Ga0075418_100987665	3300009100	Populus Rhizosphere	MKALVSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR*
Ga0075418_102302891	3300009100	Populus Rhizosphere	MIMKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR*
Ga0075418_107698973	3300009100	Populus Rhizosphere	DIAPTGGPAMKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER*
Ga0075418_116110511	3300009100	Populus Rhizosphere	MKTILSALIALAVLAGAAGSANALDAKRFWDEHPTSGER*
Ga0075418_120369372	3300009100	Populus Rhizosphere	MIMKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH*
Ga0066709_1001453035	3300009137	Grasslands Soil	MKTILSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR*
Ga0105091_104415051	3300009146	Freshwater Sediment	MKTIVGVLVALSVLAGVAGSAKALDAKKFWDEHPTGGER*
Ga0114129_118761981	3300009147	Populus Rhizosphere	MIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPTSSQR*
Ga0114129_128310042	3300009147	Populus Rhizosphere	MKIIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER*
Ga0111538_120199621	3300009156	Populus Rhizosphere	TIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER*
Ga0111538_124411822	3300009156	Populus Rhizosphere	MKTIVGVLVALSVLAGVAGSANALDVKKFWDEHPTGGER*
Ga0075423_104538862	3300009162	Populus Rhizosphere	MIMKTILSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR*
Ga0075423_119525482	3300009162	Populus Rhizosphere	MKTIVSALIALSVLPGMAAPASAALDPKKFWAEQGSPN*
Ga0075423_126718281	3300009162	Populus Rhizosphere	MKTLVCALVALSVLAGVAAPASAFDAKKFWDEHPSGSQH*
Ga0105249_124247281	3300009553	Switchgrass Rhizosphere	MKTIVSVLVALSVLAGVAGAANALDVKKFWDEHPTSGER*
Ga0105252_104429592	3300009678	Soil	WRTIMKSVISALVALSVLAGIAAPASAFDAKKFWDEHPTSGQP*
Ga0105082_10233511	3300009814	Groundwater Sand	MIMKTIVSTLVALSVLAGIPAPASAFDAKKFWDEHPTSSQR*
Ga0126382_122906532	3300010047	Tropical Forest Soil	MKTIVSALIALSVLAGIAAPASALDAKKFWDEHPTSSER*
Ga0126306_115232511	3300010166	Serpentine Soil	MKTLVSALIALAVVAGPANALDAKKFWDEHPTSGQR*
Ga0134124_132179711	3300010397	Terrestrial Soil	VSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH*
Ga0126383_125264551	3300010398	Tropical Forest Soil	MKAILSLLLALSVLTGVAGSASAFDAQKFWQEHPTSGER*
Ga0126354_11397632	3300010857	Boreal Forest Soil	MKTIVSALLALSVLGGIAAAPASAEQFDAKKFWQEHHSY*
Ga0126348_11895583	3300010862	Boreal Forest Soil	RIAMKTIVSALIAISVLAGVAAAPAAAFDAKTFWDQQSSSQGN*
Ga0137325_10628202	3300011415	Soil	MKTLISALVALSVLAGIAAPASAFDAKKFWDEHPSGSQR*
Ga0137425_11667622	3300011422	Soil	MKSVISALVALSVLAGIAAPASAFDAKKFWDVHPSGSQR*
Ga0157216_104847211	3300012668	Glacier Forefield Soil	ETKMEMIMKTIVSALLALSVLAGVAGSANALDAKKFWQEHSTSGER*
Ga0157285_101918011	3300012897	Soil	RAMKTIVSVLVVLSVLAGVAGSANALDAKKFWDEHPTGGER*
Ga0157306_101673451	3300012912	Soil	MKTIVSALIALSVLVGVGGPANALDAKRFWDEHPTSGER*
Ga0164299_111700111	3300012958	Soil	IMKTLVCALVALSVLAGVAAPASAFDAKKFWDEHPSGSQH*
Ga0157307_11314442	3300013096	Soil	MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPT
Ga0173483_101648161	3300015077	Soil	RMIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH*
Ga0173483_105175371	3300015077	Soil	MKTIVSVLVALSVLAGVAGSANALDAKKFWDEHPTGGER*
Ga0132258_101017026	3300015371	Arabidopsis Rhizosphere	MKTIVSVLVALSVLAGVAGSANALEAKVFWEQDKHQVY*
Ga0182032_109713771	3300016357	Soil	MKTIISAVLALSVLAGVASSASAFDADKFWKEHPTSGER
Ga0163161_110740822	3300017792	Switchgrass Rhizosphere	MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER
Ga0187821_100907492	3300017936	Freshwater Sediment	ISTLLALSVLAGIAAAPASAFDAKKFWDEHPTSSEH
Ga0184610_11886091	3300017997	Groundwater Sediment	MKTLVSALVALSVLAGIAAPASALDAKKFWEQYDRTHSIN
Ga0184626_100831631	3300018053	Groundwater Sediment	MKTLVSALVALSVFAGIAAPDSALDAKKFWEQHDRTHSIN
Ga0184621_101611341	3300018054	Groundwater Sediment	MKTIVGVLVALSVLAGVAGSANALDVKKFWDEHPTGGER
Ga0184621_102435602	3300018054	Groundwater Sediment	MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH
Ga0184635_103722412	3300018072	Groundwater Sediment	MKTIVSLLVALAVLAGVAGSANALDAKRFWDEHPTSGER
Ga0184625_101344372	3300018081	Groundwater Sediment	MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH
Ga0184628_100414825	3300018083	Groundwater Sediment	MKTIVSALIALSVLAGVAGPANALDAKKFWDEHPTGGER
Ga0190270_107037532	3300018469	Soil	MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTSSER
Ga0190270_108663364	3300018469	Soil	MKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER
Ga0190270_115091822	3300018469	Soil	MKTLVSALVALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP
Ga0184645_13477772	3300019233	Groundwater Sediment	MKTIVSALLALSVLAGIAAAPASAEQFDAKKFWQEHQSY
Ga0184644_13035802	3300019269	Groundwater Sediment	MKTFVSALLALSVLAGIAAAPASAEQFDAKKFWQEHQSY
Ga0184642_11515483	3300019279	Groundwater Sediment	MKTIVSALLALSVFAGIAAAPVSAADFDAKKFWEQHQSY
Ga0190264_109845831	3300019377	Soil	NAALIVMEMIMKTIVSALLALSVLAGVAGSANALDAKKFWQEHSTSGER
Ga0193738_10216852	3300020020	Soil	MKTILSALIALAVLVGAAGSAANALDAKRFWDEHPTSGER
Ga0193738_10604251	3300020020	Soil	MKTLVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR
Ga0193738_11546751	3300020020	Soil	MKTIVSALIALSVLAGVAGSANALDVKKFWEEHPTSGER
Ga0210380_100175514	3300021082	Groundwater Sediment	MKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH
Ga0210380_101034803	3300021082	Groundwater Sediment	MKTIVSVLVALSVLAGVAGSANALDAKKFWDEHPTGGER
Ga0242658_12095052	3300022530	Soil	MKTILSTLIALSVLAGVAAAPAAAFDAKKFWIEHDSIGG
Ga0209172_1000013394	3300025310	Hot Spring Sediment	MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTSGQR
Ga0207660_110556981	3300025917	Corn Rhizosphere	MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSEH
Ga0207662_102062571	3300025918	Switchgrass Rhizosphere	MKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER
Ga0209879_10362572	3300027056	Groundwater Sand	MKTIVSALIALSVLVGIAGPANALDAKKFWDEHPTSGER
Ga0209726_100340283	3300027815	Groundwater	MKTIVSALVALSVLAGIAAAPASAFDAKRFWDEHPTGSQR
Ga0209814_102187932	3300027873	Populus Rhizosphere	MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR
Ga0209481_100028982	3300027880	Populus Rhizosphere	MKTIVSALIALSVLVGVVGPANALDAKKFWDEHPTSGER
Ga0209481_101165693	3300027880	Populus Rhizosphere	VSALIALSVLAGVAGSANALDVRKFWDEHPTSGER
Ga0207428_100211343	3300027907	Populus Rhizosphere	MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGSER
Ga0207428_100407975	3300027907	Populus Rhizosphere	MKILLSALLALSVLAGVAGSANALDPKTFWEENDRQTQ
Ga0207428_101280172	3300027907	Populus Rhizosphere	MKALVSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR
Ga0207428_101774313	3300027907	Populus Rhizosphere	MKTIVSLLLALAVLTGVAGSANALDAKKFWDEHPTSGER
Ga0209382_1002135911	3300027909	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER
Ga0209382_100775625	3300027909	Populus Rhizosphere	MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGER
Ga0209382_102056592	3300027909	Populus Rhizosphere	MKTIVFALIALSVLAGVAGSANALDVRKFWDEHPTSGER
Ga0209382_105894391	3300027909	Populus Rhizosphere	MKTIVSALIALSVLAGVAGWANALDVKKFWDEHPTSGER
Ga0209857_10507652	3300027957	Groundwater Sand	MKIIVSALIALSVLAGVAGSANALDVKKFWDEHPTSGDR
Ga0247647_12053362	3300030570	Soil	MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSK
Ga0247612_10965423	3300030592	Soil	MKTILSALIALSVLAGVAGSANALDVKKFWDEHPTSGDR
Ga0308178_11724721	3300030990	Soil	ASPGVRAMKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER
Ga0247727_100028526	3300031576	Biofilm	MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTGSQR
Ga0247727_100047905	3300031576	Biofilm	MKTIVSALLALSMLAGVAGSANALDAKKFWEEHPTSGER
Ga0214473_118028672	3300031949	Soil	MKTIVSALVALSVLAGIAVAPASAFDAKKFWDEHPTGGQR
Ga0370545_159861_370_495	3300034643	Soil	MIMKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH