| Basic Information | |
|---|---|
| Family ID | F070286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKTIVSALIALSVLAGVAGPANALDAKKFWDEHPTGGER |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.95 % |
| % of genes near scaffold ends (potentially truncated) | 16.26 % |
| % of genes from short scaffolds (< 2000 bps) | 78.05 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.041 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (36.585 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.520 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF12893 | Lumazine_bd_2 | 11.38 |
| PF03328 | HpcH_HpaI | 7.32 |
| PF01656 | CbiA | 2.44 |
| PF05016 | ParE_toxin | 1.63 |
| PF00296 | Bac_luciferase | 1.63 |
| PF01474 | DAHP_synth_2 | 1.63 |
| PF02515 | CoA_transf_3 | 1.63 |
| PF03372 | Exo_endo_phos | 0.81 |
| PF03734 | YkuD | 0.81 |
| PF05988 | DUF899 | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF07087 | DUF1353 | 0.81 |
| PF05958 | tRNA_U5-meth_tr | 0.81 |
| PF00753 | Lactamase_B | 0.81 |
| PF14537 | Cytochrom_c3_2 | 0.81 |
| PF02617 | ClpS | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF14235 | DUF4337 | 0.81 |
| PF06078 | DUF937 | 0.81 |
| PF07992 | Pyr_redox_2 | 0.81 |
| PF13748 | ABC_membrane_3 | 0.81 |
| PF00892 | EamA | 0.81 |
| PF05683 | Fumerase_C | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00120 | Gln-synt_C | 0.81 |
| PF13727 | CoA_binding_3 | 0.81 |
| PF00072 | Response_reg | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 7.32 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 7.32 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 7.32 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.63 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.63 |
| COG3200 | 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II | Amino acid transport and metabolism [E] | 1.63 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.81 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.81 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.04 % |
| All Organisms | root | All Organisms | 34.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02FUWJT | Not Available | 532 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0333003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300000574|JGI1357J11328_10155803 | Not Available | 643 | Open in IMG/M |
| 3300000956|JGI10216J12902_102727915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3066 | Open in IMG/M |
| 3300000956|JGI10216J12902_107155601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1908 | Open in IMG/M |
| 3300004114|Ga0062593_101227987 | Not Available | 789 | Open in IMG/M |
| 3300004114|Ga0062593_101574969 | Not Available | 712 | Open in IMG/M |
| 3300004463|Ga0063356_104661558 | Not Available | 589 | Open in IMG/M |
| 3300004643|Ga0062591_100418865 | Not Available | 1115 | Open in IMG/M |
| 3300004798|Ga0058859_11713494 | Not Available | 578 | Open in IMG/M |
| 3300005330|Ga0070690_100202474 | Not Available | 1382 | Open in IMG/M |
| 3300005340|Ga0070689_100962405 | Not Available | 758 | Open in IMG/M |
| 3300005441|Ga0070700_100749678 | Not Available | 781 | Open in IMG/M |
| 3300005544|Ga0070686_100922924 | Not Available | 712 | Open in IMG/M |
| 3300005713|Ga0066905_100351482 | Not Available | 1178 | Open in IMG/M |
| 3300005713|Ga0066905_100535224 | Not Available | 980 | Open in IMG/M |
| 3300005713|Ga0066905_101530641 | Not Available | 608 | Open in IMG/M |
| 3300006196|Ga0075422_10108985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300006580|Ga0074049_12494461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300006844|Ga0075428_100074854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3698 | Open in IMG/M |
| 3300006844|Ga0075428_100156158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2478 | Open in IMG/M |
| 3300006844|Ga0075428_100184539 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2257 | Open in IMG/M |
| 3300006844|Ga0075428_100427678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
| 3300006844|Ga0075428_100447673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis | 1383 | Open in IMG/M |
| 3300006844|Ga0075428_100806868 | Not Available | 997 | Open in IMG/M |
| 3300006844|Ga0075428_101054068 | Not Available | 860 | Open in IMG/M |
| 3300006844|Ga0075428_101347656 | Not Available | 750 | Open in IMG/M |
| 3300006845|Ga0075421_100115328 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| 3300006845|Ga0075421_101229874 | Not Available | 833 | Open in IMG/M |
| 3300006845|Ga0075421_101326716 | Not Available | 795 | Open in IMG/M |
| 3300006846|Ga0075430_100005868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii | 10366 | Open in IMG/M |
| 3300006852|Ga0075433_10961982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300006852|Ga0075433_11447820 | Not Available | 594 | Open in IMG/M |
| 3300006852|Ga0075433_11614146 | Not Available | 559 | Open in IMG/M |
| 3300006852|Ga0075433_11714960 | Not Available | 541 | Open in IMG/M |
| 3300006865|Ga0073934_10000713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 90956 | Open in IMG/M |
| 3300006904|Ga0075424_100724001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300006953|Ga0074063_13465084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300009094|Ga0111539_10002384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 24949 | Open in IMG/M |
| 3300009094|Ga0111539_10101719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3374 | Open in IMG/M |
| 3300009094|Ga0111539_11644910 | Not Available | 745 | Open in IMG/M |
| 3300009094|Ga0111539_12250441 | Not Available | 632 | Open in IMG/M |
| 3300009098|Ga0105245_10734376 | Not Available | 1022 | Open in IMG/M |
| 3300009100|Ga0075418_10098766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3101 | Open in IMG/M |
| 3300009100|Ga0075418_10230289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 1972 | Open in IMG/M |
| 3300009100|Ga0075418_10769897 | Not Available | 1039 | Open in IMG/M |
| 3300009100|Ga0075418_11611051 | Not Available | 705 | Open in IMG/M |
| 3300009100|Ga0075418_12036937 | Not Available | 625 | Open in IMG/M |
| 3300009137|Ga0066709_100145303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3020 | Open in IMG/M |
| 3300009146|Ga0105091_10441505 | Not Available | 653 | Open in IMG/M |
| 3300009147|Ga0114129_11876198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300009147|Ga0114129_12831004 | Not Available | 576 | Open in IMG/M |
| 3300009156|Ga0111538_12019962 | Not Available | 725 | Open in IMG/M |
| 3300009156|Ga0111538_12441182 | Not Available | 656 | Open in IMG/M |
| 3300009162|Ga0075423_10453886 | Not Available | 1347 | Open in IMG/M |
| 3300009162|Ga0075423_12671828 | Not Available | 546 | Open in IMG/M |
| 3300009553|Ga0105249_12424728 | Not Available | 597 | Open in IMG/M |
| 3300009678|Ga0105252_10442959 | Not Available | 597 | Open in IMG/M |
| 3300009814|Ga0105082_1023351 | Not Available | 950 | Open in IMG/M |
| 3300010047|Ga0126382_12290653 | Not Available | 522 | Open in IMG/M |
| 3300010166|Ga0126306_11523251 | Not Available | 555 | Open in IMG/M |
| 3300010397|Ga0134124_13217971 | Not Available | 500 | Open in IMG/M |
| 3300010398|Ga0126383_12526455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300010857|Ga0126354_1139763 | Not Available | 521 | Open in IMG/M |
| 3300010862|Ga0126348_1189558 | Not Available | 546 | Open in IMG/M |
| 3300011415|Ga0137325_1062820 | Not Available | 805 | Open in IMG/M |
| 3300011422|Ga0137425_1166762 | Not Available | 549 | Open in IMG/M |
| 3300012668|Ga0157216_10484721 | Not Available | 534 | Open in IMG/M |
| 3300012897|Ga0157285_10191801 | Not Available | 636 | Open in IMG/M |
| 3300012912|Ga0157306_10167345 | Not Available | 710 | Open in IMG/M |
| 3300012958|Ga0164299_11170011 | Not Available | 580 | Open in IMG/M |
| 3300013096|Ga0157307_1131444 | Not Available | 564 | Open in IMG/M |
| 3300015077|Ga0173483_10164816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 991 | Open in IMG/M |
| 3300015077|Ga0173483_10517537 | Not Available | 640 | Open in IMG/M |
| 3300015371|Ga0132258_10101702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6773 | Open in IMG/M |
| 3300017792|Ga0163161_11074082 | Not Available | 691 | Open in IMG/M |
| 3300017936|Ga0187821_10090749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1120 | Open in IMG/M |
| 3300017997|Ga0184610_1188609 | Not Available | 686 | Open in IMG/M |
| 3300018053|Ga0184626_10083163 | Not Available | 1353 | Open in IMG/M |
| 3300018054|Ga0184621_10161134 | Not Available | 808 | Open in IMG/M |
| 3300018054|Ga0184621_10243560 | Not Available | 642 | Open in IMG/M |
| 3300018072|Ga0184635_10372241 | Not Available | 545 | Open in IMG/M |
| 3300018081|Ga0184625_10134437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300018083|Ga0184628_10041482 | Not Available | 2311 | Open in IMG/M |
| 3300018469|Ga0190270_10703753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300018469|Ga0190270_10866336 | Not Available | 917 | Open in IMG/M |
| 3300018469|Ga0190270_11509182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens | 721 | Open in IMG/M |
| 3300019233|Ga0184645_1347777 | Not Available | 516 | Open in IMG/M |
| 3300019269|Ga0184644_1303580 | Not Available | 512 | Open in IMG/M |
| 3300019279|Ga0184642_1151548 | Not Available | 682 | Open in IMG/M |
| 3300019377|Ga0190264_10984583 | Not Available | 671 | Open in IMG/M |
| 3300020020|Ga0193738_1021685 | Not Available | 2020 | Open in IMG/M |
| 3300020020|Ga0193738_1060425 | Not Available | 1131 | Open in IMG/M |
| 3300020020|Ga0193738_1154675 | Not Available | 610 | Open in IMG/M |
| 3300021082|Ga0210380_10017551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3020 | Open in IMG/M |
| 3300021082|Ga0210380_10103480 | Not Available | 1260 | Open in IMG/M |
| 3300022530|Ga0242658_1209505 | Not Available | 534 | Open in IMG/M |
| 3300025310|Ga0209172_10000133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 222640 | Open in IMG/M |
| 3300025917|Ga0207660_11055698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens | 662 | Open in IMG/M |
| 3300025918|Ga0207662_10206257 | Not Available | 1274 | Open in IMG/M |
| 3300027056|Ga0209879_1036257 | Not Available | 814 | Open in IMG/M |
| 3300027815|Ga0209726_10034028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3880 | Open in IMG/M |
| 3300027873|Ga0209814_10218793 | Not Available | 824 | Open in IMG/M |
| 3300027880|Ga0209481_10002898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7126 | Open in IMG/M |
| 3300027880|Ga0209481_10116569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1300 | Open in IMG/M |
| 3300027907|Ga0207428_10021134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5513 | Open in IMG/M |
| 3300027907|Ga0207428_10040797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3760 | Open in IMG/M |
| 3300027907|Ga0207428_10128017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1944 | Open in IMG/M |
| 3300027907|Ga0207428_10177431 | Not Available | 1611 | Open in IMG/M |
| 3300027909|Ga0209382_10021359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7858 | Open in IMG/M |
| 3300027909|Ga0209382_10077562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3920 | Open in IMG/M |
| 3300027909|Ga0209382_10205659 | Not Available | 2254 | Open in IMG/M |
| 3300027909|Ga0209382_10589439 | Not Available | 1212 | Open in IMG/M |
| 3300027957|Ga0209857_1050765 | Not Available | 731 | Open in IMG/M |
| 3300030570|Ga0247647_1205336 | Not Available | 564 | Open in IMG/M |
| 3300030592|Ga0247612_1096542 | Not Available | 672 | Open in IMG/M |
| 3300030990|Ga0308178_1172472 | Not Available | 510 | Open in IMG/M |
| 3300031576|Ga0247727_10002852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 38987 | Open in IMG/M |
| 3300031576|Ga0247727_10004790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28244 | Open in IMG/M |
| 3300031949|Ga0214473_11802867 | Not Available | 605 | Open in IMG/M |
| 3300034643|Ga0370545_159861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Citreicoccus → Citreicoccus inhibens | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 36.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.06% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.25% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.44% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.44% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.63% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_00938410 | 2170459005 | Grass Soil | MKTILSALLALSVLAGIVAPASAFDAQKFWDEHPTGSQR |
| ICChiseqgaiiDRAFT_03330031 | 3300000033 | Soil | MKILLSALLALSVLAGVAGSANALDPKTFWEENDRQTQ* |
| JGI1357J11328_101558032 | 3300000574 | Groundwater | MKTIVSALVALSVLAGIAAAPASAFDAKRFWDEHPTGSQR* |
| JGI10216J12902_1027279153 | 3300000956 | Soil | MKTLVSALVALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP* |
| JGI10216J12902_1071556012 | 3300000956 | Soil | MKAIVSALLALSVLAGVAGSANALDAKKFWDEHQTSGER* |
| Ga0062593_1012279871 | 3300004114 | Soil | MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER* |
| Ga0062593_1015749691 | 3300004114 | Soil | MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0063356_1046615581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKTLVSALLALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP* |
| Ga0062591_1004188651 | 3300004643 | Soil | MKTIVSVLVVLSVLAGVAGSANALDAKKFWDEHPTGGER* |
| Ga0058859_117134942 | 3300004798 | Host-Associated | TAMKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER* |
| Ga0070690_1002024743 | 3300005330 | Switchgrass Rhizosphere | MKTIVGVLVALSVLAGVAGSSNALDAKKFWDEHPTGGER* |
| Ga0070689_1009624051 | 3300005340 | Switchgrass Rhizosphere | MKTIVGVLVALSVLASVAGSASALDVKKFWDEHPTGGER* |
| Ga0070700_1007496782 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTIVSALIALSVLVGVADPANALDAKRFWDEHPTSGER* |
| Ga0070686_1009229241 | 3300005544 | Switchgrass Rhizosphere | MKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER* |
| Ga0066905_1003514821 | 3300005713 | Tropical Forest Soil | MKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER* |
| Ga0066905_1005352242 | 3300005713 | Tropical Forest Soil | MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSAQR* |
| Ga0066905_1015306412 | 3300005713 | Tropical Forest Soil | MKTLVSALIALTVLAGVVASANALDAKRFWDEHPTSGER* |
| Ga0075422_101089852 | 3300006196 | Populus Rhizosphere | MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGSER* |
| Ga0074049_124944611 | 3300006580 | Soil | MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGGER* |
| Ga0075428_1000748547 | 3300006844 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGWANALDVKKFWDEHPTSGER* |
| Ga0075428_1001561581 | 3300006844 | Populus Rhizosphere | MKTIVSALIALSVLAGAAGSANALDVKKFWDEHPTSGER* |
| Ga0075428_1001845395 | 3300006844 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER* |
| Ga0075428_1004276782 | 3300006844 | Populus Rhizosphere | MKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0075428_1004476732 | 3300006844 | Populus Rhizosphere | MKTIVSALIALSVLVGVVGPANALDAKKFWDEHPTSGER* |
| Ga0075428_1008068682 | 3300006844 | Populus Rhizosphere | MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR* |
| Ga0075428_1010540684 | 3300006844 | Populus Rhizosphere | AMKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER* |
| Ga0075428_1013476561 | 3300006844 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGEH* |
| Ga0075421_1001153285 | 3300006845 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDVKKFWDEHPTSGER* |
| Ga0075421_1012298742 | 3300006845 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGER* |
| Ga0075421_1013267161 | 3300006845 | Populus Rhizosphere | MKTIVFALIALSVLAGVAGSANALDVRKFWDEHPTSGER* |
| Ga0075430_1000058687 | 3300006846 | Populus Rhizosphere | MKTIISALIALSVLAGVAGSANALDVRKFWDEHPTSGER* |
| Ga0075433_109619821 | 3300006852 | Populus Rhizosphere | LSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR* |
| Ga0075433_114478202 | 3300006852 | Populus Rhizosphere | MKALVSALIALAVVAGVAGPADALDAKMFWDEHPTSGQR* |
| Ga0075433_116141462 | 3300006852 | Populus Rhizosphere | MKTIVSLLLALAVLTGVAGSANALDAKKFWDEHPTSGER* |
| Ga0075433_117149601 | 3300006852 | Populus Rhizosphere | MKIIVSALIALSVLVGIAAPAGAVSDPKTFWDQQERSQY* |
| Ga0073934_1000071395 | 3300006865 | Hot Spring Sediment | MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTSGQR* |
| Ga0075424_1007240011 | 3300006904 | Populus Rhizosphere | MKIIVSALIALSVLVGIAAPAGAVSDPKTFWDQQERS |
| Ga0074063_134650842 | 3300006953 | Soil | MKTLISALVALSVLAGIAAPASALDAKKFWDEHPTSSER* |
| Ga0111539_100023843 | 3300009094 | Populus Rhizosphere | MKTIVSLLVALTVLAGIAGPVNALDAKRFWDEHPTSGER* |
| Ga0111539_101017195 | 3300009094 | Populus Rhizosphere | MKALLSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR* |
| Ga0111539_116449102 | 3300009094 | Populus Rhizosphere | MKTLVSILVALSVLAGVAGAANALDGKRFWDEHATSGER* |
| Ga0111539_122504412 | 3300009094 | Populus Rhizosphere | MIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0105245_107343761 | 3300009098 | Miscanthus Rhizosphere | MIMKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0075418_100987665 | 3300009100 | Populus Rhizosphere | MKALVSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR* |
| Ga0075418_102302891 | 3300009100 | Populus Rhizosphere | MIMKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR* |
| Ga0075418_107698973 | 3300009100 | Populus Rhizosphere | DIAPTGGPAMKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER* |
| Ga0075418_116110511 | 3300009100 | Populus Rhizosphere | MKTILSALIALAVLAGAAGSANALDAKRFWDEHPTSGER* |
| Ga0075418_120369372 | 3300009100 | Populus Rhizosphere | MIMKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0066709_1001453035 | 3300009137 | Grasslands Soil | MKTILSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR* |
| Ga0105091_104415051 | 3300009146 | Freshwater Sediment | MKTIVGVLVALSVLAGVAGSAKALDAKKFWDEHPTGGER* |
| Ga0114129_118761981 | 3300009147 | Populus Rhizosphere | MIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPTSSQR* |
| Ga0114129_128310042 | 3300009147 | Populus Rhizosphere | MKIIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER* |
| Ga0111538_120199621 | 3300009156 | Populus Rhizosphere | TIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER* |
| Ga0111538_124411822 | 3300009156 | Populus Rhizosphere | MKTIVGVLVALSVLAGVAGSANALDVKKFWDEHPTGGER* |
| Ga0075423_104538862 | 3300009162 | Populus Rhizosphere | MIMKTILSALLALSVLAGIAAPASAFDAQKFWDEHPTGSQR* |
| Ga0075423_119525482 | 3300009162 | Populus Rhizosphere | MKTIVSALIALSVLPGMAAPASAALDPKKFWAEQGSPN* |
| Ga0075423_126718281 | 3300009162 | Populus Rhizosphere | MKTLVCALVALSVLAGVAAPASAFDAKKFWDEHPSGSQH* |
| Ga0105249_124247281 | 3300009553 | Switchgrass Rhizosphere | MKTIVSVLVALSVLAGVAGAANALDVKKFWDEHPTSGER* |
| Ga0105252_104429592 | 3300009678 | Soil | WRTIMKSVISALVALSVLAGIAAPASAFDAKKFWDEHPTSGQP* |
| Ga0105082_10233511 | 3300009814 | Groundwater Sand | MIMKTIVSTLVALSVLAGIPAPASAFDAKKFWDEHPTSSQR* |
| Ga0126382_122906532 | 3300010047 | Tropical Forest Soil | MKTIVSALIALSVLAGIAAPASALDAKKFWDEHPTSSER* |
| Ga0126306_115232511 | 3300010166 | Serpentine Soil | MKTLVSALIALAVVAGPANALDAKKFWDEHPTSGQR* |
| Ga0134124_132179711 | 3300010397 | Terrestrial Soil | VSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0126383_125264551 | 3300010398 | Tropical Forest Soil | MKAILSLLLALSVLTGVAGSASAFDAQKFWQEHPTSGER* |
| Ga0126354_11397632 | 3300010857 | Boreal Forest Soil | MKTIVSALLALSVLGGIAAAPASAEQFDAKKFWQEHHSY* |
| Ga0126348_11895583 | 3300010862 | Boreal Forest Soil | RIAMKTIVSALIAISVLAGVAAAPAAAFDAKTFWDQQSSSQGN* |
| Ga0137325_10628202 | 3300011415 | Soil | MKTLISALVALSVLAGIAAPASAFDAKKFWDEHPSGSQR* |
| Ga0137425_11667622 | 3300011422 | Soil | MKSVISALVALSVLAGIAAPASAFDAKKFWDVHPSGSQR* |
| Ga0157216_104847211 | 3300012668 | Glacier Forefield Soil | ETKMEMIMKTIVSALLALSVLAGVAGSANALDAKKFWQEHSTSGER* |
| Ga0157285_101918011 | 3300012897 | Soil | RAMKTIVSVLVVLSVLAGVAGSANALDAKKFWDEHPTGGER* |
| Ga0157306_101673451 | 3300012912 | Soil | MKTIVSALIALSVLVGVGGPANALDAKRFWDEHPTSGER* |
| Ga0164299_111700111 | 3300012958 | Soil | IMKTLVCALVALSVLAGVAAPASAFDAKKFWDEHPSGSQH* |
| Ga0157307_11314442 | 3300013096 | Soil | MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPT |
| Ga0173483_101648161 | 3300015077 | Soil | RMIMKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH* |
| Ga0173483_105175371 | 3300015077 | Soil | MKTIVSVLVALSVLAGVAGSANALDAKKFWDEHPTGGER* |
| Ga0132258_101017026 | 3300015371 | Arabidopsis Rhizosphere | MKTIVSVLVALSVLAGVAGSANALEAKVFWEQDKHQVY* |
| Ga0182032_109713771 | 3300016357 | Soil | MKTIISAVLALSVLAGVASSASAFDADKFWKEHPTSGER |
| Ga0163161_110740822 | 3300017792 | Switchgrass Rhizosphere | MKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER |
| Ga0187821_100907492 | 3300017936 | Freshwater Sediment | ISTLLALSVLAGIAAAPASAFDAKKFWDEHPTSSEH |
| Ga0184610_11886091 | 3300017997 | Groundwater Sediment | MKTLVSALVALSVLAGIAAPASALDAKKFWEQYDRTHSIN |
| Ga0184626_100831631 | 3300018053 | Groundwater Sediment | MKTLVSALVALSVFAGIAAPDSALDAKKFWEQHDRTHSIN |
| Ga0184621_101611341 | 3300018054 | Groundwater Sediment | MKTIVGVLVALSVLAGVAGSANALDVKKFWDEHPTGGER |
| Ga0184621_102435602 | 3300018054 | Groundwater Sediment | MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH |
| Ga0184635_103722412 | 3300018072 | Groundwater Sediment | MKTIVSLLVALAVLAGVAGSANALDAKRFWDEHPTSGER |
| Ga0184625_101344372 | 3300018081 | Groundwater Sediment | MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSQH |
| Ga0184628_100414825 | 3300018083 | Groundwater Sediment | MKTIVSALIALSVLAGVAGPANALDAKKFWDEHPTGGER |
| Ga0190270_107037532 | 3300018469 | Soil | MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTSSER |
| Ga0190270_108663364 | 3300018469 | Soil | MKTIVSALIALSVLVGVAGPANALDAKKFWDEHPTSGER |
| Ga0190270_115091822 | 3300018469 | Soil | MKTLVSALVALSVLAGIAAAPAAAFDAKKFWDEHPTSGQP |
| Ga0184645_13477772 | 3300019233 | Groundwater Sediment | MKTIVSALLALSVLAGIAAAPASAEQFDAKKFWQEHQSY |
| Ga0184644_13035802 | 3300019269 | Groundwater Sediment | MKTFVSALLALSVLAGIAAAPASAEQFDAKKFWQEHQSY |
| Ga0184642_11515483 | 3300019279 | Groundwater Sediment | MKTIVSALLALSVFAGIAAAPVSAADFDAKKFWEQHQSY |
| Ga0190264_109845831 | 3300019377 | Soil | NAALIVMEMIMKTIVSALLALSVLAGVAGSANALDAKKFWQEHSTSGER |
| Ga0193738_10216852 | 3300020020 | Soil | MKTILSALIALAVLVGAAGSAANALDAKRFWDEHPTSGER |
| Ga0193738_10604251 | 3300020020 | Soil | MKTLVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR |
| Ga0193738_11546751 | 3300020020 | Soil | MKTIVSALIALSVLAGVAGSANALDVKKFWEEHPTSGER |
| Ga0210380_100175514 | 3300021082 | Groundwater Sediment | MKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH |
| Ga0210380_101034803 | 3300021082 | Groundwater Sediment | MKTIVSVLVALSVLAGVAGSANALDAKKFWDEHPTGGER |
| Ga0242658_12095052 | 3300022530 | Soil | MKTILSTLIALSVLAGVAAAPAAAFDAKKFWIEHDSIGG |
| Ga0209172_1000013394 | 3300025310 | Hot Spring Sediment | MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTSGQR |
| Ga0207660_110556981 | 3300025917 | Corn Rhizosphere | MKTLVSALVALSVLAGIAAPASAFDAKKFWDEHPSGSEH |
| Ga0207662_102062571 | 3300025918 | Switchgrass Rhizosphere | MKTIVGVLVALSVLAGVAGSANALDAKKFWDEHPTGGER |
| Ga0209879_10362572 | 3300027056 | Groundwater Sand | MKTIVSALIALSVLVGIAGPANALDAKKFWDEHPTSGER |
| Ga0209726_100340283 | 3300027815 | Groundwater | MKTIVSALVALSVLAGIAAAPASAFDAKRFWDEHPTGSQR |
| Ga0209814_102187932 | 3300027873 | Populus Rhizosphere | MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSQR |
| Ga0209481_100028982 | 3300027880 | Populus Rhizosphere | MKTIVSALIALSVLVGVVGPANALDAKKFWDEHPTSGER |
| Ga0209481_101165693 | 3300027880 | Populus Rhizosphere | VSALIALSVLAGVAGSANALDVRKFWDEHPTSGER |
| Ga0207428_100211343 | 3300027907 | Populus Rhizosphere | MKTIVSALVALSVLAGIAAPASALDAKKFWDEHPTGSER |
| Ga0207428_100407975 | 3300027907 | Populus Rhizosphere | MKILLSALLALSVLAGVAGSANALDPKTFWEENDRQTQ |
| Ga0207428_101280172 | 3300027907 | Populus Rhizosphere | MKALVSALIALAVVAGVAGPANALDAKKFWDEHPTSGQR |
| Ga0207428_101774313 | 3300027907 | Populus Rhizosphere | MKTIVSLLLALAVLTGVAGSANALDAKKFWDEHPTSGER |
| Ga0209382_1002135911 | 3300027909 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDVRKFWDEHPTSGER |
| Ga0209382_100775625 | 3300027909 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGSANALDAKKFWDEHPTSGER |
| Ga0209382_102056592 | 3300027909 | Populus Rhizosphere | MKTIVFALIALSVLAGVAGSANALDVRKFWDEHPTSGER |
| Ga0209382_105894391 | 3300027909 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGWANALDVKKFWDEHPTSGER |
| Ga0209857_10507652 | 3300027957 | Groundwater Sand | MKIIVSALIALSVLAGVAGSANALDVKKFWDEHPTSGDR |
| Ga0247647_12053362 | 3300030570 | Soil | MKTIVSTLVALSVLAGIAAPASAFDAKKFWDEHPTSSK |
| Ga0247612_10965423 | 3300030592 | Soil | MKTILSALIALSVLAGVAGSANALDVKKFWDEHPTSGDR |
| Ga0308178_11724721 | 3300030990 | Soil | ASPGVRAMKTIVSALIALSVLVGVAGPANALDAKRFWDEHPTSGER |
| Ga0247727_100028526 | 3300031576 | Biofilm | MKTIVSALVALSVLAGIAAPASAFDAKKFWDEHPTGSQR |
| Ga0247727_100047905 | 3300031576 | Biofilm | MKTIVSALLALSMLAGVAGSANALDAKKFWEEHPTSGER |
| Ga0214473_118028672 | 3300031949 | Soil | MKTIVSALVALSVLAGIAVAPASAFDAKKFWDEHPTGGQR |
| Ga0370545_159861_370_495 | 3300034643 | Soil | MIMKTLVSALVALSVLVGIAAPASAFDAKKFWDEHPSGSQH |
| ⦗Top⦘ |